HHsearch alignment for GI: 254780766 and conserved domain: cd03279

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=99.53  E-value=9.3e-14  Score=108.99  Aligned_cols=67  Identities=24%  Similarity=0.364  Sum_probs=56.8

Q ss_pred             EEEEEEEEECCCCH-HHEEEECCC----CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCH---HHHHHCCCCC
Q ss_conf             18999999223254-553673279----8799986899864448999999728866667873---6887489832
Q gi|254780766|r    5 IKIKFLNISEFRNY-ASLRLVFDA----QHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY---ADVTRIGSPS   71 (375)
Q Consensus         5 M~i~~l~i~nFR~~-~~~~i~f~~----~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~---~~li~~~~~~   71 (375)
T Consensus         1 Mk~~~L~l~nF~~y~g~~~IDF~~~~~~~lflI~G~nGsGKSTIlDAI~~aLYGk~~r~~~~~~~~~~~~~ge~~   75 (213)
T cd03279           1 MKPLKLELKNFGPFREEQVIDFTGLDNNGLFLICGPTGAGKSTILDAITYALYGKTPRYGRQENLRSVFAPGEDT   75 (213)
T ss_pred             CEEEEEEEECCCCCCCCEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             905799997750458971784876787888999889999788999999999838882336641000244567844