HHsearch alignment for GI: 254780766 and conserved domain: cd03292

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=96.53  E-value=0.0022  Score=41.35  Aligned_cols=36  Identities=22%  Similarity=0.364  Sum_probs=26.5

Q ss_pred             CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH
Q ss_conf             32545536732798-7999868998644489999997
Q gi|254780766|r   15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL   50 (375)
Q Consensus        15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l   50 (375)
T Consensus        14 ~~aL~~vsl~i~~Ge~v~i~GpSGsGKSTLl~~i~gl   50 (214)
T cd03292          14 TAALDGINISISAGEFVFLVGPSGAGKSTLLKLIYKE   50 (214)
T ss_pred             CEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCC
T ss_conf             8998221779859989999979995399999999629