>cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=98.47 E-value=1.5e-06 Score=61.91 Aligned_cols=79 Identities=25% Similarity=0.211 Sum_probs=65.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) T Consensus 128 ~~LSGGq~QRVaiARAl~---------~~P~llllDEP~s~LD~~~~~~i~~~l~~l~~~~~~T~i~vTHd~~~a~~~aD 198 (235) T cd03299 128 ETLSGGEQQRVAIARALV---------VNPKILLLDEPFSALDVRTKEKLREELKKIRKEFGVTVLHVTHDFEEAWALAD 198 (235) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 458999999999999997---------38998999288764699999999999999999829999998789999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) T Consensus 199 r--i~vl~~G~iv~ 210 (235) T cd03299 199 K--VAIMLNGKLIQ 210 (235) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999

HHsearch alignment for GI: 254780766 and conserved domain: cd03299