HHsearch alignment for GI: 254780766 and conserved domain: cd03300

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=98.43  E-value=2.2e-06  Score=60.87  Aligned_cols=79  Identities=19%  Similarity=0.206  Sum_probs=65.2

Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC
Q ss_conf             312205899999999999999999870899789980122015989999999997417----9809998069678543212
Q gi|254780766|r  285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE  360 (375)
Q Consensus       285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~  360 (375)
T Consensus       129 ~~LSGGqkQRVaiARAl~---------~~P~llllDEP~s~LD~~~~~~i~~~l~~l~~~~~~T~i~VTHd~~ea~~lad  199 (232)
T cd03300         129 SQLSGGQQQRVAIARALV---------NEPKVLLLDEPLGALDLKLRKDMQLELKRLQKELGITFVFVTHDQEEALTMSD  199 (232)
T ss_pred             HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC
T ss_conf             669989999999999986---------59999998088764699999999999999999859999999999999999699


Q ss_pred             CEEEEEECCCEEEE
Q ss_conf             60079972896895
Q gi|254780766|r  361 TAKFMRISNHQALC  374 (375)
Q Consensus       361 ~~~~~~i~~g~~~~  374 (375)
T Consensus       200 r--i~vm~~G~i~~  211 (232)
T cd03300         200 R--IAVMNKGKIQQ  211 (232)
T ss_pred             E--EEEEECCEEEE
T ss_conf             9--99998999999