Query gi|254780766|ref|YP_003065179.1| recombination protein F [Candidatus Liberibacter asiaticus str. psy62] Match_columns 375 No_of_seqs 141 out of 2606 Neff 8.5 Searched_HMMs 39220 Date Tue May 31 15:31:22 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780766.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK00064 recF recombination pr 100.0 0 0 626.5 32.2 355 5-368 1-355 (355) 2 COG1195 RecF Recombinational D 100.0 0 0 610.1 29.0 361 5-373 1-362 (363) 3 TIGR00611 recf DNA replication 100.0 0 0 598.2 22.9 364 5-372 1-399 (399) 4 cd03242 ABC_RecF RecF is a rec 100.0 0 0 514.7 23.6 269 7-373 1-270 (270) 5 TIGR02169 SMC_prok_A chromosom 99.9 1.6E-26 4.2E-31 192.2 13.1 157 6-163 1-203 (1202) 6 TIGR02168 SMC_prok_B chromosom 99.9 2.5E-25 6.3E-30 184.5 12.3 144 6-151 1-173 (1191) 7 cd03272 ABC_SMC3_euk Eukaryoti 99.9 4.2E-24 1.1E-28 176.5 15.2 219 7-368 1-234 (243) 8 PRK10869 recombination and rep 99.9 5.3E-22 1.4E-26 162.8 23.0 153 7-168 2-172 (553) 9 cd03273 ABC_SMC2_euk Eukaryoti 99.9 1.1E-23 2.8E-28 173.8 14.1 227 5-370 1-246 (251) 10 cd03275 ABC_SMC1_euk Eukaryoti 99.9 2E-22 5.1E-27 165.6 16.5 214 7-358 1-225 (247) 11 COG3593 Predicted ATP-dependen 99.9 4.8E-21 1.2E-25 156.5 17.8 51 5-55 1-51 (581) 12 COG1196 Smc Chromosome segrega 99.9 1.5E-21 3.8E-26 159.9 15.0 141 5-147 1-164 (1163) 13 pfam02463 SMC_N RecF/RecN/SMC 99.9 6.6E-22 1.7E-26 162.2 12.6 141 6-148 1-163 (1162) 14 PRK02224 chromosome segregatio 99.9 6.9E-21 1.8E-25 155.5 17.3 142 5-147 1-158 (880) 15 COG0497 RecN ATPase involved i 99.9 4.2E-20 1.1E-24 150.4 21.0 154 7-169 2-173 (557) 16 PRK01156 chromosome segregatio 99.9 8.9E-21 2.3E-25 154.8 16.3 141 5-147 1-158 (895) 17 cd03274 ABC_SMC4_euk Eukaryoti 99.9 5.4E-21 1.4E-25 156.2 14.1 198 5-368 1-206 (212) 18 COG3950 Predicted ATP-binding 99.8 4.1E-20 1.1E-24 150.5 12.9 95 277-371 252-356 (440) 19 PRK03918 chromosome segregatio 99.8 5.4E-19 1.4E-23 143.2 17.5 86 273-361 778-866 (882) 20 TIGR00634 recN DNA repair prot 99.8 6.5E-18 1.7E-22 136.1 19.4 331 7-356 2-534 (605) 21 cd03239 ABC_SMC_head The struc 99.8 1.4E-18 3.6E-23 140.4 13.2 68 286-358 94-164 (178) 22 cd03241 ABC_RecN RecN ATPase i 99.8 1.3E-17 3.4E-22 134.1 16.5 228 7-364 1-245 (276) 23 COG0419 SbcC ATPase involved i 99.8 5.4E-19 1.4E-23 143.2 8.5 142 5-147 1-163 (908) 24 TIGR03185 DNA_S_dndD DNA sulfu 99.8 2E-16 5.1E-21 126.4 20.2 73 277-353 542-615 (650) 25 cd03276 ABC_SMC6_euk Eukaryoti 99.8 3.3E-17 8.3E-22 131.6 15.6 66 7-72 1-69 (198) 26 cd03278 ABC_SMC_barmotin Barmo 99.7 1.9E-16 4.8E-21 126.6 14.3 83 285-373 112-196 (197) 27 KOG0250 consensus 99.7 1.1E-15 2.9E-20 121.5 14.3 135 6-140 41-199 (1074) 28 cd03240 ABC_Rad50 The catalyti 99.7 9.3E-16 2.4E-20 122.1 11.7 81 286-372 115-201 (204) 29 COG4637 Predicted ATPase [Gene 99.7 2.3E-15 5.9E-20 119.5 13.0 73 284-363 268-342 (373) 30 cd03277 ABC_SMC5_euk Eukaryoti 99.7 2.2E-14 5.6E-19 113.1 17.0 69 6-74 2-73 (213) 31 KOG0979 consensus 99.6 1.2E-14 3E-19 114.8 13.6 120 6-129 21-150 (1072) 32 KOG0018 consensus 99.6 1E-14 2.6E-19 115.3 9.6 137 5-147 2-152 (1141) 33 KOG0933 consensus 99.6 3.5E-15 8.9E-20 118.3 6.8 122 5-127 1-141 (1174) 34 COG1106 Predicted ATPases [Gen 99.6 1.2E-13 3.1E-18 108.2 14.1 65 286-358 251-319 (371) 35 cd03279 ABC_sbcCD SbcCD and ot 99.5 9.3E-14 2.4E-18 109.0 10.6 67 5-71 1-75 (213) 36 PRK10246 exonuclease subunit S 99.5 9.9E-13 2.5E-17 102.3 14.8 145 5-151 1-179 (1047) 37 cd00267 ABC_ATPase ABC (ATP-bi 99.5 4.9E-13 1.2E-17 104.3 12.6 74 287-371 81-157 (157) 38 KOG0996 consensus 99.5 1.2E-13 3E-18 108.4 9.3 110 2-112 81-208 (1293) 39 PRK11231 fecE iron-dicitrate t 99.5 3.6E-12 9.2E-17 98.6 16.1 79 285-374 137-218 (255) 40 cd03264 ABC_drug_resistance_li 99.5 1.2E-11 3E-16 95.3 17.2 80 284-374 128-209 (211) 41 cd03224 ABC_TM1139_LivF_branch 99.5 1.8E-11 4.7E-16 94.0 17.4 79 285-374 131-212 (222) 42 cd03218 ABC_YhbG The ABC trans 99.5 1.4E-11 3.6E-16 94.7 16.6 80 284-374 131-213 (232) 43 PRK10895 putative ABC transpor 99.4 2.6E-11 6.7E-16 93.0 17.8 79 285-374 136-217 (241) 44 cd03230 ABC_DR_subfamily_A Thi 99.4 6.6E-12 1.7E-16 96.9 13.4 75 287-372 96-173 (173) 45 cd03221 ABCF_EF-3 ABCF_EF-3 E 99.4 7.7E-12 2E-16 96.5 13.3 74 287-371 71-144 (144) 46 PRK09984 phosphonate/organopho 99.4 3.7E-11 9.4E-16 92.0 16.7 79 285-374 151-233 (262) 47 cd03216 ABC_Carb_Monos_I This 99.4 2.3E-11 5.9E-16 93.3 13.6 77 287-374 83-162 (163) 48 cd03227 ABC_Class2 ABC-type Cl 99.3 2.4E-11 6.1E-16 93.3 11.6 66 287-357 78-146 (162) 49 cd03244 ABCC_MRP_domain2 Domai 99.3 1.3E-10 3.2E-15 88.6 14.6 77 286-374 139-217 (221) 50 cd03246 ABCC_Protease_Secretio 99.3 3.9E-11 9.9E-16 91.9 11.9 74 287-372 97-173 (173) 51 cd03247 ABCC_cytochrome_bd The 99.3 4.5E-11 1.2E-15 91.5 12.2 76 287-374 99-176 (178) 52 KOG0964 consensus 99.3 2.4E-11 6E-16 93.3 10.2 112 5-120 1-125 (1200) 53 PRK10851 sulfate/thiosulfate t 99.3 6.4E-10 1.6E-14 83.9 16.6 79 285-374 135-217 (352) 54 cd03228 ABCC_MRP_Like The MRP 99.3 1.3E-10 3.3E-15 88.5 12.4 73 287-371 97-171 (171) 55 COG1122 CbiO ABC-type cobalt t 99.3 2.8E-11 7.2E-16 92.8 8.7 79 285-374 137-219 (235) 56 cd03296 ABC_CysA_sulfate_impor 99.3 2.3E-09 5.8E-14 80.4 18.2 79 285-374 135-217 (239) 57 cd03369 ABCC_NFT1 Domain 2 of 99.2 7.7E-10 2E-14 83.4 14.6 77 286-374 125-203 (207) 58 pfam02463 SMC_N RecF/RecN/SMC 99.2 5.7E-09 1.5E-13 77.8 18.0 91 275-370 1066-1159(1162) 59 COG4938 Uncharacterized conser 99.2 9.8E-11 2.5E-15 89.3 7.4 46 7-53 2-47 (374) 60 TIGR00606 rad50 rad50; InterPr 99.2 1.6E-10 4.1E-15 87.8 8.5 157 6-166 2-195 (1328) 61 PRK10790 putative multidrug tr 99.1 5.3E-09 1.4E-13 77.9 14.9 78 285-374 475-554 (593) 62 KOG0964 consensus 99.1 2.1E-09 5.3E-14 80.6 12.6 199 153-368 970-1173(1200) 63 COG1196 Smc Chromosome segrega 99.1 1.6E-08 4E-13 74.9 16.9 93 273-370 1052-1147(1163) 64 COG3910 Predicted ATPase [Gene 99.1 2E-09 5.2E-14 80.7 12.1 65 306-372 139-206 (233) 65 KOG0962 consensus 99.1 4.9E-10 1.2E-14 84.7 7.6 60 6-65 3-65 (1294) 66 TIGR00618 sbcc exonuclease Sbc 99.1 2.4E-10 6E-15 86.8 5.3 59 5-63 1-66 (1063) 67 PRK03918 chromosome segregatio 99.1 6.2E-08 1.6E-12 71.0 17.7 84 5-89 1-85 (882) 68 PRK02224 chromosome segregatio 99.0 1E-07 2.6E-12 69.6 16.9 88 278-368 773-867 (880) 69 PRK11022 dppD dipeptide transp 99.0 7E-08 1.8E-12 70.7 15.8 77 286-373 153-233 (327) 70 TIGR02168 SMC_prok_B chromosom 99.0 4.3E-08 1.1E-12 72.0 14.5 164 154-355 999-1167(1191) 71 KOG0927 consensus 98.9 1.8E-07 4.7E-12 67.9 15.1 85 278-373 501-585 (614) 72 cd03266 ABC_NatA_sodium_export 98.9 1.7E-08 4.4E-13 74.6 9.1 81 284-375 134-217 (218) 73 PRK13647 cbiO cobalt transport 98.9 1.9E-08 4.7E-13 74.4 9.0 79 285-374 137-218 (273) 74 COG3839 MalK ABC-type sugar tr 98.9 6.8E-08 1.7E-12 70.7 11.6 79 285-374 132-214 (338) 75 cd03263 ABC_subfamily_A The AB 98.8 3.2E-08 8.2E-13 72.9 9.8 80 285-375 132-213 (220) 76 cd03267 ABC_NatA_like Similar 98.8 2.3E-08 5.9E-13 73.8 8.9 80 284-374 151-234 (236) 77 PRK13546 teichoic acids export 98.8 2.1E-08 5.5E-13 74.0 8.7 80 285-375 142-224 (264) 78 cd03265 ABC_DrrA DrrA is the A 98.8 2.2E-08 5.5E-13 74.0 8.7 81 284-375 129-213 (220) 79 PRK13638 cbiO cobalt transport 98.8 2.5E-08 6.4E-13 73.5 8.8 80 284-374 134-216 (271) 80 cd03269 ABC_putative_ATPase Th 98.8 5.7E-08 1.5E-12 71.2 9.7 80 284-374 126-208 (210) 81 PRK13636 cbiO cobalt transport 98.8 3.7E-08 9.4E-13 72.5 8.7 79 285-374 140-222 (285) 82 PRK13643 cbiO cobalt transport 98.8 4E-08 1E-12 72.2 8.8 78 286-374 144-224 (288) 83 COG3842 PotA ABC-type spermidi 98.8 3.4E-07 8.7E-12 66.2 13.5 79 285-374 135-217 (352) 84 cd03214 ABC_Iron-Siderophores_ 98.8 3.8E-08 9.6E-13 72.4 8.4 79 285-374 96-178 (180) 85 cd03226 ABC_cobalt_CbiO_domain 98.8 4.8E-08 1.2E-12 71.7 8.9 78 285-373 125-205 (205) 86 PRK13548 hmuV hemin importer A 98.8 5.2E-08 1.3E-12 71.5 8.8 85 285-374 133-220 (257) 87 cd03235 ABC_Metallic_Cations A 98.8 7E-08 1.8E-12 70.6 9.4 79 284-374 130-211 (213) 88 PRK10253 iron-enterobactin tra 98.8 8.1E-08 2.1E-12 70.2 9.6 79 285-374 142-224 (265) 89 PRK13639 cbiO cobalt transport 98.8 5.5E-08 1.4E-12 71.3 8.5 79 285-374 136-217 (275) 90 PRK10535 macrolide transporter 98.8 6.7E-08 1.7E-12 70.8 9.0 78 285-374 143-223 (648) 91 TIGR02169 SMC_prok_A chromosom 98.8 2.7E-07 6.8E-12 66.9 11.9 174 144-358 1000-1181(1202) 92 cd03220 ABC_KpsT_Wzt ABC_KpsT_ 98.8 8.8E-08 2.3E-12 70.0 9.4 79 285-374 141-222 (224) 93 PRK13536 nodulation factor exp 98.8 6.6E-08 1.7E-12 70.8 8.8 80 284-374 136-218 (306) 94 cd03298 ABC_ThiQ_thiamine_tran 98.7 9.7E-08 2.5E-12 69.7 9.5 79 285-374 127-209 (211) 95 PRK13649 cbiO cobalt transport 98.7 7.5E-08 1.9E-12 70.4 8.9 78 286-374 145-225 (280) 96 cd03256 ABC_PhnC_transporter A 98.7 9.7E-08 2.5E-12 69.7 9.4 79 285-374 143-225 (241) 97 PRK13652 cbiO cobalt transport 98.7 9.6E-08 2.4E-12 69.7 9.4 79 285-374 136-218 (277) 98 TIGR00972 3a0107s01c2 phosphat 98.7 3E-07 7.6E-12 66.5 11.7 71 286-365 144-216 (248) 99 PRK10575 iron-hydroxamate tran 98.7 8.6E-08 2.2E-12 70.1 8.9 79 285-374 146-228 (265) 100 PRK13537 lipooligosaccharide t 98.7 1.2E-07 3.2E-12 69.0 9.6 81 284-375 134-217 (304) 101 cd03268 ABC_BcrA_bacitracin_re 98.7 9.3E-08 2.4E-12 69.8 8.9 80 284-374 124-206 (208) 102 PRK01156 chromosome segregatio 98.7 1.6E-07 4.2E-12 68.2 10.1 95 273-370 788-888 (895) 103 COG4604 CeuD ABC-type enteroch 98.7 6.8E-07 1.7E-11 64.2 13.3 79 284-373 133-215 (252) 104 PRK13641 cbiO cobalt transport 98.7 9E-08 2.3E-12 69.9 8.7 78 286-374 145-225 (286) 105 PRK11614 livF leucine/isoleuci 98.7 1.3E-07 3.4E-12 68.8 9.5 79 285-374 136-217 (237) 106 PRK11247 ssuB aliphatic sulfon 98.7 1.3E-07 3.4E-12 68.8 9.4 79 285-374 132-214 (257) 107 PRK09536 btuD corrinoid ABC tr 98.7 1.5E-07 3.9E-12 68.4 9.7 80 284-374 136-218 (409) 108 PRK13637 cbiO cobalt transport 98.7 1.5E-07 3.8E-12 68.5 9.6 79 285-374 143-225 (287) 109 PRK13651 cobalt transporter AT 98.7 1.7E-07 4.2E-12 68.2 9.4 78 286-374 161-241 (304) 110 PRK13646 cbiO cobalt transport 98.7 1.7E-07 4.4E-12 68.1 9.4 79 285-374 144-226 (286) 111 PRK09544 znuC high-affinity zi 98.7 1.2E-07 3.1E-12 69.1 8.6 78 285-374 119-200 (251) 112 TIGR03410 urea_trans_UrtE urea 98.7 1.4E-07 3.5E-12 68.8 8.8 79 285-374 130-212 (230) 113 PRK13634 cbiO cobalt transport 98.7 1.9E-07 4.8E-12 67.9 9.4 78 286-374 132-213 (276) 114 PRK09493 glnQ glutamine ABC tr 98.7 1.4E-07 3.5E-12 68.7 8.6 79 285-374 135-216 (240) 115 PRK13547 hmuV hemin importer A 98.7 1.2E-07 3.1E-12 69.1 8.3 88 285-374 144-236 (273) 116 PRK11831 putative ABC transpor 98.7 2E-07 5.1E-12 67.6 9.4 79 285-374 143-225 (269) 117 cd03292 ABC_FtsE_transporter F 98.7 1.3E-07 3.3E-12 68.9 8.4 77 285-372 135-214 (214) 118 PRK11300 livG leucine/isoleuci 98.7 1.5E-07 3.8E-12 68.5 8.7 80 284-374 151-234 (255) 119 PRK13543 cytochrome c biogenes 98.7 1.6E-07 4E-12 68.4 8.8 75 285-370 136-213 (214) 120 COG0419 SbcC ATPase involved i 98.7 3.6E-06 9.1E-11 59.5 15.6 88 272-360 801-891 (908) 121 TIGR03522 GldA_ABC_ATP gliding 98.7 2.1E-07 5.4E-12 67.5 9.3 80 285-375 132-213 (301) 122 cd03234 ABCG_White The White s 98.7 2.5E-07 6.4E-12 67.0 9.6 79 285-374 142-224 (226) 123 cd03225 ABC_cobalt_CbiO_domain 98.7 1.2E-07 3E-12 69.2 7.9 76 285-371 133-211 (211) 124 PRK10908 cell division protein 98.7 2.2E-07 5.6E-12 67.4 9.2 77 286-373 137-216 (222) 125 PRK10771 thiQ thiamine transpo 98.7 2.7E-07 6.9E-12 66.8 9.5 79 285-374 128-210 (233) 126 PRK13645 cbiO cobalt transport 98.7 1.7E-07 4.4E-12 68.1 8.5 78 286-374 150-231 (289) 127 cd03217 ABC_FeS_Assembly ABC-t 98.7 2.5E-07 6.4E-12 67.0 9.3 77 287-374 105-185 (200) 128 cd03257 ABC_NikE_OppD_transpor 98.6 1.3E-07 3.3E-12 68.9 7.7 79 285-374 144-226 (228) 129 PRK13544 consensus 98.6 1.4E-07 3.6E-12 68.7 7.9 80 285-373 125-207 (208) 130 PRK13640 cbiO cobalt transport 98.6 2.8E-07 7.2E-12 66.7 9.2 78 285-374 143-224 (283) 131 PRK13650 cbiO cobalt transport 98.6 2.3E-07 5.9E-12 67.3 8.4 78 285-374 136-217 (276) 132 PRK13633 cobalt transporter AT 98.6 2.4E-07 6.1E-12 67.1 8.5 77 286-374 145-225 (281) 133 PRK10636 putative ABC transpor 98.6 3.1E-07 7.9E-12 66.4 8.9 81 283-374 427-507 (638) 134 COG1120 FepC ABC-type cobalami 98.6 2E-07 5E-12 67.7 7.9 79 285-374 137-219 (258) 135 cd03260 ABC_PstB_phosphate_tra 98.6 3.9E-07 1E-11 65.8 9.4 78 286-374 141-220 (227) 136 cd03237 ABC_RNaseL_inhibitor_d 98.6 3.3E-07 8.4E-12 66.3 9.0 79 285-374 114-197 (246) 137 cd03213 ABCG_EPDR ABCG transpo 98.6 4.2E-07 1.1E-11 65.6 9.3 77 287-374 112-192 (194) 138 PRK13648 cbiO cobalt transport 98.6 2.7E-07 6.9E-12 66.8 8.4 77 286-374 142-222 (269) 139 PRK13631 cbiO cobalt transport 98.6 4.1E-07 1E-11 65.6 9.3 78 286-374 176-256 (320) 140 TIGR01978 sufC FeS assembly AT 98.6 4.5E-06 1.1E-10 58.8 14.6 76 288-373 149-229 (248) 141 cd03259 ABC_Carb_Solutes_like 98.6 3.9E-07 1E-11 65.8 8.9 80 285-375 129-212 (213) 142 PRK10744 phosphate transporter 98.6 4.7E-07 1.2E-11 65.3 9.2 78 286-374 153-232 (257) 143 PRK11147 ABC transporter ATPas 98.6 3.9E-07 9.8E-12 65.8 8.8 81 283-374 437-518 (632) 144 PRK10418 nikD nickel transport 98.6 3.5E-07 9E-12 66.0 8.4 79 285-374 139-221 (254) 145 COG1131 CcmA ABC-type multidru 98.6 4.5E-07 1.1E-11 65.4 8.9 80 284-374 134-217 (293) 146 PRK11629 lolD lipoprotein tran 98.6 6.1E-07 1.6E-11 64.5 9.5 78 285-374 144-225 (233) 147 TIGR03411 urea_trans_UrtD urea 98.6 6.6E-07 1.7E-11 64.3 9.7 80 284-374 141-222 (242) 148 cd03233 ABC_PDR_domain1 The pl 98.6 5.3E-07 1.3E-11 64.9 9.1 78 286-374 118-200 (202) 149 PRK11701 phnK phosphonates tra 98.6 6.1E-07 1.6E-11 64.5 9.4 79 285-374 150-232 (258) 150 cd03215 ABC_Carb_Monos_II This 98.6 2.7E-07 6.9E-12 66.8 7.6 76 286-372 104-182 (182) 151 cd03236 ABC_RNaseL_inhibitor_d 98.6 5E-07 1.3E-11 65.1 8.8 83 284-375 137-222 (255) 152 PRK13538 cytochrome c biogenes 98.6 3.5E-07 8.9E-12 66.1 7.9 74 285-371 128-204 (204) 153 cd03261 ABC_Org_Solvent_Resist 98.6 7.3E-07 1.8E-11 64.0 9.4 79 285-374 135-217 (235) 154 PRK10584 putative ABC transpor 98.6 4.5E-07 1.1E-11 65.4 8.3 77 285-373 145-225 (228) 155 cd03219 ABC_Mj1267_LivG_branch 98.6 8.3E-07 2.1E-11 63.6 9.6 80 284-374 141-223 (236) 156 PRK11819 putative ABC transpor 98.5 7.8E-07 2E-11 63.8 9.4 81 283-374 442-523 (556) 157 PRK11124 artP arginine transpo 98.5 6.5E-07 1.6E-11 64.3 8.9 79 285-374 140-221 (242) 158 PRK10619 histidine/lysine/argi 98.5 5.9E-07 1.5E-11 64.6 8.6 78 286-374 152-232 (257) 159 PRK13644 cbiO cobalt transport 98.5 8.4E-07 2.1E-11 63.6 9.3 78 285-374 135-215 (274) 160 PRK13642 cbiO cobalt transport 98.5 5.9E-07 1.5E-11 64.6 8.5 78 285-374 139-220 (277) 161 PRK13632 cbiO cobalt transport 98.5 8.4E-07 2.1E-11 63.6 9.3 78 285-374 142-223 (273) 162 PRK11264 putative amino-acid A 98.5 6.8E-07 1.7E-11 64.2 8.8 78 286-374 142-222 (248) 163 cd03293 ABC_NrtD_SsuB_transpor 98.5 8.9E-07 2.3E-11 63.4 9.4 79 285-374 130-214 (220) 164 cd03245 ABCC_bacteriocin_expor 98.5 1.5E-06 3.7E-11 62.0 10.3 77 286-374 140-218 (220) 165 PRK13549 xylose transporter AT 98.5 1.1E-06 2.7E-11 62.9 9.6 78 286-374 405-485 (513) 166 cd03297 ABC_ModC_molybdenum_tr 98.5 1E-06 2.6E-11 63.0 9.4 79 285-374 130-212 (214) 167 cd03255 ABC_MJ0796_Lo1CDE_FtsE 98.5 6E-07 1.5E-11 64.6 8.2 76 285-372 139-218 (218) 168 CHL00131 ycf16 sulfate ABC tra 98.5 1.1E-06 2.9E-11 62.7 9.3 78 287-374 151-231 (252) 169 PRK03695 vitamin B12-transport 98.5 9.3E-07 2.4E-11 63.3 8.8 86 285-374 122-210 (245) 170 cd03295 ABC_OpuCA_Osmoprotecti 98.5 1.2E-06 3E-11 62.6 9.3 79 285-374 134-216 (242) 171 cd03251 ABCC_MsbA MsbA is an e 98.5 2.6E-06 6.6E-11 60.4 10.9 77 286-374 138-216 (234) 172 PRK09580 sufC cysteine desulfu 98.5 1.2E-06 3.2E-11 62.5 9.2 78 287-374 146-226 (248) 173 PRK13540 cytochrome c biogenes 98.5 4.4E-07 1.1E-11 65.4 6.8 64 285-357 126-192 (200) 174 cd03254 ABCC_Glucan_exporter_l 98.5 1.6E-06 4E-11 61.9 9.6 77 286-374 139-217 (229) 175 PRK13635 cbiO cobalt transport 98.5 1.3E-06 3.4E-11 62.3 9.2 77 286-374 140-220 (279) 176 cd03238 ABC_UvrA The excision 98.5 9E-07 2.3E-11 63.4 8.2 77 285-373 86-167 (176) 177 PRK10636 putative ABC transpor 98.5 1.4E-06 3.6E-11 62.1 9.1 80 284-374 147-226 (638) 178 PRK10762 D-ribose transporter 98.5 1.7E-06 4.4E-11 61.6 9.6 79 285-374 394-475 (501) 179 cd03299 ABC_ModC_like Archeal 98.5 1.5E-06 3.9E-11 61.9 9.3 79 285-374 128-210 (235) 180 PRK11819 putative ABC transpor 98.5 1E-06 2.6E-11 63.0 8.3 79 284-373 161-239 (556) 181 PRK11147 ABC transporter ATPas 98.5 1.3E-06 3.3E-11 62.3 8.7 80 284-374 154-233 (632) 182 cd03262 ABC_HisP_GlnQ_permease 98.5 1E-06 2.6E-11 63.0 8.2 77 285-372 134-213 (213) 183 PRK09452 potA putrescine/sperm 98.4 1.5E-06 3.9E-11 61.9 8.8 80 285-375 146-229 (378) 184 PRK11650 ugpC glycerol-3-phosp 98.4 1.7E-06 4.3E-11 61.6 9.0 79 285-374 133-215 (358) 185 cd03288 ABCC_SUR2 The SUR doma 98.4 4E-06 1E-10 59.2 10.8 77 286-374 156-234 (257) 186 PRK11288 araG L-arabinose tran 98.4 1.7E-06 4.4E-11 61.6 8.8 79 285-374 395-476 (501) 187 cd03289 ABCC_CFTR2 The CFTR su 98.4 3.3E-06 8.4E-11 59.7 10.2 77 286-374 138-216 (275) 188 cd03300 ABC_PotA_N PotA is an 98.4 2.2E-06 5.6E-11 60.9 9.3 79 285-374 129-211 (232) 189 cd03250 ABCC_MRP_domain1 Domai 98.4 2.5E-06 6.3E-11 60.5 9.4 74 286-371 127-204 (204) 190 PRK11153 metN DL-methionine tr 98.4 1.6E-06 4.1E-11 61.8 8.2 79 285-374 139-221 (343) 191 cd03229 ABC_Class3 This class 98.4 1.9E-06 4.8E-11 61.3 8.5 74 287-371 101-178 (178) 192 PRK10982 galactose/methyl gala 98.4 1.7E-06 4.3E-11 61.6 8.2 79 285-374 390-471 (491) 193 PRK11144 modC molybdate transp 98.4 2.4E-06 6.1E-11 60.6 9.0 79 285-374 127-209 (352) 194 COG4717 Uncharacterized conser 98.4 6.9E-06 1.8E-10 57.6 11.1 49 5-53 1-50 (984) 195 PRK11000 maltose/maltodextrin 98.4 1.6E-06 4.2E-11 61.7 7.8 79 285-374 132-214 (369) 196 cd03232 ABC_PDR_domain2 The pl 98.4 3.4E-06 8.7E-11 59.6 9.4 77 287-374 109-190 (192) 197 PRK13539 cytochrome c biogenes 98.4 9E-07 2.3E-11 63.4 6.3 66 284-358 124-192 (206) 198 cd03301 ABC_MalK_N The N-termi 98.4 3.6E-06 9.1E-11 59.5 9.3 79 285-374 129-211 (213) 199 cd03258 ABC_MetN_methionine_tr 98.4 2.3E-06 5.8E-11 60.8 8.2 79 285-374 139-221 (233) 200 PRK10247 putative ABC transpor 98.4 3.2E-06 8.1E-11 59.8 9.0 77 285-373 136-218 (225) 201 PRK11607 potG putrescine trans 98.4 3.4E-06 8.7E-11 59.6 9.1 79 285-374 148-230 (377) 202 PRK09700 D-allose transporter 98.4 3.8E-06 9.6E-11 59.4 9.2 80 285-375 408-490 (510) 203 cd03294 ABC_Pro_Gly_Bertaine T 98.4 4E-06 1E-10 59.2 9.2 79 285-374 159-241 (269) 204 PRK10762 D-ribose transporter 98.4 2.4E-06 6.2E-11 60.6 8.0 79 285-374 140-221 (501) 205 PRK10982 galactose/methyl gala 98.4 4.4E-06 1.1E-10 58.9 9.2 79 285-374 133-214 (491) 206 TIGR03269 met_CoM_red_A2 methy 98.3 5.1E-06 1.3E-10 58.5 9.3 79 285-374 426-508 (520) 207 TIGR03375 type_I_sec_LssB type 98.3 1.3E-05 3.3E-10 55.9 11.3 78 285-374 600-679 (694) 208 cd03248 ABCC_TAP TAP, the Tran 98.3 4.1E-06 1E-10 59.1 8.6 76 285-372 149-226 (226) 209 PRK10938 putative molybdenum t 98.3 5.6E-06 1.4E-10 58.2 9.3 80 284-373 399-482 (490) 210 cd03253 ABCC_ATM1_transporter 98.3 6E-06 1.5E-10 58.0 9.3 77 286-374 137-215 (236) 211 COG0488 Uup ATPase components 98.3 6.4E-06 1.6E-10 57.8 9.4 77 282-369 435-511 (530) 212 TIGR03415 ABC_choXWV_ATP choli 98.3 6.6E-06 1.7E-10 57.8 9.4 79 285-374 163-245 (382) 213 cd03231 ABC_CcmA_heme_exporter 98.3 3.1E-06 7.9E-11 59.9 7.6 69 284-361 123-194 (201) 214 cd03271 ABC_UvrA_II The excisi 98.3 3.8E-06 9.6E-11 59.3 8.0 81 285-374 168-257 (261) 215 PRK11248 tauB taurine transpor 98.3 5.2E-06 1.3E-10 58.5 8.6 75 285-370 127-205 (255) 216 TIGR03258 PhnT 2-aminoethylpho 98.3 7.2E-06 1.8E-10 57.5 9.3 79 285-374 136-219 (362) 217 PRK11174 cysteine/glutathione 98.3 1.3E-05 3.2E-10 55.9 10.5 77 286-374 485-563 (588) 218 cd03252 ABCC_Hemolysin The ABC 98.3 1.2E-05 3E-10 56.2 10.3 78 285-374 137-216 (237) 219 PTZ00265 multidrug resistance 98.3 8.4E-05 2.1E-09 50.6 14.6 78 285-373 1358-1442(1467) 220 PRK11288 araG L-arabinose tran 98.3 5.4E-06 1.4E-10 58.4 8.3 80 284-374 138-220 (501) 221 PRK10789 putative multidrug tr 98.3 1.7E-05 4.4E-10 55.0 10.8 77 286-374 451-529 (569) 222 cd03249 ABC_MTABC3_MDL1_MDL2 M 98.3 2.2E-05 5.6E-10 54.4 11.3 77 286-374 139-217 (238) 223 PRK11432 fbpC ferric transport 98.3 1E-05 2.6E-10 56.6 9.2 79 285-374 135-217 (351) 224 PRK10070 glycine betaine trans 98.2 1.1E-05 2.7E-10 56.4 9.2 79 285-374 163-245 (400) 225 PRK13549 xylose transporter AT 98.2 6.2E-06 1.6E-10 57.9 7.9 79 285-374 142-223 (513) 226 PRK11160 cysteine/glutathione 98.2 1.3E-05 3.3E-10 55.8 9.5 77 286-374 476-554 (575) 227 TIGR03269 met_CoM_red_A2 methy 98.2 1.1E-05 2.9E-10 56.3 9.0 79 285-374 167-249 (520) 228 PRK13657 cyclic beta-1,2-gluca 98.2 2.8E-05 7.2E-10 53.6 10.9 78 285-374 470-549 (585) 229 PRK11176 lipid transporter ATP 98.2 2.8E-05 7.1E-10 53.7 10.8 77 286-374 479-557 (581) 230 TIGR01188 drrA daunorubicin re 98.2 4.5E-06 1.1E-10 58.9 6.6 81 284-375 126-210 (343) 231 cd03222 ABC_RNaseL_inhibitor T 98.2 1.1E-05 2.8E-10 56.3 8.6 73 287-370 72-148 (177) 232 cd03291 ABCC_CFTR1 The CFTR su 98.2 1.8E-05 4.7E-10 54.8 9.7 77 286-374 159-238 (282) 233 PRK13541 cytochrome c biogenes 98.2 8.9E-06 2.3E-10 56.9 8.0 64 285-357 122-188 (195) 234 cd03223 ABCD_peroxisomal_ALDP 98.2 1.4E-05 3.7E-10 55.5 9.0 71 287-369 92-162 (166) 235 TIGR03265 PhnT2 putative 2-ami 98.2 1.7E-05 4.4E-10 55.1 9.3 79 285-374 133-215 (353) 236 KOG0059 consensus 98.2 8.1E-06 2.1E-10 57.2 7.6 82 283-375 695-779 (885) 237 PRK13542 consensus 98.2 6.9E-06 1.7E-10 57.6 6.9 60 284-352 145-207 (224) 238 TIGR01277 thiQ thiamine ABC tr 98.2 9.9E-06 2.5E-10 56.6 7.6 78 286-374 128-209 (213) 239 cd03270 ABC_UvrA_I The excisio 98.2 1.3E-05 3.3E-10 55.8 8.2 80 285-374 136-224 (226) 240 KOG0065 consensus 98.2 1.8E-05 4.5E-10 55.0 8.7 64 287-358 930-998 (1391) 241 PRK09700 D-allose transporter 98.2 1.9E-05 4.8E-10 54.8 8.8 80 284-374 143-225 (510) 242 KOG0927 consensus 98.1 5.2E-06 1.3E-10 58.5 5.9 78 285-373 220-298 (614) 243 PRK10419 nikE nickel transport 98.1 2.1E-05 5.3E-10 54.5 8.9 78 285-373 150-231 (266) 244 TIGR02673 FtsE cell division A 98.1 1.3E-05 3.4E-10 55.8 7.7 77 285-371 136-215 (215) 245 PRK10938 putative molybdenum t 98.1 6.2E-06 1.6E-10 57.9 5.9 34 15-48 16-50 (490) 246 PRK10261 glutathione transport 98.1 1.7E-05 4.4E-10 55.0 7.7 78 286-374 463-544 (623) 247 cd03290 ABCC_SUR1_N The SUR do 98.1 3.7E-05 9.5E-10 52.9 9.2 74 286-371 140-218 (218) 248 COG3840 ThiQ ABC-type thiamine 98.1 3.6E-05 9.2E-10 52.9 8.9 78 286-374 129-210 (231) 249 PRK09473 oppD oligopeptide tra 98.1 2.7E-05 6.9E-10 53.8 8.1 78 286-374 161-242 (330) 250 COG0488 Uup ATPase components 98.0 2.6E-05 6.6E-10 53.9 7.8 81 283-374 150-230 (530) 251 COG1118 CysA ABC-type sulfate/ 98.0 4E-05 1E-09 52.6 8.7 79 285-374 136-218 (345) 252 TIGR01166 cbiO cobalt ABC tran 98.0 1E-05 2.6E-10 56.5 5.6 63 283-354 124-189 (190) 253 COG1119 ModF ABC-type molybden 98.0 4.9E-05 1.2E-09 52.1 8.8 80 284-374 169-253 (257) 254 COG2274 SunT ABC-type bacterio 98.0 4E-05 1E-09 52.7 8.0 77 285-373 608-686 (709) 255 PRK11308 dppF dipeptide transp 98.0 7.1E-05 1.8E-09 51.0 9.2 78 286-374 154-235 (327) 256 PRK04863 mukB cell division pr 98.0 6.5E-05 1.7E-09 51.3 8.7 51 1-51 1-51 (1486) 257 PRK10522 multidrug transporter 98.0 0.00011 2.8E-09 49.8 9.6 77 286-374 449-529 (547) 258 COG1125 OpuBA ABC-type proline 97.9 6.9E-05 1.8E-09 51.1 8.3 78 285-373 134-215 (309) 259 KOG0933 consensus 97.9 0.00065 1.7E-08 44.8 13.3 72 283-359 1079-1152(1174) 260 COG1120 FepC ABC-type cobalami 97.9 3.5E-05 9E-10 53.0 6.7 32 18-49 18-50 (258) 261 TIGR03608 L_ocin_972_ABC putat 97.9 4.9E-05 1.3E-09 52.1 7.4 66 285-360 133-201 (206) 262 TIGR01186 proV glycine betaine 97.9 2.3E-05 5.9E-10 54.2 5.5 78 286-375 130-212 (372) 263 PRK13539 cytochrome c biogenes 97.9 2.1E-05 5.3E-10 54.5 4.9 39 10-48 10-49 (206) 264 COG1121 ZnuC ABC-type Mn/Zn tr 97.9 0.0001 2.6E-09 50.0 8.4 75 284-369 137-214 (254) 265 COG1136 SalX ABC-type antimicr 97.9 9.3E-05 2.4E-09 50.3 8.1 77 285-373 141-221 (226) 266 COG1137 YhbG ABC-type (unclass 97.9 0.0001 2.6E-09 50.0 8.0 79 285-374 138-219 (243) 267 KOG0055 consensus 97.9 0.00033 8.5E-09 46.6 10.6 77 285-373 488-566 (1228) 268 COG1123 ATPase components of v 97.8 0.00022 5.6E-09 47.8 9.1 77 286-373 429-509 (539) 269 COG4694 Uncharacterized protei 97.8 0.00046 1.2E-08 45.7 10.7 67 285-353 528-598 (758) 270 TIGR00955 3a01204 Pigment prec 97.8 9.1E-05 2.3E-09 50.3 7.1 76 286-373 175-255 (671) 271 COG4988 CydD ABC-type transpor 97.8 0.00022 5.6E-09 47.8 8.9 78 286-375 456-535 (559) 272 PRK09544 znuC high-affinity zi 97.8 5.1E-05 1.3E-09 52.0 5.5 48 1-48 1-51 (251) 273 COG1126 GlnQ ABC-type polar am 97.8 0.00025 6.3E-09 47.5 8.9 79 285-374 135-216 (240) 274 COG2884 FtsE Predicted ATPase 97.8 0.00021 5.3E-09 48.0 8.5 78 285-373 136-216 (223) 275 KOG0018 consensus 97.8 6.5E-05 1.7E-09 51.3 5.8 70 284-358 1049-1118(1141) 276 PRK13409 putative ATPase RIL; 97.8 0.00022 5.6E-09 47.8 8.4 78 284-370 451-532 (590) 277 PRK10261 glutathione transport 97.7 0.00033 8.4E-09 46.7 9.2 78 286-374 168-249 (623) 278 COG1135 AbcC ABC-type metal io 97.7 0.00025 6.4E-09 47.4 8.3 78 285-373 140-221 (339) 279 PRK13542 consensus 97.7 9.2E-05 2.3E-09 50.3 5.7 45 5-50 19-67 (224) 280 COG1132 MdlB ABC-type multidru 97.7 0.00064 1.6E-08 44.8 10.0 78 285-374 464-543 (567) 281 COG4175 ProV ABC-type proline/ 97.7 0.0003 7.7E-09 46.9 8.3 79 285-375 163-246 (386) 282 PRK10253 iron-enterobactin tra 97.7 4.7E-05 1.2E-09 52.2 4.1 48 1-48 1-54 (265) 283 COG3638 ABC-type phosphate/pho 97.7 0.00022 5.6E-09 47.8 7.5 79 284-373 145-227 (258) 284 PRK03695 vitamin B12-transport 97.7 5.3E-05 1.4E-09 51.8 4.3 41 6-48 3-44 (245) 285 COG4615 PvdE ABC-type sideroph 97.7 0.0001 2.6E-09 50.0 5.7 85 277-373 439-527 (546) 286 COG0411 LivG ABC-type branched 97.7 0.0002 5.1E-09 48.1 7.2 79 285-374 148-230 (250) 287 PRK13538 cytochrome c biogenes 97.7 6.1E-05 1.6E-09 51.4 4.5 33 16-48 15-48 (204) 288 KOG0062 consensus 97.7 0.00027 6.9E-09 47.2 7.7 79 285-374 481-559 (582) 289 CHL00131 ycf16 sulfate ABC tra 97.7 5.7E-05 1.5E-09 51.6 4.3 42 7-48 9-53 (252) 290 COG4987 CydC ABC-type transpor 97.6 0.00041 1E-08 46.0 8.3 76 286-373 474-551 (573) 291 cd03234 ABCG_White The White s 97.6 4E-05 1E-09 52.7 3.0 33 16-48 21-54 (226) 292 PRK13548 hmuV hemin importer A 97.6 8E-05 2E-09 50.7 4.5 35 14-48 14-49 (257) 293 PRK10619 histidine/lysine/argi 97.6 0.00014 3.6E-09 49.1 5.7 37 14-50 17-54 (257) 294 PRK13409 putative ATPase RIL; 97.6 0.00047 1.2E-08 45.6 8.4 69 284-361 210-280 (590) 295 PRK13544 consensus 97.6 7.9E-05 2E-09 50.7 4.3 36 13-48 12-48 (208) 296 PRK10575 iron-hydroxamate tran 97.6 8.1E-05 2.1E-09 50.6 4.3 33 16-48 25-58 (265) 297 PRK13638 cbiO cobalt transport 97.6 8E-05 2E-09 50.7 4.3 35 14-48 13-48 (271) 298 TIGR00968 3a0106s01 sulfate AB 97.6 0.0003 7.6E-09 47.0 7.0 80 285-375 133-216 (241) 299 cd03235 ABC_Metallic_Cations A 97.6 9E-05 2.3E-09 50.4 4.3 38 11-48 8-46 (213) 300 TIGR02857 CydD ABC transporter 97.6 0.00028 7.1E-09 47.1 6.9 67 286-358 495-564 (570) 301 PRK13543 cytochrome c biogenes 97.6 9E-05 2.3E-09 50.3 4.3 43 6-48 13-58 (214) 302 COG1127 Ttg2A ABC-type transpo 97.6 0.0006 1.5E-08 45.0 8.5 79 285-374 144-226 (263) 303 COG1121 ZnuC ABC-type Mn/Zn tr 97.6 0.00016 4E-09 48.8 5.6 46 2-48 2-51 (254) 304 TIGR00960 3a0501s02 Type II (G 97.6 0.00022 5.7E-09 47.8 6.3 77 285-372 137-216 (216) 305 pfam04310 MukB MukB N-terminal 97.6 9.8E-05 2.5E-09 50.1 4.5 51 1-51 1-51 (227) 306 TIGR03411 urea_trans_UrtD urea 97.6 0.0001 2.6E-09 50.0 4.5 36 13-48 13-49 (242) 307 cd03217 ABC_FeS_Assembly ABC-t 97.6 1E-04 2.5E-09 50.1 4.2 35 14-48 12-47 (200) 308 PRK13547 hmuV hemin importer A 97.5 0.0001 2.6E-09 50.0 4.1 31 18-48 17-48 (273) 309 TIGR01189 ccmA heme ABC export 97.5 0.0002 5.1E-09 48.1 5.6 65 282-355 127-194 (204) 310 COG4133 CcmA ABC-type transpor 97.5 0.00022 5.6E-09 47.8 5.7 65 283-356 127-194 (209) 311 cd03268 ABC_BcrA_bacitracin_re 97.5 0.0001 2.7E-09 49.9 4.0 35 14-48 12-47 (208) 312 COG1131 CcmA ABC-type multidru 97.5 8.1E-05 2.1E-09 50.6 3.4 34 15-48 18-52 (293) 313 cd03237 ABC_RNaseL_inhibitor_d 97.5 9E-05 2.3E-09 50.3 3.7 31 18-48 10-46 (246) 314 COG1117 PstB ABC-type phosphat 97.5 0.00039 1E-08 46.2 6.9 76 287-373 150-227 (253) 315 PRK11831 putative ABC transpor 97.5 0.00018 4.6E-09 48.4 5.1 48 2-49 6-56 (269) 316 PTZ00243 ABC transporter; Prov 97.5 0.0011 2.8E-08 43.2 9.1 79 285-373 1444-1523(1560) 317 cd03232 ABC_PDR_domain2 The pl 97.5 7.7E-05 2E-09 50.8 3.2 31 18-48 23-54 (192) 318 cd03226 ABC_cobalt_CbiO_domain 97.5 8.8E-05 2.2E-09 50.4 3.5 32 17-48 15-47 (205) 319 TIGR01189 ccmA heme ABC export 97.5 5.7E-05 1.5E-09 51.6 2.5 31 18-48 16-47 (204) 320 cd03259 ABC_Carb_Solutes_like 97.5 0.00014 3.6E-09 49.1 4.4 36 13-48 11-47 (213) 321 TIGR02680 TIGR02680 conserved 97.5 0.00038 9.6E-09 46.3 6.6 63 287-349 1309-1376(1416) 322 TIGR02315 ABC_phnC phosphonate 97.5 0.00019 4.8E-09 48.3 5.0 79 284-373 153-235 (253) 323 cd03238 ABC_UvrA The excision 97.5 0.00011 2.9E-09 49.7 3.8 37 13-49 6-43 (176) 324 cd03269 ABC_putative_ATPase Th 97.5 0.00012 3E-09 49.5 4.0 35 14-48 12-47 (210) 325 PRK11248 tauB taurine transpor 97.5 0.00015 3.7E-09 49.0 4.3 35 15-49 14-49 (255) 326 COG4674 Uncharacterized ABC-ty 97.5 5.1E-05 1.3E-09 52.0 1.9 81 283-374 144-226 (249) 327 PRK11300 livG leucine/isoleuci 97.5 0.00016 4.2E-09 48.6 4.5 43 6-48 7-52 (255) 328 PRK11614 livF leucine/isoleuci 97.5 0.00016 4.2E-09 48.7 4.5 34 15-48 18-52 (237) 329 cd03225 ABC_cobalt_CbiO_domain 97.5 0.0001 2.6E-09 50.0 3.4 31 18-48 17-48 (211) 330 TIGR01271 CFTR_protein cystic 97.5 0.00076 1.9E-08 44.3 7.9 87 268-371 1381-1469(1534) 331 PRK11701 phnK phosphonates tra 97.5 0.00018 4.6E-09 48.4 4.6 34 15-48 19-53 (258) 332 PRK13546 teichoic acids export 97.5 5.5E-05 1.4E-09 51.7 1.9 36 13-48 35-71 (264) 333 cd03214 ABC_Iron-Siderophores_ 97.5 0.00017 4.4E-09 48.5 4.4 35 14-48 11-46 (180) 334 KOG0996 consensus 97.5 0.00027 7E-09 47.2 5.4 81 284-369 1193-1275(1293) 335 COG1124 DppF ABC-type dipeptid 97.5 0.00094 2.4E-08 43.7 8.1 77 286-373 141-221 (252) 336 PRK13642 cbiO cobalt transport 97.4 0.00026 6.5E-09 47.4 5.2 48 1-48 1-54 (277) 337 COG1116 TauB ABC-type nitrate/ 97.4 0.001 2.6E-08 43.4 8.3 75 285-370 129-207 (248) 338 COG4559 ABC-type hemin transpo 97.4 0.00018 4.5E-09 48.4 4.3 85 285-374 134-221 (259) 339 PRK09536 btuD corrinoid ABC tr 97.4 0.00018 4.5E-09 48.4 4.2 35 14-48 14-49 (409) 340 PRK13541 cytochrome c biogenes 97.4 0.00011 2.9E-09 49.7 3.2 29 20-48 18-47 (195) 341 cd03263 ABC_subfamily_A The AB 97.4 0.00013 3.3E-09 49.3 3.5 31 18-48 18-49 (220) 342 cd03255 ABC_MJ0796_Lo1CDE_FtsE 97.4 0.00031 7.9E-09 46.8 5.4 33 18-50 20-53 (218) 343 PRK09580 sufC cysteine desulfu 97.4 0.00019 4.9E-09 48.2 4.2 35 14-48 13-48 (248) 344 cd03267 ABC_NatA_like Similar 97.4 0.00013 3.3E-09 49.3 3.3 31 18-48 37-68 (236) 345 cd03266 ABC_NatA_sodium_export 97.4 0.00014 3.6E-09 49.1 3.3 32 17-48 20-52 (218) 346 cd03233 ABC_PDR_domain1 The pl 97.4 0.00014 3.6E-09 49.1 3.4 31 18-48 23-54 (202) 347 PRK10247 putative ABC transpor 97.4 0.00037 9.3E-09 46.4 5.5 31 18-48 23-54 (225) 348 PRK13647 cbiO cobalt transport 97.4 0.00037 9.5E-09 46.3 5.5 48 1-48 1-52 (273) 349 PRK13540 cytochrome c biogenes 97.4 0.00023 5.9E-09 47.7 4.4 35 14-48 13-48 (200) 350 TIGR03522 GldA_ABC_ATP gliding 97.4 0.00018 4.7E-09 48.3 3.9 35 14-48 14-49 (301) 351 PRK13545 tagH teichoic acids e 97.4 0.0021 5.4E-08 41.4 9.3 34 15-48 37-71 (549) 352 cd03231 ABC_CcmA_heme_exporter 97.4 0.00016 4.1E-09 48.7 3.4 31 18-48 16-47 (201) 353 COG4161 ArtP ABC-type arginine 97.4 0.0011 2.8E-08 43.2 7.7 76 286-373 141-220 (242) 354 PRK11607 potG putrescine trans 97.4 0.00039 1E-08 46.2 5.3 49 1-49 16-67 (377) 355 PRK11144 modC molybdate transp 97.4 0.00028 7.1E-09 47.2 4.5 31 20-50 16-47 (352) 356 TIGR02211 LolD_lipo_ex lipopro 97.4 0.00094 2.4E-08 43.7 7.2 76 286-373 141-220 (221) 357 PRK13636 cbiO cobalt transport 97.4 0.00018 4.6E-09 48.4 3.5 32 17-48 21-53 (285) 358 PRK13646 cbiO cobalt transport 97.3 0.00019 4.9E-09 48.2 3.5 32 17-48 22-54 (286) 359 cd03220 ABC_KpsT_Wzt ABC_KpsT_ 97.3 0.0002 5E-09 48.1 3.6 36 15-50 35-71 (224) 360 PRK09493 glnQ glutamine ABC tr 97.3 0.00028 7.2E-09 47.1 4.4 33 17-49 16-49 (240) 361 PRK11124 artP arginine transpo 97.3 0.00036 9.3E-09 46.4 4.8 34 16-49 16-50 (242) 362 cd03213 ABCG_EPDR ABCG transpo 97.3 0.00018 4.5E-09 48.4 3.1 31 18-48 25-56 (194) 363 cd03271 ABC_UvrA_II The excisi 97.3 0.00028 7.1E-09 47.2 4.1 32 18-49 11-43 (261) 364 PRK13644 cbiO cobalt transport 97.3 0.00021 5.3E-09 48.0 3.4 32 17-48 17-49 (274) 365 PTZ00265 multidrug resistance 97.3 0.0028 7.2E-08 40.6 9.2 31 18-48 401-432 (1467) 366 PRK13639 cbiO cobalt transport 97.3 0.00021 5.3E-09 48.0 3.4 34 16-49 16-50 (275) 367 cd03256 ABC_PhnC_transporter A 97.3 0.00022 5.5E-09 47.9 3.4 34 17-50 16-50 (241) 368 COG4586 ABC-type uncharacteriz 97.3 0.0016 4.1E-08 42.2 7.8 79 285-374 155-237 (325) 369 PRK11264 putative amino-acid A 97.3 0.00036 9.2E-09 46.4 4.5 33 18-50 17-50 (248) 370 PRK11247 ssuB aliphatic sulfon 97.3 0.00035 9E-09 46.5 4.3 32 18-49 28-60 (257) 371 cd03219 ABC_Mj1267_LivG_branch 97.3 0.00044 1.1E-08 45.9 4.6 36 13-48 11-47 (236) 372 PRK10744 phosphate transporter 97.3 0.0004 1E-08 46.1 4.4 36 15-50 23-59 (257) 373 PRK13651 cobalt transporter AT 97.3 0.00027 6.9E-09 47.2 3.5 33 16-48 21-54 (304) 374 cd03223 ABCD_peroxisomal_ALDP 97.3 0.00026 6.8E-09 47.3 3.4 31 18-48 17-48 (166) 375 TIGR03410 urea_trans_UrtE urea 97.3 0.00042 1.1E-08 46.0 4.5 34 15-48 13-47 (230) 376 cd03250 ABCC_MRP_domain1 Domai 97.2 0.00029 7.3E-09 47.1 3.5 31 18-48 21-52 (204) 377 cd03265 ABC_DrrA DrrA is the A 97.2 0.00033 8.5E-09 46.6 3.8 35 14-48 12-47 (220) 378 cd03293 ABC_NrtD_SsuB_transpor 97.2 0.00027 6.9E-09 47.2 3.3 33 17-49 19-52 (220) 379 PRK13537 lipooligosaccharide t 97.2 0.00036 9.1E-09 46.5 3.9 31 18-48 21-52 (304) 380 COG4559 ABC-type hemin transpo 97.2 0.0023 5.9E-08 41.1 8.0 40 9-48 8-48 (259) 381 PRK13645 cbiO cobalt transport 97.2 0.00086 2.2E-08 43.9 5.8 47 2-48 4-58 (289) 382 PRK10418 nikD nickel transport 97.2 0.0006 1.5E-08 45.0 5.0 48 1-48 1-50 (254) 383 TIGR01166 cbiO cobalt ABC tran 97.2 0.00024 6.2E-09 47.5 3.0 30 19-48 9-39 (190) 384 PRK10908 cell division protein 97.2 0.00029 7.4E-09 47.0 3.2 33 17-49 17-50 (222) 385 PRK13648 cbiO cobalt transport 97.2 0.00074 1.9E-08 44.4 5.3 31 18-48 25-56 (269) 386 PRK13632 cbiO cobalt transport 97.2 0.00071 1.8E-08 44.5 5.2 31 18-48 26-57 (273) 387 PRK13649 cbiO cobalt transport 97.2 0.00033 8.5E-09 46.6 3.5 32 17-48 22-54 (280) 388 TIGR02324 CP_lyasePhnL phospho 97.2 0.00023 5.8E-09 47.7 2.6 51 283-343 147-197 (224) 389 PRK13536 nodulation factor exp 97.2 0.00044 1.1E-08 45.9 4.1 34 16-49 21-55 (306) 390 PRK13641 cbiO cobalt transport 97.2 0.0003 7.5E-09 47.0 3.1 31 18-48 23-54 (286) 391 PRK10771 thiQ thiamine transpo 97.2 0.00042 1.1E-08 46.0 3.9 28 21-48 18-46 (233) 392 pfam12128 DUF3584 Protein of u 97.2 0.0033 8.5E-08 40.1 8.4 33 19-52 9-42 (1192) 393 PRK13635 cbiO cobalt transport 97.2 0.00035 9E-09 46.5 3.2 31 18-48 23-54 (279) 394 cd03298 ABC_ThiQ_thiamine_tran 97.1 0.00047 1.2E-08 45.6 3.8 29 21-49 17-46 (211) 395 TIGR00958 3a01208 antigen pept 97.1 0.00027 6.9E-09 47.2 2.6 78 284-373 668-751 (770) 396 cd03270 ABC_UvrA_I The excisio 97.1 0.00047 1.2E-08 45.7 3.7 27 18-44 11-38 (226) 397 TIGR01187 potA polyamine ABC t 97.1 0.0035 8.9E-08 40.0 8.2 77 285-373 99-180 (331) 398 TIGR02982 heterocyst_DevA ABC 97.1 0.00074 1.9E-08 44.4 4.6 76 285-372 140-219 (220) 399 COG0444 DppD ABC-type dipeptid 97.1 0.005 1.3E-07 39.0 8.8 77 286-373 153-233 (316) 400 PRK13633 cobalt transporter AT 97.1 0.0013 3.2E-08 42.9 5.7 31 18-48 27-58 (281) 401 PRK13650 cbiO cobalt transport 97.1 0.0004 1E-08 46.1 3.2 33 17-49 19-52 (276) 402 PRK13634 cbiO cobalt transport 97.1 0.0004 1E-08 46.1 3.1 33 18-50 10-43 (276) 403 KOG0057 consensus 97.1 0.004 1E-07 39.6 8.3 77 285-373 486-564 (591) 404 cd03297 ABC_ModC_molybdenum_tr 97.1 0.00076 1.9E-08 44.3 4.6 36 15-50 10-46 (214) 405 KOG0061 consensus 97.1 0.0005 1.3E-08 45.5 3.5 57 287-352 171-229 (613) 406 COG4717 Uncharacterized conser 97.1 0.0037 9.4E-08 39.8 7.9 91 263-356 875-971 (984) 407 KOG0962 consensus 97.1 0.0023 6E-08 41.1 6.8 82 285-369 1182-1274(1294) 408 TIGR01194 cyc_pep_trnsptr cycl 97.1 0.00044 1.1E-08 45.9 3.0 84 278-373 461-549 (555) 409 PRK10535 macrolide transporter 97.1 0.0011 2.9E-08 43.1 5.2 50 1-50 1-57 (648) 410 COG4133 CcmA ABC-type transpor 97.1 0.00057 1.5E-08 45.1 3.6 36 15-50 15-51 (209) 411 PRK13637 cbiO cobalt transport 97.1 0.00049 1.2E-08 45.6 3.2 32 17-48 22-54 (287) 412 cd03290 ABCC_SUR1_N The SUR do 97.1 0.00057 1.5E-08 45.1 3.5 31 18-48 17-48 (218) 413 cd03248 ABCC_TAP TAP, the Tran 97.1 0.00055 1.4E-08 45.2 3.4 31 18-48 30-61 (226) 414 PRK13631 cbiO cobalt transport 97.0 0.00053 1.4E-08 45.3 3.3 32 17-48 41-73 (320) 415 PRK13652 cbiO cobalt transport 97.0 0.00054 1.4E-08 45.3 3.3 32 17-48 19-51 (277) 416 COG4148 ModC ABC-type molybdat 97.0 0.0046 1.2E-07 39.2 7.9 77 287-374 129-209 (352) 417 TIGR02868 CydC ABC transporter 97.0 0.0026 6.7E-08 40.8 6.6 48 285-341 500-548 (566) 418 COG1134 TagH ABC-type polysacc 97.0 0.0075 1.9E-07 37.8 9.0 80 284-374 145-227 (249) 419 cd03260 ABC_PstB_phosphate_tra 97.0 0.0011 2.7E-08 43.3 4.6 37 14-50 12-49 (227) 420 TIGR00606 rad50 rad50; InterPr 97.0 0.0029 7.4E-08 40.5 6.8 83 285-370 1207-1308(1328) 421 COG4152 ABC-type uncharacteriz 97.0 0.003 7.5E-08 40.4 6.8 76 285-372 129-208 (300) 422 PTZ00243 ABC transporter; Prov 97.0 0.013 3.3E-07 36.3 9.9 30 18-47 676-706 (1560) 423 PRK11629 lolD lipoprotein tran 97.0 0.00076 1.9E-08 44.3 3.6 32 18-49 25-57 (233) 424 cd03291 ABCC_CFTR1 The CFTR su 97.0 0.00078 2E-08 44.2 3.5 31 18-48 53-84 (282) 425 cd03301 ABC_MalK_N The N-termi 97.0 0.00094 2.4E-08 43.7 3.9 34 16-49 14-48 (213) 426 COG1123 ATPase components of v 97.0 0.0088 2.2E-07 37.4 8.9 77 286-373 154-234 (539) 427 COG0410 LivF ABC-type branched 96.9 0.00091 2.3E-08 43.8 3.6 78 285-374 135-217 (237) 428 PRK09452 potA putrescine/sperm 96.9 0.0021 5.4E-08 41.4 5.5 48 1-48 14-64 (378) 429 COG4555 NatA ABC-type Na+ tran 96.9 0.0092 2.3E-07 37.2 8.7 77 287-374 134-213 (245) 430 cd03236 ABC_RNaseL_inhibitor_d 96.9 0.00067 1.7E-08 44.7 2.8 21 28-48 27-47 (255) 431 PRK13640 cbiO cobalt transport 96.9 0.00087 2.2E-08 43.9 3.3 32 17-48 23-55 (283) 432 COG5293 Predicted ATPase [Gene 96.9 0.00099 2.5E-08 43.5 3.5 44 11-54 6-63 (591) 433 cd03245 ABCC_bacteriocin_expor 96.9 0.001 2.5E-08 43.5 3.5 31 18-48 20-51 (220) 434 TIGR01188 drrA daunorubicin re 96.9 0.00056 1.4E-08 45.2 2.2 38 14-51 7-45 (343) 435 cd03215 ABC_Carb_Monos_II This 96.9 0.00088 2.3E-08 43.9 3.1 31 18-48 16-47 (182) 436 PRK13643 cbiO cobalt transport 96.9 0.00099 2.5E-08 43.6 3.3 33 16-48 20-53 (288) 437 cd03257 ABC_NikE_OppD_transpor 96.9 0.0011 2.8E-08 43.3 3.5 33 17-49 20-53 (228) 438 cd03289 ABCC_CFTR2 The CFTR su 96.8 0.001 2.6E-08 43.5 3.2 31 18-48 20-51 (275) 439 cd03253 ABCC_ATM1_transporter 96.8 0.0011 2.7E-08 43.3 3.3 31 18-48 17-48 (236) 440 cd03254 ABCC_Glucan_exporter_l 96.8 0.0013 3.2E-08 42.9 3.5 31 18-48 19-50 (229) 441 PRK11432 fbpC ferric transport 96.8 0.0026 6.7E-08 40.8 5.1 32 17-48 21-53 (351) 442 PRK10584 putative ABC transpor 96.8 0.0012 3E-08 43.0 3.3 32 18-49 26-58 (228) 443 PRK11000 maltose/maltodextrin 96.8 0.0013 3.3E-08 42.8 3.4 32 18-49 19-51 (369) 444 cd03251 ABCC_MsbA MsbA is an e 96.8 0.0014 3.5E-08 42.6 3.5 31 18-48 18-49 (234) 445 TIGR03265 PhnT2 putative 2-ami 96.7 0.002 5E-08 41.6 4.1 36 14-49 16-52 (353) 446 cd03249 ABC_MTABC3_MDL1_MDL2 M 96.7 0.0017 4.3E-08 42.0 3.7 31 18-48 19-50 (238) 447 PRK11650 ugpC glycerol-3-phosp 96.7 0.0015 3.7E-08 42.4 3.4 33 18-50 20-53 (358) 448 COG2401 ABC-type ATPase fused 96.7 0.0066 1.7E-07 38.2 6.7 71 284-363 505-579 (593) 449 TIGR03608 L_ocin_972_ABC putat 96.7 0.0017 4.3E-08 42.1 3.6 33 18-50 14-47 (206) 450 cd03299 ABC_ModC_like Archeal 96.7 0.0015 3.9E-08 42.3 3.4 33 18-50 15-48 (235) 451 cd03300 ABC_PotA_N PotA is an 96.7 0.0017 4.3E-08 42.1 3.5 36 15-50 13-49 (232) 452 cd03261 ABC_Org_Solvent_Resist 96.7 0.0025 6.4E-08 40.9 4.3 36 15-50 13-49 (235) 453 cd03288 ABCC_SUR2 The SUR doma 96.7 0.0019 4.9E-08 41.7 3.6 31 18-48 37-68 (257) 454 cd03222 ABC_RNaseL_inhibitor T 96.6 0.0016 4E-08 42.2 2.9 21 28-48 26-46 (177) 455 TIGR02142 modC_ABC molybdate A 96.6 0.0061 1.6E-07 38.4 5.9 79 286-375 131-213 (361) 456 COG0396 sufC Cysteine desulfur 96.6 0.027 7E-07 34.1 9.2 78 287-374 145-225 (251) 457 COG0411 LivG ABC-type branched 96.6 0.00082 2.1E-08 44.1 1.4 34 15-48 17-51 (250) 458 COG0410 LivF ABC-type branched 96.6 0.008 2E-07 37.6 6.4 29 20-48 21-50 (237) 459 TIGR01194 cyc_pep_trnsptr cycl 96.6 0.0017 4.4E-08 42.0 2.9 20 28-47 369-388 (555) 460 KOG0054 consensus 96.6 0.028 7.2E-07 34.0 9.1 31 17-47 536-567 (1381) 461 TIGR00954 3a01203 Peroxysomal 96.6 0.0014 3.7E-08 42.5 2.4 59 285-353 708-766 (788) 462 cd03295 ABC_OpuCA_Osmoprotecti 96.5 0.0023 5.8E-08 41.2 3.3 34 16-49 15-49 (242) 463 cd03252 ABCC_Hemolysin The ABC 96.5 0.0024 6.1E-08 41.0 3.4 31 18-48 18-49 (237) 464 cd03292 ABC_FtsE_transporter F 96.5 0.0022 5.5E-08 41.3 3.1 36 15-50 14-50 (214) 465 cd03262 ABC_HisP_GlnQ_permease 96.5 0.0026 6.6E-08 40.8 3.5 34 17-50 15-49 (213) 466 KOG0054 consensus 96.5 0.057 1.5E-06 32.1 10.3 55 316-372 1296-1351(1381) 467 KOG0058 consensus 96.5 0.041 1.1E-06 33.0 9.5 77 285-373 603-681 (716) 468 TIGR01842 type_I_sec_PrtD type 96.5 0.0039 1E-07 39.6 4.3 75 286-372 466-543 (556) 469 KOG0062 consensus 96.5 0.0043 1.1E-07 39.4 4.5 29 20-49 100-128 (582) 470 COG4913 Uncharacterized protei 96.5 0.0059 1.5E-07 38.5 5.0 47 4-50 14-60 (1104) 471 PRK11174 cysteine/glutathione 96.5 0.0028 7.3E-08 40.6 3.4 55 287-349 383-438 (588) 472 PRK10522 multidrug transporter 96.4 0.0033 8.3E-08 40.2 3.6 27 21-47 342-369 (547) 473 COG4598 HisP ABC-type histidin 96.4 0.02 5.2E-07 35.0 7.6 78 285-372 151-230 (256) 474 cd03229 ABC_Class3 This class 96.4 0.0035 8.8E-08 40.0 3.5 35 16-50 14-49 (178) 475 COG1119 ModF ABC-type molybden 96.4 0.0017 4.2E-08 42.1 1.9 30 18-47 47-77 (257) 476 TIGR01257 rim_protein rim ABC 96.4 0.0022 5.7E-08 41.3 2.5 80 285-375 1060-1141(2272) 477 COG4674 Uncharacterized ABC-ty 96.4 0.01 2.6E-07 36.9 5.9 40 9-48 12-52 (249) 478 COG1118 CysA ABC-type sulfate/ 96.4 0.0028 7.2E-08 40.6 3.0 46 5-50 5-51 (345) 479 PRK13545 tagH teichoic acids e 96.3 0.0035 9E-08 40.0 3.3 80 284-374 141-223 (549) 480 PRK09473 oppD oligopeptide tra 96.3 0.0028 7.3E-08 40.6 2.7 33 16-48 30-63 (330) 481 COG4988 CydD ABC-type transpor 96.3 0.0041 1.1E-07 39.5 3.5 33 16-48 335-368 (559) 482 TIGR03005 ectoine_ehuA ectoine 96.3 0.016 4E-07 35.8 6.3 77 285-372 149-229 (256) 483 PRK11153 metN DL-methionine tr 96.3 0.0035 8.9E-08 40.0 3.0 34 17-50 20-54 (343) 484 cd03243 ABC_MutS_homologs The 96.3 0.006 1.5E-07 38.5 4.1 34 17-50 18-52 (202) 485 COG4525 TauB ABC-type taurine 96.2 0.033 8.3E-07 33.7 7.7 61 284-353 130-194 (259) 486 PRK13657 cyclic beta-1,2-gluca 96.2 0.0055 1.4E-07 38.7 3.5 31 18-48 351-382 (585) 487 cd03280 ABC_MutS2 MutS2 homolo 96.2 0.0062 1.6E-07 38.4 3.8 33 18-50 17-51 (200) 488 TIGR02324 CP_lyasePhnL phospho 96.1 0.0059 1.5E-07 38.5 3.4 29 20-48 26-55 (224) 489 PRK10789 putative multidrug tr 96.1 0.006 1.5E-07 38.4 3.4 30 19-48 332-362 (569) 490 COG1132 MdlB ABC-type multidru 96.1 0.0052 1.3E-07 38.8 3.1 31 18-48 345-376 (567) 491 COG1136 SalX ABC-type antimicr 96.1 0.014 3.6E-07 36.0 5.2 35 17-51 20-55 (226) 492 COG4618 ArpD ABC-type protease 96.1 0.038 9.7E-07 33.2 7.4 77 285-373 471-550 (580) 493 PRK11176 lipid transporter ATP 96.0 0.0039 9.9E-08 39.7 2.3 31 18-48 358-389 (581) 494 TIGR00929 VirB4_CagE type IV s 96.0 0.0038 9.6E-08 39.8 2.2 68 285-352 723-797 (931) 495 TIGR02769 nickel_nikE nickel i 96.0 0.011 2.8E-07 36.7 4.6 77 285-373 150-231 (267) 496 cd03284 ABC_MutS1 MutS1 homolo 96.0 0.0077 2E-07 37.7 3.8 31 20-50 21-53 (216) 497 TIGR03375 type_I_sec_LssB type 96.0 0.005 1.3E-07 38.9 2.8 26 33-58 27-53 (694) 498 COG2274 SunT ABC-type bacterio 96.0 0.0064 1.6E-07 38.3 3.3 25 23-47 494-519 (709) 499 PRK11160 cysteine/glutathione 96.0 0.0074 1.9E-07 37.8 3.6 28 20-47 359-387 (575) 500 COG4555 NatA ABC-type Na+ tran 96.0 0.0081 2.1E-07 37.6 3.8 32 20-51 20-52 (245) No 1 >PRK00064 recF recombination protein F; Reviewed Probab=100.00 E-value=0 Score=626.54 Aligned_cols=355 Identities=36% Similarity=0.548 Sum_probs=321.6 Q ss_pred EEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCCCC Q ss_conf 18999999223254553673279879998689986444899999972886666787368874898320589888628532 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEG 84 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~~~ 84 (375) |+|++|+|.|||||++++++|+|++|+|+|+||+||||||||||++++|||||+....++|++|++.+ .+.+.+..... T Consensus 1 M~i~~L~l~nFRn~~~~~l~~~~~~n~i~G~NGsGKTnlLEAI~~L~~grSfR~~~~~~li~~~~~~~-~v~a~~~~~~~ 79 (355) T PRK00064 1 MYLTRLSLTDFRNYEELDLELSPGVNVLVGENGQGKTNLLEAIYLLAPGRSHRTARDKELIRFGAEAA-VVHARVQKGGG 79 (355) T ss_pred CEECEEEEECCCCCCCCEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHCCCCCCE-EEEEEEEECCC T ss_conf 97087887365598534783499808999999888899999999984898888898699972899878-99999983892 Q ss_pred CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHH Q ss_conf 00266753002466333211257743332101233345202100110012687234121010001358467788877776 Q gi|254780766|r 85 LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFER 164 (375) Q Consensus 85 ~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~~y~~~l~~y~K 164 (375) ...+.+.+.. + +.+.+++||+++++.+++.+.+|++||+|++..++.|+|+.||+||||++||++|.|...|.+|+| T Consensus 80 ~~~i~i~~~~--~-~~~~~~ing~~~~~~s~l~~~lp~v~~~P~~~~li~g~p~~RR~flD~~~~~~~~~y~~~l~~y~k 156 (355) T PRK00064 80 ELPLGLEISR--K-GKRRVRINGEPQRKLSELAGLLNVVLFTPEDLRLVKGGPSERRRFLDRLLFQIEPVYASALSQYER 156 (355) T ss_pred EEEEEEEECC--C-CCEEEEECCEECCCHHHHHHHCCEEEECCCHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHH T ss_conf 5899999836--9-965999999216478999722869998635576760797899999787655249189999999999 Q ss_pred HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHH Q ss_conf 66667988630565432100245653279999999999999999999999985316430112201566676558967888 Q gi|254780766|r 165 LMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244 (375) Q Consensus 165 ~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~ 244 (375) +|+|||++||++..+.+|+++|+++||+.|..|...|.++++.+++.+.+.+..++.....+.+.|..+.. ....+ T Consensus 157 ~LkqRN~lLK~~~~~~~~l~~w~~~la~~g~~I~~~R~~~~~~l~~~~~~~~~~l~~~~~~~~l~y~~~~~----~~~~~ 232 (355) T PRK00064 157 ALKQRNALLKEQKADLAWLDVWDEQLAELGAAIAAARLEYLERLAPLAAKTHQEIFPEAELLSLSYQPGVD----LENIE 232 (355) T ss_pred HHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCC----CHHHH T ss_conf 99999999720578847899999999999999999999999999999999999857974445899827998----22589 Q ss_pred HHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHH Q ss_conf 87654553111000000000257320011001245510233122058999999999999999998708997899801220 Q gi|254780766|r 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISA 324 (375) Q Consensus 245 e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s 324 (375) +.|.+.|.+++++|...|+|++||||||+.|.++|.++ ..++||||||+++++++||+++++.+.++..||+||||++| T Consensus 233 ~~l~~~L~~~~~~D~~~g~T~~GPHRdD~~~~~~~~~~-~~~~S~GQqK~~~lalkLAq~~~~~~~~~~~PIlLlDDv~s 311 (355) T PRK00064 233 EDLLEALAKNRERDRARGRTLVGPHRDDLRVRINGKPA-ADFASTGQQKLLLLALKLAEAELLKEETGEAPILLLDDVAS 311 (355) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCH-HHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH T ss_conf 99999999867989982888889873438999898434-43146238999999999999999998549997899948300 Q ss_pred CCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEEEEEEC Q ss_conf 15989999999997417980999806967854321260079972 Q gi|254780766|r 325 HLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368 (375) Q Consensus 325 ~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~~~~i~ 368 (375) |||+.++..++++|.+.+.|||||||+++.|+.+.+.+++|||+ T Consensus 312 ELD~~r~~~ll~~l~~~~~QvfiT~td~~~~~~~~~~~~~FhVe 355 (355) T PRK00064 312 ELDDGRRAALLETLIALGAQVFITATDLEGFDALWENAKIFHVE 355 (355) T ss_pred CCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCCEEEEC T ss_conf 16999999999998747986999757878876554348489969 No 2 >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Probab=100.00 E-value=0 Score=610.08 Aligned_cols=361 Identities=32% Similarity=0.482 Sum_probs=325.6 Q ss_pred EEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCCCC Q ss_conf 18999999223254553673279879998689986444899999972886666787368874898320589888628532 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEG 84 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~~~ 84 (375) |+|.+|.+.|||||++++++|+|++|+|+|+||+||||||||||++++|||||+..++++|+++++.+ .+.+.+..... T Consensus 1 M~l~~L~L~nFRNy~~~~l~~~p~~nvl~G~NgqGKTNlLEAI~~l~~grS~Rt~~~~~lir~~~~~~-~i~~~v~~~~~ 79 (363) T COG1195 1 MYLLSLLLRNFRNYAELDLDLSPGVNVLVGENGQGKTNLLEAIYLLALGRSHRTSRDKELIRTGADEA-EISARVQRKGR 79 (363) T ss_pred CCEEEEEHHHCCCCCCCEECCCCCCEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCE-EEEEEEEECCC T ss_conf 91036135331784120003699837998989886289999999971256765301457986188628-99999960551 Q ss_pred CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHH Q ss_conf 00266753002466333211257743332101233345202100110012687234121010001358467788877776 Q gi|254780766|r 85 LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFER 164 (375) Q Consensus 85 ~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~~y~~~l~~y~K 164 (375) ...+.+. .... +.+.+++||.+.++.+++.+.+|+|||+|+|+.++.|+|+.||+||||++++++|.|...|+.|+| T Consensus 80 ~~~~~~~--~~~~-g~~~vring~~~~~~~el~g~l~~vlf~Pedl~Lv~G~P~~RRrFLD~~l~~~~p~y~~~~~~Y~k 156 (363) T COG1195 80 EGTLGLQ--ISKK-GRRRVRINGTKARKLAELAGHLNVVLFTPEDLGLVKGSPSDRRRFLDWLLFQIEPVYLEALSNYEK 156 (363) T ss_pred EEEEEEE--ECCC-CCEEEEECCCCCCCHHHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHH T ss_conf 2015787--5267-635898878224568988611756996546435005897888999988875269289999999999 Q ss_pred HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHH Q ss_conf 66667988630565432100245653279999999999999999999999985316430112201566676558967888 Q gi|254780766|r 165 LMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244 (375) Q Consensus 165 ~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~ 244 (375) +|||||++||+.+.|..|+++||.|||+.|.+|...|.++++.|++.+.+.+..+......+...+...... +.+..+ T Consensus 157 ~lkqRN~~Lk~~~~d~~~L~~~d~qLa~~g~~i~~~R~~~l~~L~~~~~~~~~~~~~~~~~l~~~y~~~~~~--~~~~~~ 234 (363) T COG1195 157 LLKQRNALLKQLQGDYAWLDVWDQQLAELGAEIAAARAEYLNALAPLAEKIHQLFLPELESLSIFYRGSVDV--TAWEIE 234 (363) T ss_pred HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHEEEECCCCC--CHHHHH T ss_conf 999999998744677789999999999999999999999999999999999754086234342354033566--276778 Q ss_pred HHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHH Q ss_conf 87654553111000000000257320011001245510233122058999999999999999998708997899801220 Q gi|254780766|r 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISA 324 (375) Q Consensus 245 e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s 324 (375) +.|.+.|.+.+++|..+|+|++||||||+.|++++.++ ..+||+||||+++++++||+++++.+.++..||||||||+| T Consensus 235 ~~~~~~L~~~r~rD~~~G~Tl~GPHRdDl~~~~~~~~~-~~~~S~Gqqk~l~laLrLAe~~l~~~~~g~~PILLLDDv~s 313 (363) T COG1195 235 EDYLEALAKRRERDLARGYTLVGPHRDDLLFRLNGKPA-ADFASQGQQKTLALALRLAEIELLREETGEYPILLLDDVAS 313 (363) T ss_pred HHHHHHHHHHHHHHHHCCCCCCCCCCHHEEEEECCCCH-HHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHH T ss_conf 99999999877889976886758873104887778125-66558425899999999999999987428897898616567 Q ss_pred CCCHHHHHHHHHHHHHCCCCEEEEECCHHHHH-HHHCCEEEEEECCCEEE Q ss_conf 15989999999997417980999806967854-32126007997289689 Q gi|254780766|r 325 HLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-SLNETAKFMRISNHQAL 373 (375) Q Consensus 325 ~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~-~~~~~~~~~~i~~g~~~ 373 (375) |||+.+|..+++. .+.+.|+|||||+.+.++ .+.+++++|+|++|++. T Consensus 314 eLD~~Rr~~Ll~~-~~~~~Q~fvT~t~~~~~~~~~~~~~~~f~V~~g~i~ 362 (363) T COG1195 314 ELDDGRRAALLDT-IELGVQVFVTTTDLEDIDDNLDENAQMFHVEDGKIT 362 (363) T ss_pred HHCHHHHHHHHHH-CCCCCEEEEECCCHHHHHHHHHCCCEEEEEECCEEC T ss_conf 5598999999743-445874999725777766652125407998411445 No 3 >TIGR00611 recf DNA replication and repair protein RecF; InterPro: IPR001238 All proteins in this family, including recF, for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. RecF is involved in DNA metabolism and is required for recombinational DNA repair and for induction of the SOS response , . ; GO: 0003697 single-stranded DNA binding, 0005524 ATP binding, 0006281 DNA repair. Probab=100.00 E-value=0 Score=598.23 Aligned_cols=364 Identities=27% Similarity=0.385 Sum_probs=321.4 Q ss_pred EEEEEEE---------EECCCCHHHEEEE---CCCCEE-EEECCCCCCH--HHHHHHHHHHCCCCCCCCCCHHHHHHCCC Q ss_conf 1899999---------9223254553673---279879-9986899864--44899999972886666787368874898 Q gi|254780766|r 5 IKIKFLN---------ISEFRNYASLRLV---FDAQHT-IFVGDNGVGK--TNILEAISFLSPGRGFRRASYADVTRIGS 69 (375) Q Consensus 5 M~i~~l~---------i~nFR~~~~~~i~---f~~~~n-~i~G~NG~GK--T~iLEAI~~l~~gksfR~~~~~~li~~~~ 69 (375) |++.+|. |++||||+.++++ |+|++| +|+|+||+|| ||+|||||+++.|+|||++.++++|++|. T Consensus 1 M~~~~L~rPCrCGCkPl~~FRNy~~v~L~rCvl~p~~Nq~~~G~NgqGKrPTnllEAiy~L~~~rShR~~~~~~lIr~~~ 80 (399) T TIGR00611 1 MYLSRLERPCRCGCKPLKDFRNYDEVDLERCVLSPGVNQVFVGPNGQGKRPTNLLEAIYYLALGRSHRTSRDKELIRFGA 80 (399) T ss_pred CCCCCCCCCCCCCCCCCCCCCCHHHCCCHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEECCC T ss_conf 92300177555677568887786450100201178874488767889864078999999987444354420563011278 Q ss_pred CCEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCC Q ss_conf 320589888628532002667530024663332112577433--321012333452021001100126872341210100 Q gi|254780766|r 70 PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIR--VVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRM 147 (375) Q Consensus 70 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~n~~~~~--~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~ 147 (375) +.+ ++.+.+...+....+...+.. +++.+..++|..... +.+++++.+|+++|+|+++.|+.|+|++||+||||. T Consensus 81 ~~~-~~~g~~~~~~~~~~~~l~~~~--~~k~~~~~~n~~~~~g~k~~dl~g~L~~~LfaPEdL~Lv~G~P~~RRrFLD~~ 157 (399) T TIGR00611 81 EAA-VIEGRVSKEDREVTIDLEILL--KKKGKKAKVNILGQDGNKLSDLAGLLPVVLFAPEDLTLVKGSPSVRRRFLDWE 157 (399) T ss_pred CEE-EEEEEEEECCCEEEEEEEEEE--ECCCCEEEEEECCCCCCHHHHHHHHCCEEEECCCCCCCCCCCHHHHHHHHHHH T ss_conf 617-999999808717898765873--00366258741655553099898741203207887210158865678883158 Q ss_pred CCCCC-HHHHHHHHHHHHHHHHHHHHHHCC-----CCCC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 01358-467788877776666679886305-----6543---21002456532799999999999999999999999853 Q gi|254780766|r 148 VFAID-PRHRRRMIDFERLMRGRNRLLTEG-----YFDS---SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQK 218 (375) Q Consensus 148 i~~~~-~~y~~~l~~y~K~LkqRN~lLk~~-----~~d~---~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~ 218 (375) ++|+. |.|...|+.|+|+|||||++||.. +.|. +.|++||.+||++|.+|...|.+|+++|++.+.+.++. T Consensus 158 l~~~~~~~~~~~~s~y~r~LkQRNa~Lk~~~~~~~~~D~~~~~~L~vwD~~La~~g~~v~~~R~~~~~~L~~~~~~~~~~ 237 (399) T TIGR00611 158 LFQVSRPVYLSAWSDYQRVLKQRNAALKQAQGARQQGDRSVLSTLEVWDSQLAELGAKVSAKRAEFIEKLEPEAQKAHQL 237 (399) T ss_pred HHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 77623157899998642699988779987544431057557878644128999999999999999999988999999997 Q ss_pred CCCCCEEEEECCCC-----CCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHH Q ss_conf 16430112201566-----6765589678888765455311100000000025732001100124551023312205899 Q gi|254780766|r 219 ENFPHIKLSLTGFL-----DGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293 (375) Q Consensus 219 ~~~~~~~~~l~~~~-----~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk 293 (375) +.......++.+.. ......+.+...+.|.+.|...+++|..+|+|.+||||||+.|++||.++ ..++|+||+| T Consensus 238 ~l~~~~~~~~~y~~s~e~~~~~~~~~~~~~~~~~~~~L~~~~~~d~~rg~T~~GPHRdDl~~~~n~~pv-~~~~S~Gq~~ 316 (399) T TIGR00611 238 LLPELESLSLFYRGSLEVIDADEAETLWDIETDYAEALARNFERDLERGYTLVGPHRDDLRFRLNGLPV-EDFASQGQQR 316 (399) T ss_pred HCCCCHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHCCCCH-HHHCCHHHHH T ss_conf 425202345543012013327871256889999999999874668866899648734777754158584-3430054789 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHH--HHCCEEEEEECC-- Q ss_conf 9999999999999998708997899801220159899999999974179809998069678543--212600799728-- Q gi|254780766|r 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS--LNETAKFMRISN-- 369 (375) Q Consensus 294 ~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~--~~~~~~~~~i~~-- 369 (375) ++++||+||+.+++.+..+..|||||||++||||..+|..|++.+...+.|||||||..+.++. ..+...++.|+. T Consensus 317 ~l~~aLrLA~~~ll~~~~~e~PilLlDDv~SELD~~Rr~~L~~~~~~~~~QVfvTa~~~d~~~~~~~~~~~~~~~~~~~~ 396 (399) T TIGR00611 317 SLALALRLAEGELLREEGGEYPILLLDDVASELDDQRRRALAETLQSLGEQVFVTAISLDHLKEMQDANRVTIALVSVEA 396 (399) T ss_pred HHHHHHHHHHHHHHHHHCCCCCEEEECCHHHCCHHHHHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHCCCCEEEEECCC T ss_conf 99999999899999984689842644252322607899999999971696699996242012000010034023564267 Q ss_pred CEE Q ss_conf 968 Q gi|254780766|r 370 HQA 372 (375) Q Consensus 370 g~~ 372 (375) |+| T Consensus 397 G~~ 399 (399) T TIGR00611 397 GTI 399 (399) T ss_pred CCC T ss_conf 879 No 4 >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage. When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task. This CD represents the nucleotide binding domain of RecF. RecF belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=100.00 E-value=0 Score=514.72 Aligned_cols=269 Identities=33% Similarity=0.549 Sum_probs=245.9 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCCCCCE Q ss_conf 99999922325455367327987999868998644489999997288666678736887489832058988862853200 Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLA 86 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~~~~~ 86 (375) |++|+|.|||||++.+++|+|++|+|+|+||+||||||||||++++|||||+.+..++|++|++.+ .+.+.+....... T Consensus 1 i~~L~l~nFRn~~~~~l~~~~~~n~i~G~NGsGKTnlLEAI~~ls~grSFR~~~~~~lI~~~~~~~-~v~~~~~~~~~~~ 79 (270) T cd03242 1 LKSLELRNFRNYAELELEFEPGVTVLVGENAQGKTNLLEAISLLATGKSHRTSRDKELIRWGAEEA-KISAVLERQGGEL 79 (270) T ss_pred CCEEEEECCCCCCCCEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHCCCCCCE-EEEEEEEECCCEE T ss_conf 967876476698505672499948999999887899999999981799888675588852789858-9999999899607 Q ss_pred EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHH Q ss_conf 26675300246633321125774333210123334520210011001268723412101000135846778887777666 Q gi|254780766|r 87 DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLM 166 (375) Q Consensus 87 ~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~~y~~~l~~y~K~L 166 (375) .+.+.+. .+ ..+.+++||.+++..+++.+.+|++||+|++..++.|+|++||+||||++||++|.|.+.|++|+|+| T Consensus 80 ~~~~~~~--~~-~~k~~~in~~~~~~~s~l~~~lp~v~~~P~~~~li~g~p~~RR~flD~~i~~~~~~y~~~l~~Y~k~L 156 (270) T cd03242 80 ALELTIR--SG-GGRKARLNGIKVRRLSDLLGVLNAVWFAPEDLELVKGSPADRRRFLDRLLGQLEPAYAHVLSEYQKAL 156 (270) T ss_pred EEEEEEE--CC-CCEEEEECCCCCCCHHHHHHHCCEEEEECCHHHHHHCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHH T ss_conf 9999994--39-95499999903504898871088899923755466179488999999999862999999999999999 Q ss_pred HHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHH Q ss_conf 66798863056543210024565327999999999999999999999998531643011220156667655896788887 Q gi|254780766|r 167 RGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246 (375) Q Consensus 167 kqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~ 246 (375) +|||++|| T Consensus 157 kQRN~lLK------------------------------------------------------------------------ 164 (270) T cd03242 157 RQRNALLK------------------------------------------------------------------------ 164 (270) T ss_pred HHHHHHHC------------------------------------------------------------------------ T ss_conf 99999837------------------------------------------------------------------------ Q ss_pred HHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCC Q ss_conf 65455311100000000025732001100124551023312205899999999999999999870899789980122015 Q gi|254780766|r 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHL 326 (375) Q Consensus 247 ~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~L 326 (375) ||||||+.|.++++++ ..+|||||||+++++++||+++++.+.++..||+||||++||| T Consensus 165 --------------------GpHrdD~~~~~~~~~~-~~~~S~GQqK~~~~~l~Laq~~~~~~~~~~~PilLlDDi~seL 223 (270) T cd03242 165 --------------------GPHRDDLLFFLNDKPA-ADFGSQGQQRTLALALKLAEIQLIKEVSGEYPVLLLDDVLAEL 223 (270) T ss_pred --------------------CCCHHHEEEEECCEEH-HHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHH T ss_conf --------------------9981217998798707-8767878999999999999999999986999789972315540 Q ss_pred CHHHHHHHHHHHHHCCCCEEEEECCHHHHHHH-HCCEEEEEECCCEEE Q ss_conf 98999999999741798099980696785432-126007997289689 Q gi|254780766|r 327 DEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL-NETAKFMRISNHQAL 373 (375) Q Consensus 327 D~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~-~~~~~~~~i~~g~~~ 373 (375) |+.++..++++|.+.+ |||||+|+.+.++.+ ..++++|||++|+|. T Consensus 224 D~~r~~~l~~~l~~~~-QvfiT~t~~~~~~~~~~~~~~~F~Ve~G~it 270 (270) T cd03242 224 DLGRQAALLDAIEGRV-QTFVTTTDLADFDALWLRRAQIFRVDAGTLS 270 (270) T ss_pred CHHHHHHHHHHHCCCC-CEEEECCCHHHHHHHCCCCCCEEEECCCEEC T ss_conf 9999999999870189-7999757857745433466738998087979 No 5 >TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by IPR011890 from INTERPRO. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent .. Probab=99.94 E-value=1.6e-26 Score=192.23 Aligned_cols=157 Identities=24% Similarity=0.405 Sum_probs=114.1 Q ss_pred EEEEEEEECCCCHH-H-EEEECCCCEEEEECCCCCCHHHHHHHHHHHCCC---CCCCCCCHHHHHHCC---------CCC Q ss_conf 89999992232545-5-367327987999868998644489999997288---666678736887489---------832 Q gi|254780766|r 6 KIKFLNISEFRNYA-S-LRLVFDAQHTIFVGDNGVGKTNILEAISFLSPG---RGFRRASYADVTRIG---------SPS 71 (375) Q Consensus 6 ~i~~l~i~nFR~~~-~-~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~g---ksfR~~~~~~li~~~---------~~~ 71 (375) ||++|.+.||+||. . +.|+|.+|+|+|+||||||||||+|||-|++++ |++|+.+++|||..| ++. T Consensus 1 YIe~ie~~nFKSFg~kk~~Ipf~~GFtvIsGPNGSGKSNI~DaiLFaLGl~s~k~~RAe~LsDLi~~gahe~~~~~~~~~ 80 (1202) T TIGR02169 1 YIEKIELENFKSFGTKKKVIPFLKGFTVISGPNGSGKSNIIDAILFALGLSSSKAMRAERLSDLIFNGAHEAAKNAKSAD 80 (1202) T ss_pred CCEEEEEECCEEECCCEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC T ss_conf 92578872011207871263168888478888888645599999997664102342221052224487422235688996 Q ss_pred EEEEEEEECCCCC--------------------CEEEEEEEECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCEEEC--- Q ss_conf 0589888628532--------------------002667530024663-3321125774333210123334520210--- Q gi|254780766|r 72 FFSTFARVEGMEG--------------------LADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRISWLVP--- 127 (375) Q Consensus 72 ~~~~~~~~~~~~~--------------------~~~~~~~~~~~~~~~-~k~~~~n~~~~~~~~~l~~~l~~v~~~p--- 127 (375) ...+...+..... ...+..++.+.+++. ...+++||.+++ ++++.+.|.-..|.| T Consensus 81 ea~V~v~F~nd~~~~prsqvttaaGsenv~~vde~~v~Rr~kv~~~~~yySyY~lNG~~~~-l~ei~d~L~~~gI~p~gY 159 (1202) T TIGR02169 81 EAEVTVTFKNDDGKFPRSQVTTAAGSENVLEVDELEVSRRLKVTDDGKYYSYYYLNGKSVR-LSEIHDFLAAAGIYPEGY 159 (1202) T ss_pred EEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCEEEEEEECCCCCC-HHHHHHHHHHCCCCCCCC T ss_conf 8989888722787587310000224444442243589988887379846888887082035-766899998617688987 Q ss_pred ------CHHHCCCCCCHHHHHHCCCC--CCCCCHHHHHHHHHHH Q ss_conf ------01100126872341210100--0135846778887777 Q gi|254780766|r 128 ------SMDRIFSGLSMERRRFLDRM--VFAIDPRHRRRMIDFE 163 (375) Q Consensus 128 ------~~~~li~~~p~~RR~flD~~--i~~~~~~y~~~l~~y~ 163 (375) |-..+|..+|.+||+.||.+ |..+|..--+++.+.. T Consensus 160 NvVlQGDvt~~I~Ms~~ERRkiIdeiAGvaeFD~kkekA~eeL~ 203 (1202) T TIGR02169 160 NVVLQGDVTKIISMSAVERRKIIDEIAGVAEFDRKKEKALEELE 203 (1202) T ss_pred EEEEECCHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHH T ss_conf 06743541231038843567888885481488899999999999 No 6 >TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . The smc gene is often associated with scpB (IPR005234 from INTERPRO) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle , , .; GO: 0005515 protein binding, 0005524 ATP binding, 0005694 chromosome. Probab=99.93 E-value=2.5e-25 Score=184.54 Aligned_cols=144 Identities=23% Similarity=0.299 Sum_probs=112.3 Q ss_pred EEEEEEEECCCCH-HHEEEECCCCEEEEECCCCCCHHHHHHHHHHHC---CCCCCCCCCHHHHHHCCCCCE-----EEEE Q ss_conf 8999999223254-553673279879998689986444899999972---886666787368874898320-----5898 Q gi|254780766|r 6 KIKFLNISEFRNY-ASLRLVFDAQHTIFVGDNGVGKTNILEAISFLS---PGRGFRRASYADVTRIGSPSF-----FSTF 76 (375) Q Consensus 6 ~i~~l~i~nFR~~-~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~---~gksfR~~~~~~li~~~~~~~-----~~~~ 76 (375) +|++|+|.+|+|| +.+.|+|++|+|.||||||||||||+|||.|+. ..|+.|+.++.|+|+.|+..- ..+. T Consensus 1 ~Lk~l~l~GFKSFaD~t~i~F~~g~TgiVGPNGcGKSNi~DAiRWVLGEqSak~LRg~~M~DVIF~Gs~~Rkp~~~AeV~ 80 (1191) T TIGR02168 1 RLKKLELAGFKSFADPTTINFDKGITGIVGPNGCGKSNIVDAIRWVLGEQSAKALRGGKMEDVIFNGSETRKPLSLAEVE 80 (1191) T ss_pred CCCEEEECCCCCCCCCEEEEECCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCEEEEE T ss_conf 96135761210135304786178527986279987001899999860033477734689995563488777657700689 Q ss_pred EEECCCC--------CCEEEEEEEECCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHC---------CCCCCH Q ss_conf 8862853--------2002667530024-663332112577433321012333452021001100---------126872 Q gi|254780766|r 77 ARVEGME--------GLADISIKLETRD-DRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRI---------FSGLSM 138 (375) Q Consensus 77 ~~~~~~~--------~~~~~~~~~~~~~-~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~l---------i~~~p~ 138 (375) +.+++.+ ...+|.|++.... ++.+ .|+|||.+++. .++...|--..+.+....| +...|+ T Consensus 81 L~fdN~d~~l~~~y~~y~Ei~itRr~~Rg~GeS-eY~iN~~~cRL-kDI~dLF~dtGlG~~sysII~QG~I~~i~~aKPe 158 (1191) T TIGR02168 81 LVFDNSDGLLPGQYADYSEISITRRLYRGDGES-EYFINGQPCRL-KDIQDLFLDTGLGKRSYSIIEQGKISEIIEAKPE 158 (1191) T ss_pred EEEECCCCCCHHHHCCCCEEEEEEEEEECCCCC-EEEECCCCCHH-HHHHHHHHHCCCCCCCCEEECCCCHHHHHCCCHH T ss_conf 888558883512113677178998887458644-04557750137-7799887322788654323034305565249968 Q ss_pred HHHHHCCC--CCCCC Q ss_conf 34121010--00135 Q gi|254780766|r 139 ERRRFLDR--MVFAI 151 (375) Q Consensus 139 ~RR~flD~--~i~~~ 151 (375) +||.+|.. +|+.+ T Consensus 159 erR~i~EEAAGisKY 173 (1191) T TIGR02168 159 ERRAIFEEAAGISKY 173 (1191) T ss_pred HHHHHHHHHCCHHHH T ss_conf 999998872135788 No 7 >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo Probab=99.92 E-value=4.2e-24 Score=176.54 Aligned_cols=219 Identities=21% Similarity=0.345 Sum_probs=131.3 Q ss_pred EEEEEEECCCCH-HHEEEE-CCCCEEEEECCCCCCHHHHHHHHHHHCC--CCCCCCCCHHHHHHCCCCCEEEEEEEE--- Q ss_conf 999999223254-553673-2798799986899864448999999728--866667873688748983205898886--- Q gi|254780766|r 7 IKFLNISEFRNY-ASLRLV-FDAQHTIFVGDNGVGKTNILEAISFLSP--GRGFRRASYADVTRIGSPSFFSTFARV--- 79 (375) Q Consensus 7 i~~l~i~nFR~~-~~~~i~-f~~~~n~i~G~NG~GKT~iLEAI~~l~~--gksfR~~~~~~li~~~~~~~~~~~~~~--- 79 (375) |++|.|.+||+| +.+.++ |+|++|+|||+|||||||+++||.|+++ ..+.|+.++.++|..|+... +..+.+ T Consensus 1 iK~i~i~GFKSf~d~t~i~~f~p~~taIVGpNGsGKSNi~dAIrwVLGe~~~~lR~~~~~dvIf~Gs~~~-~~~A~Vei~ 79 (243) T cd03272 1 IKQVIIQGFKSYKDQTVIEPFSPKHNVVVGRNGSGKSNFFAAIRFVLSDEYTHLREEQRQALLHEGSGPS-VMSAYVEII 79 (243) T ss_pred CCEEEEECEECCCCCEEECCCCCCCCEEECCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHEECCCCCC-CCEEEEEEE T ss_conf 9479992700577765731479996379899876604367761256537755542455676442578988-620699999 Q ss_pred -CCCCC-----CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCH Q ss_conf -28532-----002667530024663332112577433321012333452021001100126872341210100013584 Q gi|254780766|r 80 -EGMEG-----LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDP 153 (375) Q Consensus 80 -~~~~~-----~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~ 153 (375) ++.+. ..++.+++.....+ ..+++|+++++. .++.+.|...-+..+ +| T Consensus 80 fDNsd~~~~~~~~Ei~irR~i~~~~--seY~iN~~~~rl-kDI~~lf~~tGlg~~-----------------------np 133 (243) T cd03272 80 FDNSDNRFPIDKEEVRLRRTIGLKK--DEYFLDKKNVTK-NDVMNLLESAGFSRS-----------------------NP 133 (243) T ss_pred EECCCCCCCCCCCEEEEEEEEECCC--CEEEECCCCCCH-HHHHHHHHHCCCCCC-----------------------CC T ss_conf 9788887689986799999995798--579899870369-999998753599989-----------------------98 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCC Q ss_conf 67788877776666679886305654321002456532799999999999999999999999853164301122015666 Q gi|254780766|r 154 RHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD 233 (375) Q Consensus 154 ~y~~~l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~ 233 (375) - .+..+++. + T Consensus 134 y----------------~II~QG~I------------------------------------------------------~ 143 (243) T cd03272 134 Y----------------YIVPQGKI------------------------------------------------------N 143 (243) T ss_pred C----------------EEEECCCC------------------------------------------------------C T ss_conf 7----------------79966735------------------------------------------------------3 Q ss_pred CCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC Q ss_conf 76558967888876545531110000000002573200110012455102331220589999999999999999987089 Q gi|254780766|r 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGF 313 (375) Q Consensus 234 ~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~ 313 (375) .-..... ++. ...-.+|.||+-+++||+.+|- +..+. T Consensus 144 ~i~n~kP----eE~----------------------------------r~i~~~~~~~k~~~alalifai-----~~~~P 180 (243) T cd03272 144 SLTNMKQ----DEQ----------------------------------QEMQQLSGGQKSLVALALIFAI-----QKCDP 180 (243) T ss_pred HHHCCCH----HHH----------------------------------HHHHHHCCCHHHHHHHHHHHHH-----HCCCC T ss_conf 3032991----999----------------------------------9999971346779999999998-----45599 Q ss_pred CCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEEEEEC Q ss_conf 9789980122015989999999997417--980999806967854321260079972 Q gi|254780766|r 314 APILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKFMRIS 368 (375) Q Consensus 314 ~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~~~i~ 368 (375) .|++|+||+.|.||+.++..+.++++++ +.|+|+||+.+..++.-. . +|.|. T Consensus 181 aPfyllDEidaaLD~~~~~~v~~~ik~ls~~~QfI~ithr~~~~~~Ad-~--~ygV~ 234 (243) T cd03272 181 APFYLFDEIDAALDAQYRTAVANMIKELSDGAQFITTTFRPELLEVAD-K--FYGVK 234 (243) T ss_pred CCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-H--EEEEE T ss_conf 837887134401599899999999999734984999980889997506-4--37269 No 8 >PRK10869 recombination and repair protein; Provisional Probab=99.92 E-value=5.3e-22 Score=162.80 Aligned_cols=153 Identities=18% Similarity=0.181 Sum_probs=111.5 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCC---- Q ss_conf 9999992232545536732798799986899864448999999728866667873688748983205898886285---- Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGM---- 82 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~---- 82 (375) |.+|+|+||--+++++++|++|+|||+|+.|||||-||+||.+++++| ...++|+.|++...+ .+.+... T Consensus 2 L~~L~I~n~alI~~~~l~f~~Gl~viTGETGAGKSill~al~lllG~r-----a~~~~ir~g~~~a~v-ea~F~~~~~~~ 75 (553) T PRK10869 2 LAQLTISNFAIVRELEIDFQSGMTVITGETGAGKSIAIDALGLCLGGR-----AEASMVRPGATRADL-CARFSLKDTPA 75 (553) T ss_pred CCEEEEEEEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCC-----CCCCCCCCCCCEEEE-EEEEECCCCHH T ss_conf 873998305878989997699986877899987999999999984889-----884646699975999-99997288757 Q ss_pred ----------CCCEEEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCC Q ss_conf ----------320026675300246633321125774333--21012333452021001100126872341210100013 Q gi|254780766|r 83 ----------EGLADISIKLETRDDRSVRCLQINDVVIRV--VDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFA 150 (375) Q Consensus 83 ----------~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~ 150 (375) +...++.+++.+..++.+ ..++||.+++. +.++... .+-++.+......-.|+..|.+||...-+ T Consensus 76 ~~~~l~~~~~~~~~eliirR~i~~~GrS-r~~INg~~vt~~~Lk~l~~~--LidIHgQhe~q~Ll~~~~q~~lLD~f~~~ 152 (553) T PRK10869 76 ALRWLEDNQLEDGNECLLRRVISSDGRS-RGFINGTPVPLSQLRELGQL--LIQIHGQHAHQLLLKPEHQKTLLDSYANH 152 (553) T ss_pred HHHHHHHCCCCCCCCEEEEEEECCCCCE-EEEECCEECCHHHHHHHHHH--HHHHHCCHHHHHHHCCHHHHHHHHHHCCC T ss_conf 8999985699988857999998689965-89999998569999999999--99985236678770832589999863486 Q ss_pred C--CHHHHHHHHHHHHHHHH Q ss_conf 5--84677888777766666 Q gi|254780766|r 151 I--DPRHRRRMIDFERLMRG 168 (375) Q Consensus 151 ~--~~~y~~~l~~y~K~Lkq 168 (375) . -..|...|..|+++.++ T Consensus 153 ~~l~~~~~~~y~~~~~~~~~ 172 (553) T PRK10869 153 TSLLQEMAAAYQLWHQSCRD 172 (553) T ss_pred HHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999999999 No 9 >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo Probab=99.91 E-value=1.1e-23 Score=173.83 Aligned_cols=227 Identities=22% Similarity=0.313 Sum_probs=145.1 Q ss_pred EEEEEEEEECCCCHH-HEEE-ECCCCEEEEECCCCCCHHHHHHHHHHHCC---CCCCCCCCHHHHHHCCCCCEE---EEE Q ss_conf 189999992232545-5367-32798799986899864448999999728---866667873688748983205---898 Q gi|254780766|r 5 IKIKFLNISEFRNYA-SLRL-VFDAQHTIFVGDNGVGKTNILEAISFLSP---GRGFRRASYADVTRIGSPSFF---STF 76 (375) Q Consensus 5 M~i~~l~i~nFR~~~-~~~i-~f~~~~n~i~G~NG~GKT~iLEAI~~l~~---gksfR~~~~~~li~~~~~~~~---~~~ 76 (375) |+|++|.|.+|++|. .+.+ +|+||+|+||||||||||||+|||.|+.+ .|+.|+.++.|+|..|..... .+. T Consensus 1 M~ik~i~i~GFKSF~d~T~i~~f~~g~taIVGPNGsGKSNI~DAIrwVLGe~s~k~LRg~~m~DvIF~g~~~~~~~A~V~ 80 (251) T cd03273 1 MHIKEIILDGFKSYATRTVISGFDPQFNAITGLNGSGKSNILDAICFVLGITNLSTVRASNLQDLIYKRGQAGITKASVT 80 (251) T ss_pred CEEEEEEECCCCCCCCCEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCHHHHCCCCCCEEEECCCCCCCEEEEEE T ss_conf 93669998072267887788505999569999998866889999999975674434121355516888999996126999 Q ss_pred EEECCCC---------CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCC Q ss_conf 8862853---------2002667530024663332112577433321012333452021001100126872341210100 Q gi|254780766|r 77 ARVEGME---------GLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRM 147 (375) Q Consensus 77 ~~~~~~~---------~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~ 147 (375) ..+++.+ ...++.+.+....++. ..+++|+++++.. ++...|. |-+ T Consensus 81 l~fdN~d~~~~p~~~~~~~EI~ItRri~r~G~-seY~INg~~~R~k-DI~~lF~-----------------------dtg 135 (251) T cd03273 81 IVFDNSDKSQSPIGFENYPEITVTRQIVLGGT-NKYLINGHRAQQQ-RVQDLFQ-----------------------SVQ 135 (251) T ss_pred EEECCCCCCCCCCCCCCCCEEEEEEEEEECCC-CEEEECCCEECHH-HHHHHHH-----------------------HCC T ss_conf 99726875458765577887999999998888-5798997664599-9999974-----------------------437 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEE Q ss_conf 01358467788877776666679886305654321002456532799999999999999999999999853164301122 Q gi|254780766|r 148 VFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS 227 (375) Q Consensus 148 i~~~~~~y~~~l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~ 227 (375) +..-.|. .+..+++.+. ++ +. T Consensus 136 lg~~sp~----------------~II~QGrI~~----il-------------------n~-------------------- 156 (251) T cd03273 136 LNVNNPH----------------FLIMQGRITK----VL-------------------NM-------------------- 156 (251) T ss_pred CCCCCCC----------------EEEECCCHHH----HH-------------------CC-------------------- T ss_conf 8989986----------------0675774889----88-------------------38-------------------- Q ss_pred ECCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHH Q ss_conf 01566676558967888876545531110000000002573200110012455102331220589999999999999999 Q gi|254780766|r 228 LTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLI 307 (375) Q Consensus 228 l~~~~~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~ 307 (375) . ......+.+ .+-||.-+++|++.+|.+++ T Consensus 157 -----------k-p~eRr~l~E-------------------------------------EAAG~rsl~al~li~a~l~~- 186 (251) T cd03273 157 -----------G-GVWKESLTE-------------------------------------LSGGQRSLVALSLILALLLF- 186 (251) T ss_pred -----------C-HHHHHHHHH-------------------------------------HHCCHHHHHHHHHHHHHHHC- T ss_conf -----------9-799999999-------------------------------------85454578888889999735- Q ss_pred HHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH--CCCCEEEEECCHHHHHHHHCCEEEEEECCC Q ss_conf 987089978998012201598999999999741--798099980696785432126007997289 Q gi|254780766|r 308 SNTTGFAPILLLDEISAHLDEDKRNALFRIVTD--IGSQIFMTGTDKSVFDSLNETAKFMRISNH 370 (375) Q Consensus 308 ~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~--~~~Qv~iTt~~~~~~~~~~~~~~~~~i~~g 370 (375) +..|..++|||.|.||..+-..+=.++++ ...|+++-++..-.|+..+--- -....+| T Consensus 187 ----kpap~yildeidaaLd~~~t~~i~~~~k~~~~~sqfivvs~k~~m~~~a~~l~-~~~~~~g 246 (251) T cd03273 187 ----KPAPMYILDEVDAALDLSHTQNIGRMIKTHFKGSQFIVVSLKEGMFNNANVLF-RTRFVDG 246 (251) T ss_pred ----CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHE-EEEEECC T ss_conf ----89763012334544310336789999985086654899985587876426234-6577567 No 10 >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=99.90 E-value=2e-22 Score=165.56 Aligned_cols=214 Identities=22% Similarity=0.317 Sum_probs=138.2 Q ss_pred EEEEEEECCCCH-HHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCC--CCCCCCCCHHHHHHCCCCC-----EEEEEEE Q ss_conf 999999223254-5536732798799986899864448999999728--8666678736887489832-----0589888 Q gi|254780766|r 7 IKFLNISEFRNY-ASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSP--GRGFRRASYADVTRIGSPS-----FFSTFAR 78 (375) Q Consensus 7 i~~l~i~nFR~~-~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~--gksfR~~~~~~li~~~~~~-----~~~~~~~ 78 (375) |++|.|.||++| ....+.|.+++|+|+||||||||||+|||.|+.+ .++.|+.++.|+|..|... ...+... T Consensus 1 lk~l~l~gFKSf~~~~~i~~~~~~t~IvGpNGsGKSNi~DAi~~vlGe~s~~lR~~~m~DlIf~g~~~~~~~~~A~V~l~ 80 (247) T cd03275 1 LKRLELENFKSYKGRHVIGPFDRFTCIIGPNGSGKSNLMDAISFVLGEKSSHLRSKNLKDLIYRARVGKPDSNSAYVTAV 80 (247) T ss_pred CCEEEECCCCCCCCCEEECCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHHCCCCCCEEEECCCCCCCCCCEEEEEEE T ss_conf 94489807536789868548998379989987765888999999965662330645611278658878899854899999 Q ss_pred ECCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCHHHHHH Q ss_conf 62853200266753002466333211257743332101233345202100110012687234121010001358467788 Q gi|254780766|r 79 VEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRR 158 (375) Q Consensus 79 ~~~~~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~~y~~~ 158 (375) ++....+..+ .+..-.++. ..+++||.+++. .++.+.|..+-+....-. | +|+|- T Consensus 81 f~n~~~ev~i--~Rr~~r~G~-seY~INg~~vrl-kdi~elf~~~gIgv~a~n-----------f---lV~QG------- 135 (247) T cd03275 81 YEDDDGEEKT--FRRIITGGS-SSYRINGKVVSL-KEYNEELEKINILVKARN-----------F---LVFQG------- 135 (247) T ss_pred EECCCCEEEE--EEEEEECCC-EEEEECCCCCCH-HHHHHHHHHCCCCCCCCC-----------E---EEECC------- T ss_conf 9889985999--999997885-068788972678-999999876599977872-----------3---89644------- Q ss_pred HHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC Q ss_conf 87777666667988630565432100245653279999999999999999999999985316430112201566676558 Q gi|254780766|r 159 MIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238 (375) Q Consensus 159 l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~ 238 (375) +..+++. ..+ T Consensus 136 --~Ve~Il~-------~~P------------------------------------------------------------- 145 (247) T cd03275 136 --DVESIAS-------KNP------------------------------------------------------------- 145 (247) T ss_pred --HHHHHHC-------CCC------------------------------------------------------------- T ss_conf --4888863-------793------------------------------------------------------------- Q ss_pred CHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE Q ss_conf 96788887654553111000000000257320011001245510233122058999999999999999998708997899 Q gi|254780766|r 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILL 318 (375) Q Consensus 239 ~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilL 318 (375) |.|- | . +..++|-||+-+.+|||.+|-. ..+..|..+ T Consensus 146 -----------------------------p~rR---f----~--~~~~LSGGEKtl~alallFai~-----~~~PsPF~v 182 (247) T cd03275 146 -----------------------------PGKR---F----R--DMDNLSGGEKTMAALALLFAIH-----SYQPAPFFV 182 (247) T ss_pred -----------------------------HHHC---C----C--CHHHCCCCHHHHHHHHHHHHHH-----CCCCCCEEE T ss_conf -----------------------------0310---0----2--1233382089999999999997-----128995588 Q ss_pred EECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHH Q ss_conf 80122015989999999997417---98099980696785432 Q gi|254780766|r 319 LDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSL 358 (375) Q Consensus 319 iDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~ 358 (375) +|||.|.||..+..++.++|.+. +.|+|+-|+.+..++.- T Consensus 183 LDEVDAaLD~~Nv~r~~~~i~~~~~~~~QfIvITh~~~~~~~A 225 (247) T cd03275 183 LDEVDAALDNTNVGKVASYIREQAGPNFQFIVISLKEEFFSKA 225 (247) T ss_pred EECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHC T ss_conf 7067634688999999999998725686799998888998630 No 11 >COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] Probab=99.88 E-value=4.8e-21 Score=156.53 Aligned_cols=51 Identities=25% Similarity=0.559 Sum_probs=47.9 Q ss_pred EEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC Q ss_conf 189999992232545536732798799986899864448999999728866 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG 55 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks 55 (375) |+|++++|.|||||.+++++|..|+|+++|+|.+|||++|+|+.++....+ T Consensus 1 M~L~~v~I~nFR~i~~lsl~~~~g~~vlIGeN~~GKsslLdAL~l~l~~~~ 51 (581) T COG3593 1 MHLERVKIKNFRGINRLSLEFEEGLNVLIGENNSGKSSLLDALRLLLDPES 51 (581) T ss_pred CCCEEEEECCCCEEEEEEEEECCCCEEEECCCCCCHHHHHHHHHHHCCCCC T ss_conf 942067862500154210454578437976787552789999999708765 No 12 >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Probab=99.88 E-value=1.5e-21 Score=159.90 Aligned_cols=141 Identities=23% Similarity=0.393 Sum_probs=102.8 Q ss_pred EEEEEEEEECCCCHHH-EEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCC---CCCCCCHHHHHHCCCCC-----EEEE Q ss_conf 1899999922325455-3673279879998689986444899999972886---66678736887489832-----0589 Q gi|254780766|r 5 IKIKFLNISEFRNYAS-LRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGR---GFRRASYADVTRIGSPS-----FFST 75 (375) Q Consensus 5 M~i~~l~i~nFR~~~~-~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gk---sfR~~~~~~li~~~~~~-----~~~~ 75 (375) |+|++|.+.||+||.. +.++|.||+|+||||||||||||++||.|+++.. ++|+.++.|+|+.|+.. +..+ T Consensus 1 m~lk~i~l~gFKSF~~~~~i~f~~~~t~IvGPNGSGKSNI~DAi~fVLG~~s~k~lRa~~~~DlIf~g~~~r~~~~~A~V 80 (1163) T COG1196 1 MYLKRIELKGFKSFADPTEINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAKNLRASKMSDLIFAGSGNRKPANYAEV 80 (1163) T ss_pred CCEEEEEEECCEECCCCEEEECCCCCEEEECCCCCCHHHHHHHHHHHCCCCCHHHHCCCCCHHHHHCCCCCCCCCCEEEE T ss_conf 91379998785624783686169996168899988668899999998389502110425726675188987888770389 Q ss_pred EEEECCCCC-----CEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE---------ECCHHHCCCCCCHHHH Q ss_conf 888628532-----00266753002466333211257743332101233345202---------1001100126872341 Q gi|254780766|r 76 FARVEGMEG-----LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL---------VPSMDRIFSGLSMERR 141 (375) Q Consensus 76 ~~~~~~~~~-----~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~---------~p~~~~li~~~p~~RR 141 (375) ...+++.+. ..++++.+.+..++. ..+++||..++. +++...|.-.-+ -..-..++...|..|| T Consensus 81 ~l~fdN~d~~~~~~~~ei~v~Rri~r~g~-S~Y~INg~~~~~-~dI~~l~~~~gi~~~~~~iV~QG~V~~i~~~kp~err 158 (1163) T COG1196 81 ELTFDNSDNTLPLEYEEISVTRRIYRDGE-SEYYINGEKVRL-KDIQDLLADSGIGKESYSIVSQGKVEEIINAKPEERR 158 (1163) T ss_pred EEEEECCCCCCCCCCCEEEEEEEEEECCC-EEEEECCCEEEH-HHHHHHHHHCCCCCCCCCEEECCCHHHHHCCCHHHHH T ss_conf 99986788767777763899999997797-389988907409-9999999875999888635454518999759989999 Q ss_pred HHCCCC Q ss_conf 210100 Q gi|254780766|r 142 RFLDRM 147 (375) Q Consensus 142 ~flD~~ 147 (375) .+|+.. T Consensus 159 ~iiEEa 164 (1163) T COG1196 159 KLIEEA 164 (1163) T ss_pred HHHHHH T ss_conf 999999 No 13 >pfam02463 SMC_N RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination. Probab=99.88 E-value=6.6e-22 Score=162.20 Aligned_cols=141 Identities=23% Similarity=0.330 Sum_probs=95.9 Q ss_pred EEEEEEEECCCCHH-HEEEECCCCEEEEECCCCCCHHHHHHHHHHHCC---CCCCCCCCHHHHHHCCCCCE----EEEEE Q ss_conf 89999992232545-536732798799986899864448999999728---86666787368874898320----58988 Q gi|254780766|r 6 KIKFLNISEFRNYA-SLRLVFDAQHTIFVGDNGVGKTNILEAISFLSP---GRGFRRASYADVTRIGSPSF----FSTFA 77 (375) Q Consensus 6 ~i~~l~i~nFR~~~-~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~---gksfR~~~~~~li~~~~~~~----~~~~~ 77 (375) +|++|.|.||+||. .+.++|+||+|+||||||||||||+|||.|+++ .++.|+.++.|||..|.... ..+.. T Consensus 1 yIk~i~i~gFKSy~~~~~i~f~~gft~IVGpNGSGKSNi~DAI~fVLG~~s~k~lR~~~~~dLI~~g~~~~~~~~A~V~l 80 (1162) T pfam02463 1 YLKRIEIEGFKSYAKTVILPFSPGFTAIVGPNGSGKSNILDAILFVLGERSAKSLRSERLSDLIHYSKSGAFVNSAEVTI 80 (1162) T ss_pred CCCEEEEECCCCCCCCEECCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHCCCCHHHHEECCCCCCCCCEEEEEE T ss_conf 97479970830899996458999917888999987788999999985997542316015888702899999986689999 Q ss_pred EECCCC-----CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC---------HHHCCCCCCHHHHHH Q ss_conf 862853-----200266753002466333211257743332101233345202100---------110012687234121 Q gi|254780766|r 78 RVEGME-----GLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS---------MDRIFSGLSMERRRF 143 (375) Q Consensus 78 ~~~~~~-----~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~---------~~~li~~~p~~RR~f 143 (375) .+++.+ ...++++++.+..++. ..+++||++++. .++...|...-+.+. ....+...|..||.. T Consensus 81 ~fdn~~~~~~~~~~ev~i~R~i~~~g~-seY~iNg~~~~~-~dv~~ll~~~gi~~~~~~~ivqqg~i~~i~~~~~~~r~~ 158 (1162) T pfam02463 81 TFDNEDKELPIDDPEVSIRRRVYRGGD-SEYYINGKDVTK-KDVAELLESAGISPEAYNFLVQGGKVEIIAMMKPERRLE 158 (1162) T ss_pred EEECCCCCCCCCCCEEEEEEEEEECCC-EEEEECCEECCH-HHHHHHHHHCCCCCCCCEEEECCCHHHHHHCCCHHHHHH T ss_conf 998799876899985999999998896-589889946379-999999997595999883897776858997799989998 Q ss_pred CCCCC Q ss_conf 01000 Q gi|254780766|r 144 LDRMV 148 (375) Q Consensus 144 lD~~i 148 (375) |...+ T Consensus 159 l~E~a 163 (1162) T pfam02463 159 IEEEA 163 (1162) T ss_pred HHHHH T ss_conf 89998 No 14 >PRK02224 chromosome segregation protein; Provisional Probab=99.88 E-value=6.9e-21 Score=155.52 Aligned_cols=142 Identities=22% Similarity=0.294 Sum_probs=95.7 Q ss_pred EEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCCCC Q ss_conf 18999999223254553673279879998689986444899999972886666787368874898320589888628532 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEG 84 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~~~ 84 (375) |+|++|+|.|||||.+++|+|++|+|+|+|+||||||||+|||.|+++|.+.+...+.++|+.|+....+ ...+..... T Consensus 1 M~i~~l~L~nFks~~d~~i~F~~Gi~~I~G~NGsGKSsIldAI~~aL~g~~~~~~~~~~~i~~g~~~~~V-~l~F~~~g~ 79 (880) T PRK02224 1 MRFKRLYLENFKCYADADLTLEDGVTVIHGLNGSGKSSLLEACFFALYGSKALDFTLADAVTKGAETAKI-ELGFEHAGG 79 (880) T ss_pred CEEEEEEEECCCCCCCCEEECCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEEE-EEEEEECCE T ss_conf 9777999967015566668469985899899999889999999999808877888789997679985599-999997892 Q ss_pred CEEEEEEEECCCCCCC--C-CCCCCCCCCCCCC-------CCCC----CCCCCEEECC--HHHCCCCCCHHHHHHCCCC Q ss_conf 0026675300246633--3-2112577433321-------0123----3345202100--1100126872341210100 Q gi|254780766|r 85 LADISIKLETRDDRSV--R-CLQINDVVIRVVD-------ELNK----HLRISWLVPS--MDRIFSGLSMERRRFLDRM 147 (375) Q Consensus 85 ~~~~~~~~~~~~~~~~--k-~~~~n~~~~~~~~-------~l~~----~l~~v~~~p~--~~~li~~~p~~RR~flD~~ 147 (375) .+.+...+........ + .+..++..+.... ++.+ .|.-+.+.|+ ...++...|..||.+|+.+ T Consensus 80 ~y~v~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~ilg~~~~~f~~~~~i~Qg~~~~ll~~~p~eR~~il~~l 158 (880) T PRK02224 80 DYHIERRFRASGERAQTAKCVLETPGENIDGATDVYAEITELLRMDAEAFVNCAYVRQGEVNKLINAKPSDRQDMIDDL 158 (880) T ss_pred EEEEEEEEECCCCCCCCCEEEEECCCCEECCHHHHHHHHHHHHCCCHHHHHHEEEECCCCHHHHHHCCHHHHHHHHHHH T ss_conf 8999999855887655520377269851025578999999996998876262147522478988708988899999998 No 15 >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Probab=99.88 E-value=4.2e-20 Score=150.41 Aligned_cols=154 Identities=20% Similarity=0.212 Sum_probs=114.4 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCC---- Q ss_conf 9999992232545536732798799986899864448999999728866667873688748983205898886285---- Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGM---- 82 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~---- 82 (375) |.+|+|+||--++.++++|++|+|||+|+.|+|||-+|+||.+|++|| ...++||+|++...+. +.+... T Consensus 2 L~~LsIknfaiIe~L~leF~~GltVlTGETGAGKSIiidAl~lllG~r-----a~~~~VR~G~~~a~v~-a~F~~~~~~~ 75 (557) T COG0497 2 LLELSIKNFAIIEELELEFEKGLTVLTGETGAGKSIIIDALGLLLGGR-----ADASLVRHGAKRAEVE-AIFDLDNPPA 75 (557) T ss_pred CCEEEEEHEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCC-----CCCCHHCCCCCEEEEE-EEECCCCHHH T ss_conf 737745010010212241068956865688875667998999972787-----7811211788606899-9854796688 Q ss_pred ---------CCCEEEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCC Q ss_conf ---------320026675300246633321125774333--210123334520210011001268723412101000135 Q gi|254780766|r 83 ---------EGLADISIKLETRDDRSVRCLQINDVVIRV--VDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAI 151 (375) Q Consensus 83 ---------~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~ 151 (375) +....+.+++.+..++.+ ..++||..++. +.++...+ +-++.+....-.-.|...|++||...-+- T Consensus 76 ~~~L~e~gie~~~~iilrR~i~~~GrS-r~~INg~~Vs~~~L~~l~~~L--i~IHGQh~~q~Ll~~~~~r~lLD~f~~~~ 152 (557) T COG0497 76 RAWLEENGIEDDEEVILRRVISADGRS-RAFINGQPVSLAQLKELGQLL--IDIHGQHEHQSLLKPELQRQLLDAFAGLE 152 (557) T ss_pred HHHHHHCCCCCCCCEEEEEEECCCCCE-EEEECCEEEEHHHHHHHHHHH--EEEECCCHHHHHCCHHHHHHHHHHHCCCH T ss_conf 999997599976757999887277861-688999983099999999766--01226631777619488999998745755 Q ss_pred CH---HHHHHHHHHHHHHHHH Q ss_conf 84---6778887777666667 Q gi|254780766|r 152 DP---RHRRRMIDFERLMRGR 169 (375) Q Consensus 152 ~~---~y~~~l~~y~K~LkqR 169 (375) +. .|...++.|+.+.++. T Consensus 153 ~~~~~~~~~~y~~w~~~~~~l 173 (557) T COG0497 153 ELAQEAYQEAYQAWKQARREL 173 (557) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 789999999999999999999 No 16 >PRK01156 chromosome segregation protein; Provisional Probab=99.87 E-value=8.9e-21 Score=154.82 Aligned_cols=141 Identities=23% Similarity=0.321 Sum_probs=94.1 Q ss_pred EEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCCCC Q ss_conf 18999999223254553673279879998689986444899999972886666787368874898320589888628532 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEG 84 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~~~ 84 (375) |+|++|.|.|||||.+.+|+|++|+|+|+||||||||||+|||.|+++|.+ |+..+.++|+.|+....+ ...+..... T Consensus 1 M~ik~l~l~nFks~~d~~i~F~~Gi~~I~G~NGaGKStIldAI~~aL~g~~-~~~~~~d~i~~g~~~~~V-~l~F~~~~~ 78 (895) T PRK01156 1 MIIKRIRLKNFLSHDDSEIEFDTGINIITGKNGAGKSSIVDAIRFALFTDK-RTEKIEDMIKKGKNNLEV-ELEFRIGGH 78 (895) T ss_pred CEEEEEEEECEECCCCCEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCC-CCCCHHHHHHCCCCCEEE-EEEEEECCE T ss_conf 977699996700577872517999278889999987899999999977897-668789897689984699-999999997 Q ss_pred CEEEEEEEECCCCCCC--CCCCCCCCCCCC-CC--------CCCC----CCCCCEEECC--HHHCCCCCCHHHHHHCCCC Q ss_conf 0026675300246633--321125774333-21--------0123----3345202100--1100126872341210100 Q gi|254780766|r 85 LADISIKLETRDDRSV--RCLQINDVVIRV-VD--------ELNK----HLRISWLVPS--MDRIFSGLSMERRRFLDRM 147 (375) Q Consensus 85 ~~~~~~~~~~~~~~~~--k~~~~n~~~~~~-~~--------~l~~----~l~~v~~~p~--~~~li~~~p~~RR~flD~~ 147 (375) .+.+...+.....+.. ..+..+|..+.. .. .+.+ .|.-+.+.|+ ...++...|..||..|+.+ T Consensus 79 ~y~v~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~ilgl~~~~F~~~~~i~QG~~~~ll~~~~~eR~~il~~l 158 (895) T PRK01156 79 VYQIRRSIERRGKGSRREAYIKKDGSIIAEGFDDTTKYIEKNILGISKDVFLNSIFVGQGEMDSLISGDPAQRKKILDEI 158 (895) T ss_pred EEEEEEEEECCCCCCCCCEEEECCCCEEECCCHHHHHHHHHHHCCCCHHHHHHEEEEECCCHHHHHCCCHHHHHHHHHHH T ss_conf 89999885125778876538802883301140679999999863999888543057616467888608989899999999 No 17 >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo Probab=99.87 E-value=5.4e-21 Score=156.20 Aligned_cols=198 Identities=20% Similarity=0.332 Sum_probs=127.4 Q ss_pred EEEEEEEEECCCCHH-HEEE-ECCCCEEEEECCCCCCHHHHHHHHHHHCCC--CCCCCCCHHHHHHCCCCCEEEEEEEEC Q ss_conf 189999992232545-5367-327987999868998644489999997288--666678736887489832058988862 Q gi|254780766|r 5 IKIKFLNISEFRNYA-SLRL-VFDAQHTIFVGDNGVGKTNILEAISFLSPG--RGFRRASYADVTRIGSPSFFSTFARVE 80 (375) Q Consensus 5 M~i~~l~i~nFR~~~-~~~i-~f~~~~n~i~G~NG~GKT~iLEAI~~l~~g--ksfR~~~~~~li~~~~~~~~~~~~~~~ 80 (375) |+|++|.+.||++|. ...+ +|++++|+|+|||||||||++|||.|+.+- +..|+.++.|+|...+...-...+.++ T Consensus 1 m~Ik~i~l~gFKSf~~~~~i~pf~~~~t~IvGpNGsGKSNiiDAi~fvlG~~a~~lR~~~l~dlI~nS~~~~~~~~~~V~ 80 (212) T cd03274 1 LIITKLVLENFKSYAGEQVIGPFHKSFSAIVGPNGSGKSNVIDSMLFVFGFRASKMRQKKLSDLIHNSAGHPNLDSCSVE 80 (212) T ss_pred CEEEEEEECCCCCCCCCEEECCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHEECCCCCCCCCEEEEE T ss_conf 94889998782157898773257999549999998864888999999972327666551257751477899998747999 Q ss_pred CCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCHHHCCCCCCHHHHHHCCCCCCCCCHHHHHHHH Q ss_conf 85320026675300246633321125774333210123334520210011001268723412101000135846778887 Q gi|254780766|r 81 GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMI 160 (375) Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l~~v~~~p~~~~li~~~p~~RR~flD~~i~~~~~~y~~~l~ 160 (375) +.+.. ++|+. T Consensus 81 ---------v~F~~------------------------------------------------i~d~~------------- 90 (212) T cd03274 81 ---------VHFQE------------------------------------------------IIDKP------------- 90 (212) T ss_pred ---------EEHHH------------------------------------------------HHCCH------------- T ss_conf ---------98262------------------------------------------------23542------------- Q ss_pred HHHHHHHHHHHHHHCCCCCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCC Q ss_conf 7776666679886305654321--00245653279999999999999999999999985316430112201566676558 Q gi|254780766|r 161 DFERLMRGRNRLLTEGYFDSSW--CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238 (375) Q Consensus 161 ~y~K~LkqRN~lLk~~~~d~~~--l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~ 238 (375) + |+....|... .-++..+. +.| ... T Consensus 91 ----~-------l~~~gid~~~~rflilqgev----e~i--------a~m------------------------------ 117 (212) T cd03274 91 ----L-------LKSKGIDLDHNRFLILQGEV----EQI--------AQM------------------------------ 117 (212) T ss_pred ----H-------HCCCCEEEECCCEEEEECCH----HHH--------HHC------------------------------ T ss_conf ----1-------04676133125269983405----777--------757------------------------------ Q ss_pred CHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE Q ss_conf 96788887654553111000000000257320011001245510233122058999999999999999998708997899 Q gi|254780766|r 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILL 318 (375) Q Consensus 239 ~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilL 318 (375) |-|. =+ ..+++|-||+-+.+|||.+|-. ..+..|..+ T Consensus 118 -----------------------------PgK~-------~k--~is~LSGGEKsLtAlALlFAi~-----~~kPsPFyv 154 (212) T cd03274 118 -----------------------------PKKS-------WK--NISNLSGGEKTLSSLALVFALH-----HYKPTPLYV 154 (212) T ss_pred -----------------------------CCHH-------HH--HHHHCCCHHHHHHHHHHHHHHH-----CCCCCCEEE T ss_conf -----------------------------6413-------34--4656275189999999999996-----428995589 Q ss_pred EECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEEEEEC Q ss_conf 80122015989999999997417--980999806967854321260079972 Q gi|254780766|r 319 LDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKFMRIS 368 (375) Q Consensus 319 iDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~~~i~ 368 (375) +|||.|-||+.+..++.+++.+. +.|+|+.|+.+..++.-....-++.++ T Consensus 155 LDEVDAALD~~Nv~r~a~~ike~s~~aQFIVIThr~~tme~AD~L~GV~~~~ 206 (212) T cd03274 155 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELADRLVGIYKTN 206 (212) T ss_pred EECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHEEEEEEEC T ss_conf 7356424678889999999998477976999985889998515179899737 No 18 >COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] Probab=99.84 E-value=4.1e-20 Score=150.46 Aligned_cols=95 Identities=17% Similarity=0.216 Sum_probs=68.6 Q ss_pred CCCCCHHHHHCCCHHHHHHHHHHHHH----HHH-HHHHHCC--CCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEE Q ss_conf 24551023312205899999999999----999-9998708--99789980122015989999999997417--980999 Q gi|254780766|r 277 YCDKAITIAHGSTGEQKVVLVGIFLA----HAR-LISNTTG--FAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFM 347 (375) Q Consensus 277 ~~~~~~~~~~~S~Gqqk~~~l~l~La----~~~-~~~~~~~--~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~i 347 (375) -+++.++.+.+|.|..-.++++--.| .+. .+..... ..-|+|+|||.-||||.||+.+++.|... ..|+|+ T Consensus 252 ~~~geI~ls~lSdg~Rt~~Alvadiarr~v~LNp~Lsd~la~~tpgivLiDeIdlflhP~WQQqi~qkL~saFp~IQfIv 331 (440) T COG3950 252 GNGGEIPLSELSDGPRTKFALVADIARRCVVLNPYLSDALAKLTPGIVLIDEIDLFLHPKWQQQINQKLLSAFPEIQFIV 331 (440) T ss_pred CCCCCCCHHHCCCCHHHHHHHHHHHHHHHHHCCHHHCCHHHCCCCCEEEEEHHHHHCCHHHHHHHHHHHHHHCHHHHHHH T ss_conf 77771010330311488999999998889636821126544489866974220110288899999999986443450023 Q ss_pred EECCHHHHHHHH-CCEEEEEECCCE Q ss_conf 806967854321-260079972896 Q gi|254780766|r 348 TGTDKSVFDSLN-ETAKFMRISNHQ 371 (375) Q Consensus 348 Tt~~~~~~~~~~-~~~~~~~i~~g~ 371 (375) |||++.+++... +..++.++-+|. T Consensus 332 stHsP~vlsTv~~esIrlln~~~gd 356 (440) T COG3950 332 STHSPFVLSTVNGESIRLLNLSSGD 356 (440) T ss_pred HCCCCEEEEECCCCEEEEEECCCCC T ss_conf 3388658983162206874115766 No 19 >PRK03918 chromosome segregation protein; Provisional Probab=99.84 E-value=5.4e-19 Score=143.17 Aligned_cols=86 Identities=27% Similarity=0.378 Sum_probs=70.3 Q ss_pred EECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEE Q ss_conf 100124551023312205899999999999999999870899789980122015989999999997417---98099980 Q gi|254780766|r 273 LIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTG 349 (375) Q Consensus 273 ~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt 349 (375) +.+.+.|+..++..+|.||+=+++|||.||-+.++. +..|+++|||+++.||+.++..+++.|... +.||+|-| T Consensus 778 ~~~~~~g~~r~~~~LSGGE~~~~aLAL~Lals~~~~---~~~~~lflDEgfg~LD~~~~~~~~~~L~~l~~~~~qi~IIS 854 (882) T PRK03918 778 LFVVYEGKERPLGFLSGGERIALGLAFRLALSMYLA---GEISLLILDEPTPFLDEERRRKLVDIMERYLRKIPQVIIVS 854 (882) T ss_pred EEEECCCEECCCCCCCHHHHHHHHHHHHHHHHHHHH---CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE T ss_conf 999359836177778888999999999999999871---49994998799788798999999999999865899899995 Q ss_pred CCHHHHHHHHCC Q ss_conf 696785432126 Q gi|254780766|r 350 TDKSVFDSLNET 361 (375) Q Consensus 350 ~~~~~~~~~~~~ 361 (375) |+..+-+.+... T Consensus 855 H~~el~~~~d~~ 866 (882) T PRK03918 855 HDEELKDAADHV 866 (882) T ss_pred CHHHHHHHCCCE T ss_conf 757899867968 No 20 >TIGR00634 recN DNA repair protein RecN; InterPro: IPR004604 DNA repair protein RecN is thought to be DNA damage inducible and involved in recombinational processes. The N-terminal region of most of the bacterial RecN proteins sequenced to date contains an ATP/GTP binding domain within an SMC-like motif. SMC-like domains are involved in chromosomal scaffolding and segregation. It is possible that the function of RecN in homologous recombination is either structural or enzymatic or both. RecN may be involved in the proper positioning of the recombining segments of DNA, ensuring normal recombination. The observation that inactivation of this gene leads to a decreased transformation efficiency, as well as increased sensitivity to DNA-damaging agents, may be due to some defect in chromosomal partitioning or positioning during these recombination-dependent processes . The protein may function presynaptically to process double-stranded breaks to produce 3 single-stranded DNA intermediates during recombination. ; GO: 0005524 ATP binding, 0006281 DNA repair, 0006310 DNA recombination. Probab=99.82 E-value=6.5e-18 Score=136.11 Aligned_cols=331 Identities=15% Similarity=0.170 Sum_probs=190.4 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCC-C-- Q ss_conf 9999992232545536732798799986899864448999999728866667873688748983205898886285-3-- Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGM-E-- 83 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~-~-- 83 (375) |.+|+|.||--++.++++|+.|+|||+|+.|+|||.+|+||+||+++| -..++||.|++..++...+-... . T Consensus 2 L~~L~I~Nfa~I~~l~~eF~rGltVLTGETGaGKSm~i~Al~LL~G~r-----~~~~~vR~G~~~A~~eg~F~~~~~~~~ 76 (605) T TIGR00634 2 LTELRINNFALIRELTVEFERGLTVLTGETGAGKSMIIDALSLLLGQR-----AGASLVRSGENRAVVEGVFTTESEDDV 76 (605) T ss_pred CCEEEEHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHCCCCC-----CCCCEEECCCCCEEEEEEEEECCCCCC T ss_conf 630230454567776776626871430464550788776698705885-----476312337871478988850577775 Q ss_pred ----------------CCEEEEEEE-ECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEECCHHHCCCCCCHHHHHHC Q ss_conf ----------------200266753-00246633321125774333--21012333452021001100126872341210 Q gi|254780766|r 84 ----------------GLADISIKL-ETRDDRSVRCLQINDVVIRV--VDELNKHLRISWLVPSMDRIFSGLSMERRRFL 144 (375) Q Consensus 84 ----------------~~~~~~~~~-~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~v~~~p~~~~li~~~p~~RR~fl 144 (375) +.....+.+ .++.++. ...++||+.++. +.++... .+-++.+...+-.-.|+++|++| T Consensus 77 ~V~~~~~~~~~~~~~~~~~~~~i~~R~~~~~G~-S~~~~ng~~V~~~~L~e~~~~--l~~l~GQ~~~q~L~~~~~qr~lL 153 (605) T TIGR00634 77 PVADYTALQEIELEEEDEDEEVILRRSISRDGR-SRAYLNGKLVSASSLEELTSE--LLDLHGQHDQQLLLRPDEQRQLL 153 (605) T ss_pred CCCCCCHHHCCCCCCCCCCCEEEEEEEECCCCC-CEEEECCCCCCHHHHHHHHHH--HHHHHCCCHHHHCCCHHHHHHHH T ss_conf 010120333378888989736876643125788-467888821568999999987--44332342353205855789999 Q ss_pred CCCCCCC--C--HHHHHHHHHHHHHHHH---H----------HH------------------------------------ Q ss_conf 1000135--8--4677888777766666---7----------98------------------------------------ Q gi|254780766|r 145 DRMVFAI--D--PRHRRRMIDFERLMRG---R----------NR------------------------------------ 171 (375) Q Consensus 145 D~~i~~~--~--~~y~~~l~~y~K~Lkq---R----------N~------------------------------------ 171 (375) |..-.+- + ..|.+.+..|.+..++ | .- T Consensus 154 D~FA~~~~~~~~~~~~~~Y~~~~~~~~~L~~~~~~~~e~~~~~d~L~F~l~El~~~~l~~~dE~~~L~~e~~~Ls~~e~l 233 (605) T TIGR00634 154 DTFAGANLLEKVKAYRELYQAWLKARQQLKELQQKEQELAQRLDFLQFQLEELEEADLQPGDEDEALEAEQQRLSNLEKL 233 (605) T ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCHHHH T ss_conf 88608655899999999999999999999999999999999998999988554203699882689999999983017899 Q ss_pred ---------HHHC------------------------------------------------------------------- Q ss_conf ---------8630------------------------------------------------------------------- Q gi|254780766|r 172 ---------LLTE------------------------------------------------------------------- 175 (375) Q Consensus 172 ---------lLk~------------------------------------------------------------------- 175 (375) .|.. T Consensus 234 ~~~~~~a~~~L~~a~~~~d~~~~~~~~~~~~~~~~l~~~~~~d~~l~~~~e~v~~al~~v~ea~~~l~~~~del~~Dp~~ 313 (605) T TIGR00634 234 RELSQNALAALRGALSDVDVQEGALLEGLGEAQLALASEESIDGSLRELAEQVENALTEVEEATRELREYLDELEFDPER 313 (605) T ss_pred HHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHH T ss_conf 99999999999621566755404799999999986777508897589999999999999999999999737786769688 Q ss_pred ----------------CCCC-----------------------------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf ----------------5654-----------------------------3210024565327999999999999999999 Q gi|254780766|r 176 ----------------GYFD-----------------------------SSWCSSIEAQMAELGVKINIARVEMINALSS 210 (375) Q Consensus 176 ----------------~~~d-----------------------------~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~ 210 (375) ++.. ....+....|+...+..++..|...-.+|.. T Consensus 314 L~~i~~Rl~~~~~L~rKY~~~~~~~l~~~~~~~~El~~L~~~~~~~~~L~~~~~~l~~~~~~~A~~ls~~R~~~A~~L~~ 393 (605) T TIGR00634 314 LNEIEERLAEIKRLKRKYGASVEEVLEYAEKIKEELDQLDDSDESLEALEEEVDKLEEELAKAAEALSLIRRKAAERLAK 393 (605) T ss_pred HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99999999999999875268988999999999999986655434799999999999999999999986999999999999 Q ss_pred HHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCH---HHHHC Q ss_conf 999998531643011220156667655896788887654553111000000000257320011001245510---23312 Q gi|254780766|r 211 LIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAI---TIAHG 287 (375) Q Consensus 211 ~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~---~~~~~ 287 (375) .+...++.+......+...-...... ..++.....-....=...+.|..|.-.-.|.|.-|-+.. -...+ T Consensus 394 ~v~~~Lk~L~Me~a~F~v~~~~~~~~-------~~~~~~~~a~~L~~g~~~r~~~~G~D~V~F~fs~n~G~~~~PLak~A 466 (605) T TIGR00634 394 RVEQELKALAMEKAEFTVELKTSLPS-------RNDEAPSVALALVSGAKARAGAYGADQVEFLFSANTGEPVKPLAKVA 466 (605) T ss_pred HHHHHHHHCCCCCEEEEEEEEECCCC-------CCCCCCCEEEEECCCCEEECCCCCCCEEEEEEECCCCCCCCCHHHHC T ss_conf 99999751021213789988523532-------22357740566247850202656743157864137878987535443 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHC-CCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHH Q ss_conf 205899999999999999999870-899789980122015989999999997417--980999806967854 Q gi|254780766|r 288 STGEQKVVLVGIFLAHARLISNTT-GFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFD 356 (375) Q Consensus 288 S~Gqqk~~~l~l~La~~~~~~~~~-~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~ 356 (375) |-||..-+.|||+.- +.... ..-+-+++|||..+.-=.--..|-+.|..+ ..||++=||-+.+-. T Consensus 467 SGGELSRv~LAL~~~----ls~~~~~~~~TliFDEvDvGvsG~~A~~ia~~L~~LS~~~QV~cvTHlp~vAA 534 (605) T TIGR00634 467 SGGELSRVMLALKVV----LSSSDPAAVTTLIFDEVDVGVSGKTAQAIAKKLAQLSERKQVLCVTHLPQVAA 534 (605) T ss_pred CCCHHHHHHHHHHHH----CCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCEEEECCCHHHHH T ss_conf 661699999999985----42346567871276316417646899999999999853095899818379897 No 21 >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression. Probab=99.80 E-value=1.4e-18 Score=140.42 Aligned_cols=68 Identities=25% Similarity=0.402 Sum_probs=57.6 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHH Q ss_conf 12205899999999999999999870899789980122015989999999997417---98099980696785432 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSL 358 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~ 358 (375) ++|-||+.+.++|+.+|. ...+..|+.++|||.|.||+.++.++.+++.+. +.|+||.||++...... T Consensus 94 lLSGGEksl~alal~~ai-----~~~~p~p~~iLDEvdAaLD~~N~~r~~~~i~el~~~~sQfIiITH~~~~m~~a 164 (178) T cd03239 94 ILSGGEKSLSALALIFAL-----QEIKPSPFYVLDEIDAALDPTNRRRVSDMIKEMAKHTSQFIVITLKKEMFENA 164 (178) T ss_pred CCCCCHHHHHHHHHHHHH-----HCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHC T ss_conf 167525899999999999-----71389966998276554798899999999999973899899998689999747 No 22 >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.79 E-value=1.3e-17 Score=134.07 Aligned_cols=228 Identities=20% Similarity=0.227 Sum_probs=153.1 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEEEEEEECCC---- Q ss_conf 9999992232545536732798799986899864448999999728866667873688748983205898886285---- Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGM---- 82 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~~~~~~~~~~~~~~---- 82 (375) |..|.|+||--+++++++|++|+|+|+|+.|||||-|++||.+++++| ...++|+.|++...+ .+.+... T Consensus 1 L~~L~IkNfalId~l~l~F~~GlnVlTGETGAGKSIlidAL~lllG~R-----a~~~~IR~g~~~a~v-ea~F~i~~~~~ 74 (276) T cd03241 1 LLELSIKNFALIEELELDFEEGLTVLTGETGAGKSILLDALSLLLGGR-----ASADLIRSGAEKAVV-EGVFDISDEEE 74 (276) T ss_pred CCEEEEEEEEEEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCC-----CCCCCCCCCCCEEEE-EEEEECCCCHH T ss_conf 968999608989887982599975887899888999999999962899-----884533588850899-99997599668 Q ss_pred ----------CCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCEEECCHHHCCCCCCHHHHHHCCCCCCCC Q ss_conf ----------32002667530024663332112577433321012333-4520210011001268723412101000135 Q gi|254780766|r 83 ----------EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL-RISWLVPSMDRIFSGLSMERRRFLDRMVFAI 151 (375) Q Consensus 83 ----------~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l-~~v~~~p~~~~li~~~p~~RR~flD~~i~~~ 151 (375) +...++.+++.+..++.+ ..++||.+++. +.|...- ..+-++.+......-.|+..|.+||... T Consensus 75 ~~~~l~~~~~~~d~~liirR~i~~~GrS-r~~INg~~vt~-~~L~~l~~~LidIHgQhe~q~Ll~~~~h~~lLD~~~--- 149 (276) T cd03241 75 AKALLLELGIEDDDDLIIRREISRKGRS-RYFINGQSVTL-KLLRELGSLLVDIHGQHDHQNLLNPERQLDLLDGGL--- 149 (276) T ss_pred HHHHHHHCCCCCCCCEEEEEEECCCCCC-EEEECCEECCH-HHHHHHHHHEEEECCCCCCHHHCCHHHHHHHHCCCC--- T ss_conf 8999973799778844999998689970-69999998379-999999740089907961055549867999876986--- Q ss_pred CHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC Q ss_conf 84677888777766666798863056543210024565327999999999999999999999998531643011220156 Q gi|254780766|r 152 DPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGF 231 (375) Q Consensus 152 ~~~y~~~l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~ 231 (375) +.++ |. ++ .. T Consensus 150 --------------------------------d~ie----------------f~--------------------~~--~~ 159 (276) T cd03241 150 --------------------------------DDVE----------------FL--------------------FS--TN 159 (276) T ss_pred --------------------------------CCHH----------------HH--------------------CC--CC T ss_conf --------------------------------1002----------------12--------------------15--99 Q ss_pred CCCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 66765589678888765455311100000000025732001100124551023312205899999999999999999870 Q gi|254780766|r 232 LDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTT 311 (375) Q Consensus 232 ~~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~ 311 (375) ... .. . | -...+|.||..-+.||++.. -... T Consensus 160 ~g~----~~--------~------------------~--------------l~~~aSgGElSRi~LAlk~~-----~~~~ 190 (276) T cd03241 160 PGE----PL--------K------------------P--------------LAKIASGGELSRLMLALKAI-----LARK 190 (276) T ss_pred CCC----CC--------C------------------H--------------HHHHHCHHHHHHHHHHHHHH-----HCCC T ss_conf 899----75--------2------------------4--------------67662764899999999999-----6278 Q ss_pred CCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEE Q ss_conf 899789980122015989999999997417--98099980696785432126007 Q gi|254780766|r 312 GFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKF 364 (375) Q Consensus 312 ~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~ 364 (375) ...|.+++|||.+..--.--..+-+.|.++ +.|||+-||-+.+-..-.....+ T Consensus 191 ~~~~tliFDEID~GigG~~A~~vg~~l~~ls~~~QVi~ITHlpQvAa~ad~H~~V 245 (276) T cd03241 191 DAVPTLIFDEIDTGISGEVAQAVGKKLKELSRSHQVLCITHLPQVAAMADNHFLV 245 (276) T ss_pred CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHCCCCEEEE T ss_conf 8998579844578989899999999999984798799981779988413767999 No 23 >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Probab=99.78 E-value=5.4e-19 Score=143.17 Aligned_cols=142 Identities=27% Similarity=0.398 Sum_probs=98.9 Q ss_pred EEEEEEEEECCCCHHHEEEE--CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCC--CCCHHHHHHCCCCCEEEEEEEEC Q ss_conf 18999999223254553673--279879998689986444899999972886666--78736887489832058988862 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLV--FDAQHTIFVGDNGVGKTNILEAISFLSPGRGFR--RASYADVTRIGSPSFFSTFARVE 80 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~--f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR--~~~~~~li~~~~~~~~~~~~~~~ 80 (375) |+|.+|.|.|||+|.+.+++ |.+|+|+|+|+||||||||||||.|+++|+..| +....++++.|+.. ..+...+. T Consensus 1 M~i~~L~L~Nf~S~~~~~~~~~f~~gi~lI~G~nGsGKSSIldAI~~ALyG~~~~~~~~~~~~~i~~g~~~-~~V~l~F~ 79 (908) T COG0419 1 MKILRLRLKNFRSFKDIDIEKLFDSGIFLIVGPNGAGKSSILDAITFALYGKTPRLGAFSLDDLIRAGEKS-ASVELEFE 79 (908) T ss_pred CCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCCCC-EEEEEEEE T ss_conf 98604675466565556223157888379989999978899999999982898775440155898658860-79999999 Q ss_pred CCCCCEEEEEEEECCCCC---CCCCCCCCCCCCCC-C-------CCC----CCCCCCCEEECCH--HHCCCCCCHHHHHH Q ss_conf 853200266753002466---33321125774333-2-------101----2333452021001--10012687234121 Q gi|254780766|r 81 GMEGLADISIKLETRDDR---SVRCLQINDVVIRV-V-------DEL----NKHLRISWLVPSM--DRIFSGLSMERRRF 143 (375) Q Consensus 81 ~~~~~~~~~~~~~~~~~~---~~k~~~~n~~~~~~-~-------~~l----~~~l~~v~~~p~~--~~li~~~p~~RR~f 143 (375) .....+.+...+....+. .......+|..+.. . ..+ .+.|.-+.+.|+. ..++...|..|... T Consensus 80 ~~g~~Y~i~R~~~r~~~~~~~~~~~~~~~g~~~~~~~~~v~~~i~~llgld~~~f~~~v~l~QGe~~~fl~~~~~er~~i 159 (908) T COG0419 80 VNGKKYRIEREFRRGRGQSTGSLQIIEVDGERIADGKKDVNEKIEELLGLDKDTFTRSVYLPQGEFDAFLKSKPKERKEI 159 (908) T ss_pred ECCEEEEEEEEEECCCCCCCCCHHHHCCCCCEEECCCCCHHHHHHHHHCCCHHHHHHHEEECHHHHHHHHHCCHHHHHHH T ss_conf 89979999998634778776420242047752000422189999988498999876761642286999986594669999 Q ss_pred CCCC Q ss_conf 0100 Q gi|254780766|r 144 LDRM 147 (375) Q Consensus 144 lD~~ 147 (375) +|.+ T Consensus 160 l~~l 163 (908) T COG0419 160 LDEL 163 (908) T ss_pred HHHH T ss_conf 9999 No 24 >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria. Probab=99.77 E-value=2e-16 Score=126.38 Aligned_cols=73 Identities=19% Similarity=0.317 Sum_probs=57.7 Q ss_pred CCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHH-HHHHCCCCEEEEECCHH Q ss_conf 245510233122058999999999999999998708997899801220159899999999-97417980999806967 Q gi|254780766|r 277 YCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFR-IVTDIGSQIFMTGTDKS 353 (375) Q Consensus 277 ~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~-~l~~~~~Qv~iTt~~~~ 353 (375) .+|+.++..-+|.||+-++++|+.-|-+ +-.....|+ +||-|++.||..+|..++. |+++...|||+=+|+.. T Consensus 542 ~~g~~i~~~~LSaGEkQilalsfi~aL~---~~Sg~~~Pi-iIDTPlGrLD~~hR~~li~~y~P~~s~QVIlLsTdtE 615 (650) T TIGR03185 542 NNGDHVPKERLSAGEKQILAIALLWALA---RVSGRRLPV-IIDTPLGRLDSSHRENLVVNYFPKASHQVLLLSTDEE 615 (650) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHH---HHCCCCCCE-EEECCCCCCCHHHHHHHHHHHCCCCCCEEEEECCHHH T ss_conf 8999888767897899999999999999---860898988-9848742017899999999848540573899725154 No 25 >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=99.77 E-value=3.3e-17 Score=131.55 Aligned_cols=66 Identities=29% Similarity=0.461 Sum_probs=61.6 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC---CCCCCHHHHHHCCCCCE Q ss_conf 9999992232545536732798799986899864448999999728866---66787368874898320 Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG---FRRASYADVTRIGSPSF 72 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks---fR~~~~~~li~~~~~~~ 72 (375) |++|++.||+||++++++|+|++|+|+|+||+|||+||+||.+.++|+. -|+.+.+++|++|++.. T Consensus 1 I~~I~l~NFm~h~~~~~~f~p~lN~IiG~NGsGKSsIl~AI~lgLGgk~~~~~Rg~s~k~fIK~G~~~A 69 (198) T cd03276 1 IESITLKNFMCHRHLQIEFGPRVNFIVGNNGSGKSAILTALTIGLGGKASDTNRGSSLKDLIKDGESSA 69 (198) T ss_pred CCEEEEEEECCCCCEEEEECCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCEE T ss_conf 947999813351213896089828998899998899999999863888133653133999986787438 No 26 >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function. Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w Probab=99.73 E-value=1.9e-16 Score=126.58 Aligned_cols=83 Identities=18% Similarity=0.300 Sum_probs=63.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|-||+..+++|+.+|-+. .+..||+++|||.|.||+.+...+++.|.+. +.++++.||+...+.. .|.. T Consensus 112 ~~LSGGqkQRvAiAr~~A~~~-----~~p~~iliLDEPTs~LD~~~~~~i~~~l~~l~~~~t~IiITH~~~~i~~-AD~I 185 (197) T cd03278 112 SLLSGGEKALTALALLFAIFR-----VRPSPFCVLDEVDAALDDANVERFARLLKEFSKETQFIVITHRKGTMEA-ADRL 185 (197) T ss_pred CCCCHHHHHHHHHHHHHHHHH-----CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH-CCEE T ss_conf 438878999999999999983-----4999789971785538989999999999998569989999849999985-8999 Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) -.+.+.+|.+. T Consensus 186 i~v~m~~~~~~ 196 (197) T cd03278 186 YGVTMQESGVS 196 (197) T ss_pred EEEEECCCCCC T ss_conf 99983799879 No 27 >KOG0250 consensus Probab=99.69 E-value=1.1e-15 Score=121.47 Aligned_cols=135 Identities=24% Similarity=0.336 Sum_probs=94.9 Q ss_pred EEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC---CCCCCHHHHHHCCCCCEEEEE-EEECC Q ss_conf 89999992232545536732798799986899864448999999728866---667873688748983205898-88628 Q gi|254780766|r 6 KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG---FRRASYADVTRIGSPSFFSTF-ARVEG 81 (375) Q Consensus 6 ~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks---fR~~~~~~li~~~~~~~~~~~-~~~~~ 81 (375) +|.+|++.||.||.++.|+|+|.+|+|+|+||||||.||-||.++++||. -|+++++++|+.|+.+..+.. ....| T Consensus 41 ~I~sI~L~NFMCHsnL~IeFg~~vNfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A~IsItL~N~G 120 (1074) T KOG0250 41 KIESIHLTNFMCHSNLLIEFGPRVNFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSAKISITLSNSG 120 (1074) T ss_pred EEEEEEEEEECCCCCCEECCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEECCC T ss_conf 38999975210333541025887137646898748999999998626531456530439999967875148999982577 Q ss_pred CC------CCEEEEEEEECCCCCCCCCCC--CCCCCCCC-CCCC---CCCC------CCCEEECCHHH--CCCCCCHHH Q ss_conf 53------200266753002466333211--25774333-2101---2333------45202100110--012687234 Q gi|254780766|r 82 ME------GLADISIKLETRDDRSVRCLQ--INDVVIRV-VDEL---NKHL------RISWLVPSMDR--IFSGLSMER 140 (375) Q Consensus 82 ~~------~~~~~~~~~~~~~~~~~k~~~--~n~~~~~~-~~~l---~~~l------~~v~~~p~~~~--li~~~p~~R 140 (375) .. ....|++...++.+.+..... -+|..++. .+++ ...| |++|++-+.-+ |-.+.|+.. T Consensus 121 ~~Afk~eiyG~~IiIER~I~~~~S~~~~~~~~~grvVStKk~dl~~vv~~f~I~veNP~~~lsQD~aR~FL~~~~p~dk 199 (1074) T KOG0250 121 LDAFKPEIYGNSIIIERTIRRSSSTYYLLRSANGRVVSTKKEDLDTVVDHFNIQVENPMFVLSQDAARSFLANSNPKDK 199 (1074) T ss_pred CCCCCHHHCCCEEEEEEEECCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHCHHHHHHHHHCCCHHHH T ss_conf 6667745438805999862356525888760367622361988999999828677784023048889999854993778 No 28 >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence. Probab=99.67 E-value=9.3e-16 Score=122.06 Aligned_cols=81 Identities=26% Similarity=0.343 Sum_probs=57.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHH-HHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 122058999999999999999998708997899801220159899999-9999741----79809998069678543212 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNA-LFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~-ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) .+|.||+....+++++|-|..+- ..++++++|||.++||+.+++. +.+.+.. .+..|++.|||.+... ..+ T Consensus 115 ~LSgGqkq~~~l~~RlalAraL~---~~p~lllLDEPTs~LD~~~~~~~l~~ll~~~~~~~~~tiIivtHd~e~~~-~aD 190 (204) T cd03240 115 RCSGGEKVLASLIIRLALAETFG---SNCGILALDEPTTNLDEENIEESLAEIIEERKSQKNFQLIVITHDEELVD-AAD 190 (204) T ss_pred HCCHHHCCCCHHHHHHHHHHHHH---CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH-HCC T ss_conf 27864307230756999999984---59998998187666997899999999999998569989999944989998-499 Q ss_pred CEEEEEE-CCCEE Q ss_conf 6007997-28968 Q gi|254780766|r 361 TAKFMRI-SNHQA 372 (375) Q Consensus 361 ~~~~~~i-~~g~~ 372 (375) . ++.| .+|++ T Consensus 191 ~--vv~i~kdG~~ 201 (204) T cd03240 191 H--IYRVEKDGRQ 201 (204) T ss_pred E--EEEEECCCCC T ss_conf 5--9999589883 No 29 >COG4637 Predicted ATPase [General function prediction only] Probab=99.67 E-value=2.3e-15 Score=119.47 Aligned_cols=73 Identities=23% Similarity=0.318 Sum_probs=58.5 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC--CCEEEEECCHHHHHHHHCC Q ss_conf 33122058999999999999999998708997899801220159899999999974179--8099980696785432126 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG--SQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~--~Qv~iTt~~~~~~~~~~~~ 361 (375) .-.+|.|+.|.+.++..|- .. ...|++++|||+..|||.....+........ .||||+||+..++..+... T Consensus 268 ~~eLSDGTlRfl~l~t~Ll-----sp--~~p~ll~ldEPE~sLHP~lL~~La~~~~sAak~sQv~VsTHS~rLl~~~e~~ 340 (373) T COG4637 268 DRELSDGTLRFLALATLLL-----SP--RPPPLLLLDEPETSLHPDLLPALAELMRSAAKRSQVIVSTHSPRLLNAVEEH 340 (373) T ss_pred HHHCCCCHHHHHHHHHHHC-----CC--CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCCC T ss_conf 4203533899999999983-----99--9996267458523358769999999999862055189982779999535636 Q ss_pred EE Q ss_conf 00 Q gi|254780766|r 362 AK 363 (375) Q Consensus 362 ~~ 363 (375) +. T Consensus 341 ~v 342 (373) T COG4637 341 SV 342 (373) T ss_pred CE T ss_conf 45 No 30 >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for Probab=99.65 E-value=2.2e-14 Score=113.06 Aligned_cols=69 Identities=20% Similarity=0.279 Sum_probs=63.1 Q ss_pred EEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC---CCCCCHHHHHHCCCCCEEE Q ss_conf 89999992232545536732798799986899864448999999728866---6678736887489832058 Q gi|254780766|r 6 KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG---FRRASYADVTRIGSPSFFS 74 (375) Q Consensus 6 ~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks---fR~~~~~~li~~~~~~~~~ 74 (375) .|.+|++.||.+|+.+++.|+|++|+|+|+||+|||+|+.||.+.+.|+. -|+.+..++|++|+++.++ T Consensus 2 ~I~rI~l~NFmty~~~~~~~gp~lN~IiGpNGSGKSsIv~AI~lgLGG~p~~lgRa~~v~~fVK~G~~~~~i 73 (213) T cd03277 2 SIVRIKLENFVTYDETEFRPGPSLNMIIGPNGSGKSSIVCAICLGLGGKPKLLGRAKKVGEFVKRGCDEGTI 73 (213) T ss_pred EEEEEEEEEEECCEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHHCCCHHHCCCHHHHHHHHHCCCCCEEE T ss_conf 289999973001104699549975799889988789999999988189800045265699998578764289 No 31 >KOG0979 consensus Probab=99.63 E-value=1.2e-14 Score=114.85 Aligned_cols=120 Identities=20% Similarity=0.315 Sum_probs=89.9 Q ss_pred EEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC---CCCCCHHHHHHCCCCCEEEEEEEECCC Q ss_conf 89999992232545536732798799986899864448999999728866---667873688748983205898886285 Q gi|254780766|r 6 KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG---FRRASYADVTRIGSPSFFSTFARVEGM 82 (375) Q Consensus 6 ~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks---fR~~~~~~li~~~~~~~~~~~~~~~~~ 82 (375) -|-+|++.||-.|+.+++-|+|.+|.|+||||+|||+|+-||.++++|+. -|+.+..++|++|++.+.+-.. +.+. T Consensus 21 sIvrI~l~NF~Ty~~~e~~pgpsLNmIiGpNGSGKSSiVcAIcLglgG~Pk~lGRak~VgeyIK~G~~~g~IEI~-l~~~ 99 (1072) T KOG0979 21 SIVRIELHNFLTYDHTEFLPGPSLNMIIGPNGSGKSSIVCAICLGLGGKPKLLGRAKKVGEYIKRGEDEGYIEIE-LKDK 99 (1072) T ss_pred CEEEEEEEEEEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHHHCCCCHHHCCCHHHHHHHHHCCCCCCEEEEE-EECC T ss_conf 669999740044433344378861268778989704889999997279744314355799999647766369999-9627 Q ss_pred CCCEEEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCC-----CEEECCH Q ss_conf 320026675300246633321125774333--2101233345-----2021001 Q gi|254780766|r 83 EGLADISIKLETRDDRSVRCLQINDVVIRV--VDELNKHLRI-----SWLVPSM 129 (375) Q Consensus 83 ~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~-----v~~~p~~ 129 (375) +. ++++.+.+..++. ..+++|++-++. ..++.+.|++ +-|.|++ T Consensus 100 ~e--~~~ItR~I~~~k~-S~y~iN~~a~t~s~i~elv~~fNIQi~NLCqFLpQD 150 (1072) T KOG0979 100 DE--TLTITRLISRDKE-SKYFINDSATTKSEIEELVAHFNIQIDNLCQFLPQD 150 (1072) T ss_pred CC--CEEEEEEEEECCC-CCEEECCCHHHHHHHHHHHHHHHCCCCCHHHHCCHH T ss_conf 88--6479998730577-535545521006899999999703127465435687 No 32 >KOG0018 consensus Probab=99.59 E-value=1e-14 Score=115.31 Aligned_cols=137 Identities=18% Similarity=0.271 Sum_probs=92.1 Q ss_pred EEEEEEEEECCCCHHHEE-EECCCCEEEEECCCCCCHHHHHHHHHHHCCCC--CCCCCCHHHHHHCCCCCEEEEEEEECC Q ss_conf 189999992232545536-73279879998689986444899999972886--666787368874898320589888628 Q gi|254780766|r 5 IKIKFLNISEFRNYASLR-LVFDAQHTIFVGDNGVGKTNILEAISFLSPGR--GFRRASYADVTRIGSPSFFSTFARVEG 81 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~-i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gk--sfR~~~~~~li~~~~~~~~~~~~~~~~ 81 (375) |+|..|.|.||+||...+ |-|-..+|.|+|||||||||++|||+|+++-+ +.|++..++||. |.+-...+.+.+.- T Consensus 2 g~L~~lEieNFKSYkGh~~iGPF~~FTaIIGPNGSGKSNlMDAISFVLGekss~LR~~~lkdLIy-g~~i~~~v~l~Y~~ 80 (1141) T KOG0018 2 GRLLTLEIENFKSYKGHQVIGPFDRFTAIIGPNGSGKSNLMDAISFVLGEKSSHLRVSHLKDLIY-GKPIRKPVTLKYEE 80 (1141) T ss_pred CCEEEEEHHCCCCCCCCEEECCCHHCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHC-CCCCCCCHHHEEEC T ss_conf 85145301012000596442670211154689987627889888998547775455440888863-77669850330443 Q ss_pred CC-CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCC---C-------CCCEEECCHHHCCCCCCHHHHHHCCCC Q ss_conf 53-200266753002466333211257743332101233---3-------452021001100126872341210100 Q gi|254780766|r 82 ME-GLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH---L-------RISWLVPSMDRIFSGLSMERRRFLDRM 147 (375) Q Consensus 82 ~~-~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~---l-------~~v~~~p~~~~li~~~p~~RR~flD~~ 147 (375) .+ ..... .+.+. ++...+++|++.++. +++... + +...|..+...+....|.++=++++.+ T Consensus 81 ~dg~~~~F--~R~I~--~G~seY~Idn~~Vt~-~eY~~eLek~nIlVkARNFLVFQGdVe~Ia~ksPkElt~LFEEI 152 (1141) T KOG0018 81 GDGETRRF--TRAIN--GGTSEYMIDNEIVTR-EEYLEELEKINILVKARNFLVFQGDVEKIAGKNPKELTALFEEI 152 (1141) T ss_pred CCCHHHHH--HHHHC--CCCEEEEECCEEECH-HHHHHHHHHCCEEEEEEEEEEEECHHHHHHCCCHHHHHHHHHHH T ss_conf 88412345--44303--884069887863129-99999986376688611467860508888601989999999997 No 33 >KOG0933 consensus Probab=99.58 E-value=3.5e-15 Score=118.30 Aligned_cols=122 Identities=23% Similarity=0.294 Sum_probs=86.2 Q ss_pred EEEEEEEEECCCCHHH-EEE-ECCCCEEEEECCCCCCHHHHHHHHHHHCCC---CCCCCCCHHHHHHCCCCCEE---EEE Q ss_conf 1899999922325455-367-327987999868998644489999997288---66667873688748983205---898 Q gi|254780766|r 5 IKIKFLNISEFRNYAS-LRL-VFDAQHTIFVGDNGVGKTNILEAISFLSPG---RGFRRASYADVTRIGSPSFF---STF 76 (375) Q Consensus 5 M~i~~l~i~nFR~~~~-~~i-~f~~~~n~i~G~NG~GKT~iLEAI~~l~~g---ksfR~~~~~~li~~~~~~~~---~~~ 76 (375) |+|++|.|.+|+||.. +.| .|+|.+|.|+|-|||||||||+||+|+++- ...|++++.|||..+...++ .+. T Consensus 1 M~IkeiiLDGFKSYa~rTvI~~fDp~FNAITGlNGSGKSNILDsICFvLGI~nl~~VRA~nlqeLIyk~GQAGiTkAsVs 80 (1174) T KOG0933 1 MHIKEIILDGFKSYATRTVISGFDPQFNAITGLNGSGKSNILDSICFVLGITNLSQVRASNLQELIYKNGQAGITKASVS 80 (1174) T ss_pred CCHHHHHHCCHHCCEEEEECCCCCCCCCHHHCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEE T ss_conf 95055312120010024420488865001205777771478889999982452888888789999984686664257999 Q ss_pred EEECC---------CCCCEEEEEEEECCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEEC Q ss_conf 88628---------5320026675300246633321125774333--210123334520210 Q gi|254780766|r 77 ARVEG---------MEGLADISIKLETRDDRSVRCLQINDVVIRV--VDELNKHLRISWLVP 127 (375) Q Consensus 77 ~~~~~---------~~~~~~~~~~~~~~~~~~~k~~~~n~~~~~~--~~~l~~~l~~v~~~p 127 (375) ..+++ -+...+|++.+.+.-.+.. .+.|||..... ..+|+..+.+..=.| T Consensus 81 VvFdNtdk~~SP~G~E~h~EIsVtRqIv~gG~~-KylINGh~a~~~~vq~lF~SVqLNvNNP 141 (1174) T KOG0933 81 VVFDNTDKARSPLGYEHHDEISVTRQIVVGGTN-KYLINGHLAQNSKVQDLFCSVQLNVNNP 141 (1174) T ss_pred EEECCCCCCCCCCCCCCCCEEEEEEEEEECCCE-EEEECCEECCHHHHHHHHHHHCCCCCCC T ss_conf 996589745699986568803789999965730-3777670076357999988854257998 No 34 >COG1106 Predicted ATPases [General function prediction only] Probab=99.57 E-value=1.2e-13 Score=108.22 Aligned_cols=65 Identities=23% Similarity=0.321 Sum_probs=49.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHH Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSL 358 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~ 358 (375) --|.|-+|.+.+.-.+.- ...-.+++||++++|||..-..+++.+.+. ..|+|+|||+...++.. T Consensus 251 ~~~~G~kk~~~i~~~l~~--------~~~k~l~iDEie~~lHp~lm~~~l~~~~~~~~~~niq~~~TTH~~e~id~~ 319 (371) T COG1106 251 EEGEGFKKALIIVPLLSD--------LNDKVLLIDEIENGLHPSLMILILETLEDKVKNNNIQVFLTTHSTEFIDLL 319 (371) T ss_pred EECCHHHHHHHHHHHHHH--------CCCCEEEEEHHHHCCCHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHH T ss_conf 014307778888754552--------477469950354420879999999998763147437887310038999999 No 35 >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini. Probab=99.53 E-value=9.3e-14 Score=108.99 Aligned_cols=67 Identities=24% Similarity=0.364 Sum_probs=56.8 Q ss_pred EEEEEEEEECCCCH-HHEEEECCC----CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCH---HHHHHCCCCC Q ss_conf 18999999223254-553673279----8799986899864448999999728866667873---6887489832 Q gi|254780766|r 5 IKIKFLNISEFRNY-ASLRLVFDA----QHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY---ADVTRIGSPS 71 (375) Q Consensus 5 M~i~~l~i~nFR~~-~~~~i~f~~----~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~---~~li~~~~~~ 71 (375) |++.+|++.||++| +..+|+|++ ++++|.|+||+||||||+||.|+++|+..|..+. .+.++.+++. T Consensus 1 Mk~~~L~l~nF~~y~g~~~IDF~~~~~~~lflI~G~nGsGKSTIlDAI~~aLYGk~~r~~~~~~~~~~~~~ge~~ 75 (213) T cd03279 1 MKPLKLELKNFGPFREEQVIDFTGLDNNGLFLICGPTGAGKSTILDAITYALYGKTPRYGRQENLRSVFAPGEDT 75 (213) T ss_pred CEEEEEEEECCCCCCCCEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCE T ss_conf 905799997750458971784876787888999889999788999999999838882336641000244567844 No 36 >PRK10246 exonuclease subunit SbcC; Provisional Probab=99.52 E-value=9.9e-13 Score=102.30 Aligned_cols=145 Identities=17% Similarity=0.193 Sum_probs=86.0 Q ss_pred EEEEEEEEECCCCHH-HEEEECCC------CEEEEECCCCCCHHHHHHHHHHHCCCCCCCC----CCHHHHHHCCCCCEE Q ss_conf 189999992232545-53673279------8799986899864448999999728866667----873688748983205 Q gi|254780766|r 5 IKIKFLNISEFRNYA-SLRLVFDA------QHTIFVGDNGVGKTNILEAISFLSPGRGFRR----ASYADVTRIGSPSFF 73 (375) Q Consensus 5 M~i~~l~i~nFR~~~-~~~i~f~~------~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~----~~~~~li~~~~~~~~ 73 (375) |++-+|+|+||.+|. ..+|+|+. |+=+|+|+||||||||||||.|+++|++-|. ....++++.+....+ T Consensus 1 MrPl~L~l~~fgsy~~~~~IDFt~~~l~~~gLFlI~G~TGAGKSTIlDAItfALYG~~~r~~~~~~~~~~~~~~~~~~~~ 80 (1047) T PRK10246 1 MKILSLRLKNLNSLKGEWKIDFTAEPFASNGLFAITGPTGAGKTTLLDAICLALYHETPRLNNVSQSQNDLMTRDTAECL 80 (1047) T ss_pred CCCEEEEEECCCCCCCCEEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCCCEE T ss_conf 95359998550178898467489864566887888899999889999999999589988888877560556228999668 Q ss_pred EEEEEECCCCCCEEEEEEEECCCCC--CC------CCCC-CCCCCCC-CC-------CCCCC----CCCCCEEECCH--H Q ss_conf 8988862853200266753002466--33------3211-2577433-32-------10123----33452021001--1 Q gi|254780766|r 74 STFARVEGMEGLADISIKLETRDDR--SV------RCLQ-INDVVIR-VV-------DELNK----HLRISWLVPSM--D 130 (375) Q Consensus 74 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~------k~~~-~n~~~~~-~~-------~~l~~----~l~~v~~~p~~--~ 130 (375) +. ..+......+.+.........+ +. .... -+|..+. .. .++.+ .|.=+.+.|+. . T Consensus 81 Ve-l~F~~~g~~Yri~r~~~~~r~~~~g~~~~~~~~l~~~~dg~~~~~k~~~v~~~I~~llGLd~~qF~q~v~LpQG~F~ 159 (1047) T PRK10246 81 AE-VEFEVKGEAYRAFWSQNRARNQPDGNLQAPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFA 159 (1047) T ss_pred EE-EEEEECCEEEEEEEEHHHCCCCCCCCEECCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHEECCCCHH T ss_conf 99-99999998999986155305599985421124677558988505637889999999979999991143067511169 Q ss_pred HCCCCCCHHHHHHCCCCCCCC Q ss_conf 001268723412101000135 Q gi|254780766|r 131 RIFSGLSMERRRFLDRMVFAI 151 (375) Q Consensus 131 ~li~~~p~~RR~flD~~i~~~ 151 (375) .++..+|..|+..|-+ +|+. T Consensus 160 ~FL~a~~~eR~~iL~~-LF~t 179 (1047) T PRK10246 160 AFLNAKPKERAELLEE-LTGT 179 (1047) T ss_pred HHHCCCHHHHHHHHHH-HHCC T ss_conf 8867996889999999-9597 No 37 >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.51 E-value=4.9e-13 Score=104.29 Aligned_cols=74 Identities=20% Similarity=0.337 Sum_probs=61.8 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|.||++.+.+|..|+ ..++|+++|||.++||+..+..+.+.+.+. +..++++||+.+....+.+. T Consensus 81 LSgGqkqrv~iA~al~---------~~p~ililDEPtsgLD~~~~~~l~~~i~~l~~~g~tii~vtH~~~~~~~~~d~-- 149 (157) T cd00267 81 LSGGQRQRVALARALL---------LNPDLLLLDEPTSGLDPASRERLLELLRELAEEGRTVIIVTHDPELAELAADR-- 149 (157) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE-- T ss_conf 8869999999999997---------09999999698766899999999999999996899999990899999997999-- Q ss_pred EEEECCCE Q ss_conf 79972896 Q gi|254780766|r 364 FMRISNHQ 371 (375) Q Consensus 364 ~~~i~~g~ 371 (375) ++.+++|+ T Consensus 150 v~~~~~Gk 157 (157) T cd00267 150 VIVLKDGK 157 (157) T ss_pred EEEEECCC T ss_conf 99974888 No 38 >KOG0996 consensus Probab=99.51 E-value=1.2e-13 Score=108.38 Aligned_cols=110 Identities=20% Similarity=0.279 Sum_probs=77.3 Q ss_pred CCCEEEEEEEEECCCCHHHEEE--ECCCCEEEEECCCCCCHHHHHHHHHHHCCCC--CCCCCCHHHHHHCCCCC-----E Q ss_conf 8851899999922325455367--3279879998689986444899999972886--66678736887489832-----0 Q gi|254780766|r 2 TNRIKIKFLNISEFRNYASLRL--VFDAQHTIFVGDNGVGKTNILEAISFLSPGR--GFRRASYADVTRIGSPS-----F 72 (375) Q Consensus 2 ~~~M~i~~l~i~nFR~~~~~~i--~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gk--sfR~~~~~~li~~~~~~-----~ 72 (375) .+||.|..|.+.||++|....+ +|.+.++.|+|||||||||+++|+-|+.+-| -.|..+.++||..+... . T Consensus 81 ~~RL~I~~i~~~NFKSYaG~~ilGPFHksFtaIvGPNGSGKSNVIDsmLFVFGfRA~kiR~~klS~LIh~S~~~~~l~SC 160 (1293) T KOG0996 81 GPRLMITEIVVENFKSYAGKQILGPFHKSFTAIVGPNGSGKSNVIDSMLFVFGFRASKIRSKKLSALIHKSDGHPNLQSC 160 (1293) T ss_pred CCEEEEHHHHHHHHHHHCCCEEECCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCE T ss_conf 88066116665400641686421677877315678998870378899999965327677677899988344789987630 Q ss_pred EEEE--EEECC---CC----CCEEEEEEEECCCCCCCCCCCCCCCCCCC Q ss_conf 5898--88628---53----20026675300246633321125774333 Q gi|254780766|r 73 FSTF--ARVEG---ME----GLADISIKLETRDDRSVRCLQINDVVIRV 112 (375) Q Consensus 73 ~~~~--~~~~~---~~----~~~~~~~~~~~~~~~~~k~~~~n~~~~~~ 112 (375) .+.. ..+-. .. ...++.++++.-.+..+ .+++||+..+. T Consensus 161 sV~vhFq~iiD~~~~~~E~vp~s~~~ItRtA~~~NsS-kY~Ingk~as~ 208 (1293) T KOG0996 161 SVEVHFQKIIDKPGGTYEVVPDSEFTITRTAFRDNSS-KYYINGKEASF 208 (1293) T ss_pred EEEEEEEEEECCCCCCEEECCCCEEEEEEHHHHCCCC-EEEECCCCCCH T ss_conf 4887643323168986221379705897435407873-27677850429 No 39 >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Probab=99.49 E-value=3.6e-12 Score=98.64 Aligned_cols=79 Identities=20% Similarity=0.365 Sum_probs=66.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++++|+|||.++||+..+..+++.+.+. +.=|+++|||.+....+.+. T Consensus 137 ~~LSGGqkQRv~iAraL~---------~~p~lllLDEPtsgLD~~~~~~i~~li~~l~~~g~tvi~vtHdl~~~~~~aDr 207 (255) T PRK11231 137 TELSGGQRQRAFLAMVLA---------QDTPVVLLDEPTTYLDINHQVELMRLMRELNTQGKTVVTVLHDLNQASRYCDH 207 (255) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 529999999999999995---------39997998388644899999999999999986899999993788999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|++++ T Consensus 208 --iivl~~G~iv~ 218 (255) T PRK11231 208 --LVVMANGHVVA 218 (255) T ss_pred --EEEEECCEEEE T ss_conf --99998998999 No 40 >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component. The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.47 E-value=1.2e-11 Score=95.30 Aligned_cols=80 Identities=20% Similarity=0.271 Sum_probs=67.3 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCC Q ss_conf 3312205899999999999999999870899789980122015989999999997417--98099980696785432126 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~ 361 (375) ...+|.||++-+.++..|+ ..++++++|||.+.|||..+..+.+++.+. +.=|++|||+.+....+.+. T Consensus 128 ~~~LSgG~kqrv~ia~al~---------~~P~lliLDEPt~gLDp~~~~~~~~ll~~l~~~~tii~stH~l~e~e~~~dr 198 (211) T cd03264 128 IGSLSGGMRRRVGIAQALV---------GDPSILIVDEPTAGLDPEERIRFRNLLSELGEDRIVILSTHIVEDVESLCNQ 198 (211) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCE T ss_conf 4458988999999999982---------8999999948976789999999999999972998999989988999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+.+|++++ T Consensus 199 --i~il~~G~iv~ 209 (211) T cd03264 199 --VAVLNKGKLVF 209 (211) T ss_pred --EEEEECCEEEE T ss_conf --99998999998 No 41 >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids. The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. Probab=99.46 E-value=1.8e-11 Score=94.01 Aligned_cols=79 Identities=19% Similarity=0.279 Sum_probs=66.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++++|+|||.+.||+..+..+++.+.+. +.-++++||+.+....+.+. T Consensus 131 ~~LSgG~~Qrv~iAraL~---------~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~~g~tii~vtHdl~~~~~~~Dr 201 (222) T cd03224 131 GTLSGGEQQMLAIARALM---------SRPKLLLLDEPSEGLAPKIVEEIFEAIRELRDEGVTILLVEQNARFALEIADR 201 (222) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 448999999999999996---------49999999386547999999999999999995699999990858999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|++.| T Consensus 202 --v~vl~~G~iv~ 212 (222) T cd03224 202 --AYVLERGRVVL 212 (222) T ss_pred --EEEEECCEEEE T ss_conf --99997999999 No 42 >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium. Probab=99.45 E-value=1.4e-11 Score=94.75 Aligned_cols=80 Identities=24% Similarity=0.225 Sum_probs=66.6 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.|||+.+.+|..|+ ..++|+|+|||.+.|||..+..+.+.+.+. +.=|++|||+.+....+.+ T Consensus 131 ~~~LSgG~~qrv~iAraL~---------~~P~illlDEPt~GLDp~~~~~i~~~i~~l~~~g~tili~tH~l~~~~~~~d 201 (232) T cd03218 131 ASSLSGGERRRVEIARALA---------TNPKFLLLDEPFAGVDPIAVQDIQKIIKILKDRGIGVLITDHNVRETLSITD 201 (232) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 2559999999999999996---------6999999889856889999999999999999589999999283999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 202 r--v~vl~~G~ii~ 213 (232) T cd03218 202 R--AYIIYEGKVLA 213 (232) T ss_pred E--EEEEECCEEEE T ss_conf 9--99997998999 No 43 >PRK10895 putative ABC transporter ATP-binding protein YhbG; Provisional Probab=99.45 E-value=2.6e-11 Score=93.00 Aligned_cols=79 Identities=23% Similarity=0.202 Sum_probs=65.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCC Q ss_conf 31220589999999999999999987089978998012201598999999999741---798099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++++|+|||.+.|||..+..+.+.+.+ .+.-|+++||+.+....+.+. T Consensus 136 ~~LSgG~kqrv~iAraL~---------~~P~illLDEPt~gLD~~~~~~i~~~l~~l~~~g~tvl~~tHdl~~~~~~~dr 206 (241) T PRK10895 136 QSLSGGERRRVEIARALA---------ANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCER 206 (241) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 668988899999999996---------69988999587547999999999999999996499999990729999997999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+++| T Consensus 207 --v~vl~~G~iv~ 217 (241) T PRK10895 207 --AYIVSQGHLIA 217 (241) T ss_pred --EEEEECCEEEE T ss_conf --99998999999 No 44 >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity. In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.43 E-value=6.6e-12 Score=96.93 Aligned_cols=75 Identities=19% Similarity=0.305 Sum_probs=63.4 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|.||++.+.+|..|+ ..++++|+|||.+.||+..+..+.+.+.+. +.=|+++||+.+....+.+. T Consensus 96 LSgG~kqrv~ia~al~---------~~p~lllLDEPt~gLD~~~~~~i~~~i~~l~~~g~tvi~~tH~l~~~~~~~dr-- 164 (173) T cd03230 96 LSGGMKQRLALAQALL---------HDPELLILDEPTSGLDPESRREFWELLRELKKEGKTILLSSHILEEAERLCDR-- 164 (173) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE-- T ss_conf 3989999999999996---------49999999088657999999999999999996899999992838999986999-- Q ss_pred EEEECCCEE Q ss_conf 799728968 Q gi|254780766|r 364 FMRISNHQA 372 (375) Q Consensus 364 ~~~i~~g~~ 372 (375) ++-+++|+| T Consensus 165 i~vl~~G~i 173 (173) T cd03230 165 VAILNNGRI 173 (173) T ss_pred EEEEECCCC T ss_conf 999939999 No 45 >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions. Probab=99.42 E-value=7.7e-12 Score=96.48 Aligned_cols=74 Identities=22% Similarity=0.344 Sum_probs=64.9 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEEEEE Q ss_conf 22058999999999999999998708997899801220159899999999974179809998069678543212600799 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~~~~ 366 (375) +|.||++.+.+|..|+ ..++++++|||.++||+..+..+.+.|.+.+.-++++||+...+..+.+. ++. T Consensus 71 LSgGqkqr~~la~al~---------~~p~iliLDEPt~~LD~~~~~~i~~~l~~~~~tii~vsHd~~~~~~~~dr--ii~ 139 (144) T cd03221 71 LSGGEKMRLALAKLLL---------ENPNLLLLDEPTNHLDLESIEALEEALKEYPGTVILVSHDRYFLDQVATK--IIE 139 (144) T ss_pred CCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE--EEE T ss_conf 7999999999999972---------59989999577555899999999999997099999996798999987999--999 Q ss_pred ECCCE Q ss_conf 72896 Q gi|254780766|r 367 ISNHQ 371 (375) Q Consensus 367 i~~g~ 371 (375) +++|+ T Consensus 140 l~~G~ 144 (144) T cd03221 140 LEDGK 144 (144) T ss_pred EECCC T ss_conf 92989 No 46 >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Probab=99.42 E-value=3.7e-11 Score=92.03 Aligned_cols=79 Identities=22% Similarity=0.238 Sum_probs=67.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||..+.+|-.|+ .+++|+|+|||.+.|||..+..+++.+.+. +.=++++||+.+....+.+ T Consensus 151 ~~LSGGqkQRv~IArAL~---------~~P~iLllDEPta~LDp~~~~~i~~~l~~l~~~~g~Til~vtHdl~~a~~~~D 221 (262) T PRK09984 151 STLSGGQQQRVAIARALM---------QQAKVILADEPIASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCE 221 (262) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 348999999999999997---------19999998388677999999999999999998549799998889899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|++++ T Consensus 222 r--i~vl~~G~ii~ 233 (262) T PRK09984 222 R--IVALRQGHVFY 233 (262) T ss_pred E--EEEEECCEEEE T ss_conf 9--99996999999 No 47 >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=99.38 E-value=2.3e-11 Score=93.35 Aligned_cols=77 Identities=21% Similarity=0.318 Sum_probs=64.7 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|.|||..+.++..|+ ..+.++++|||.+.||+..+..+++.+.+. +.=++++||+.+....+.+. T Consensus 83 LSgG~~Qrv~iaral~---------~~p~llilDEPt~gLD~~~~~~i~~~l~~l~~~G~til~vtH~l~~~~~~~Dr-- 151 (163) T cd03216 83 LSVGERQMVEIARALA---------RNARLLILDEPTAALTPAEVERLFKVIRRLRAQGVAVIFISHRLDEVFEIADR-- 151 (163) T ss_pred CCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE-- T ss_conf 9989999999999997---------29999999097557999999999999999987898999993849999986999-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+.+|++++ T Consensus 152 v~vl~~G~iVa 162 (163) T cd03216 152 VTVLRDGRVVG 162 (163) T ss_pred EEEECCCEEEE T ss_conf 99990999983 No 48 >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport. These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2). No known transmembrane proteins or domains are associated with these proteins. Probab=99.34 E-value=2.4e-11 Score=93.29 Aligned_cols=66 Identities=26% Similarity=0.349 Sum_probs=50.8 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHH Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDS 357 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~ 357 (375) +|.||+....++..|+.+ ..+..+++|+|||.+.+|+.....+.+.+.+. +.++++|||..++..- T Consensus 78 lSgg~~~~~~l~~~l~~~-----~~~~~~lillDE~~~Gtd~~~~~~l~~~i~~~~~~~~~~i~tTH~~eL~~l 146 (162) T cd03227 78 LSGGEKELSALALILALA-----SLKPRPLYILDEIDRGLDPRDGQALAEAILEHLVKGAQVIVITHLPELAEL 146 (162) T ss_pred CCCCHHHHHHHHHHHHHC-----CCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHH T ss_conf 054299999999999854-----248984899636557999889999999999999769989997973999999 No 49 >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=99.32 E-value=1.3e-10 Score=88.57 Aligned_cols=77 Identities=13% Similarity=0.259 Sum_probs=62.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+.+|-.|+ ..++|+++|||.|+||+.....+++.|.+. +.=|++.||+.+.+.. .+ + T Consensus 139 ~LSgGqkQrv~lARal~---------~~p~ililDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~itH~l~~~~~-~D--r 206 (221) T cd03244 139 NLSVGQRQLLCLARALL---------RKSKILVLDEATASVDPETDALIQKTIREAFKDCTVLTIAHRLDTIID-SD--R 206 (221) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-CC--E T ss_conf 79999999999999996---------599999997975679999999999999987799899999158899983-99--8 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|+|.+ T Consensus 207 i~vl~~G~Iv~ 217 (221) T cd03244 207 ILVLDKGRVVE 217 (221) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 50 >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra Probab=99.32 E-value=3.9e-11 Score=91.90 Aligned_cols=74 Identities=22% Similarity=0.332 Sum_probs=58.5 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|.||+..+++|-.|+ ..++|+++|||.|.||+.....+++.|.+. +.=+++.||+...+.. .-+ T Consensus 97 LSGGQkQRvalARal~---------~~p~ililDEpts~LD~~~e~~i~~~l~~l~~~~~Tvi~vtH~~~~~~~---aD~ 164 (173) T cd03246 97 LSGGQRQRLGLARALY---------GNPRILVLDEPNSHLDVEGERALNQAIAALKAAGATRIVIAHRPETLAS---ADR 164 (173) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH---CCE T ss_conf 7699999999999982---------7999999968766899899999999999786489899998479999984---999 Q ss_pred EEEECCCEE Q ss_conf 799728968 Q gi|254780766|r 364 FMRISNHQA 372 (375) Q Consensus 364 ~~~i~~g~~ 372 (375) ++.+++|+| T Consensus 165 Iivl~~GkI 173 (173) T cd03246 165 ILVLEDGRV 173 (173) T ss_pred EEEEECCCC T ss_conf 999939999 No 51 >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis. The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism. Probab=99.32 E-value=4.5e-11 Score=91.45 Aligned_cols=76 Identities=21% Similarity=0.314 Sum_probs=60.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEE Q ss_conf 2205899999999999999999870899789980122015989999999997417--98099980696785432126007 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKF 364 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~ 364 (375) +|.||++.+.+|-.|+ ..+||+++|||.|+||+..+..+++.|.+. +.=+++.||+.+.+... -++ T Consensus 99 LSgGqkqRv~iAral~---------~~p~ililDEpts~LD~~t~~~i~~~l~~~~~~~Tvi~itH~~~~l~~~---D~I 166 (178) T cd03247 99 FSGGERQRLALARILL---------QDAPIVLLDEPTVGLDPITERQLLSLIFEVLKDKTLIWITHHLTGIEHM---DKI 166 (178) T ss_pred CCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHC---CEE T ss_conf 8999999999999996---------4979767228655699899999999999983999999980589899869---999 Q ss_pred EEECCCEEEE Q ss_conf 9972896895 Q gi|254780766|r 365 MRISNHQALC 374 (375) Q Consensus 365 ~~i~~g~~~~ 374 (375) +-+++|+|+. T Consensus 167 ivl~~G~Iv~ 176 (178) T cd03247 167 LFLENGKIIM 176 (178) T ss_pred EEEECCEEEE T ss_conf 9998999998 No 52 >KOG0964 consensus Probab=99.31 E-value=2.4e-11 Score=93.29 Aligned_cols=112 Identities=25% Similarity=0.365 Sum_probs=75.6 Q ss_pred EEEEEEEEECCCCHHHE-EEE-CCCCEEEEECCCCCCHHHHHHHHHHHCCCC--CCCCCCHHHHHHCCCCCEEEEEEEEC Q ss_conf 18999999223254553-673-279879998689986444899999972886--66678736887489832058988862 Q gi|254780766|r 5 IKIKFLNISEFRNYASL-RLV-FDAQHTIFVGDNGVGKTNILEAISFLSPGR--GFRRASYADVTRIGSPSFFSTFARVE 80 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~-~i~-f~~~~n~i~G~NG~GKT~iLEAI~~l~~gk--sfR~~~~~~li~~~~~~~~~~~~~~~ 80 (375) |+|+.+.|.|||+|++- -++ |+|..|||||.||+||||+.-||+|++.+- ..|...-.-|+..|+. ..++.+.++ T Consensus 1 MyIk~ViI~GFrSYrd~tvv~~fSph~NvIVGrNGSGKSNFF~AIrFVLSDey~hLk~E~R~gLlHEGsG-~~V~sA~VE 79 (1200) T KOG0964 1 MYIKQVIIKGFRSYRDETVVDPFSPHHNVIVGRNGSGKSNFFHAIRFVLSDEYSHLKREERQGLLHEGSG-AMVMSASVE 79 (1200) T ss_pred CCEEEEEECCCHHHCCCCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCCHHHCCHHHHHHHHHCCCC-CCEEEEEEE T ss_conf 9357766414211122535678898765586479887212578753301240422388987546625888-644788799 Q ss_pred CCC---------CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 853---------2002667530024663332112577433321012333 Q gi|254780766|r 81 GME---------GLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120 (375) Q Consensus 81 ~~~---------~~~~~~~~~~~~~~~~~k~~~~n~~~~~~~~~l~~~l 120 (375) -.. +..++++.+++...+ -.+++|++.+++. ++...+ T Consensus 80 IvF~nsdnr~~~~k~Ev~lrRtVGlKK--DeY~lD~k~Vtk~-evvnLL 125 (1200) T KOG0964 80 IVFDNSDNRLPRGKSEVSLRRTVGLKK--DEYFLDNKMVTKG-EVVNLL 125 (1200) T ss_pred EEEECCCCCCCCCCCEEEEEEEECCCC--HHHHCCCCCCCHH-HHHHHH T ss_conf 997176433688987378987632140--3432055666589-999999 No 53 >PRK10851 sulfate/thiosulfate transporter subunit; Provisional Probab=99.29 E-value=6.4e-10 Score=83.93 Aligned_cols=79 Identities=24% Similarity=0.196 Sum_probs=65.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+.+|--|+ ..+.+||+|||.|.||+..+..+.+.|.++ +.=+++.|||....-.+.+ T Consensus 135 ~~LSGGqrQRVaiARAL~---------~~P~vLLLDEPts~LD~~~r~~i~~~l~~L~~e~g~T~i~VTHD~~eA~~laD 205 (352) T PRK10851 135 AQLSGGQKQRVALARALA---------VEPQILLLDEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEAMEVAD 205 (352) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 149999999999999986---------59999999088766898999999999999999739989999889999998698 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 206 r--I~Vm~~G~I~q 217 (352) T PRK10851 206 R--VVVMSQGNIEQ 217 (352) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 54 >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export. They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.27 E-value=1.3e-10 Score=88.47 Aligned_cols=73 Identities=18% Similarity=0.365 Sum_probs=58.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEE Q ss_conf 2205899999999999999999870899789980122015989999999997417--98099980696785432126007 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKF 364 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~ 364 (375) +|.||+..+.+|-.|+ ..++|+|+|||.|+||+.....+++.+.+. +.=+++.||+.+.+.. .+ ++ T Consensus 97 LSgGq~Qri~lARal~---------~~p~illlDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~vtH~~~~~~~-~D--~v 164 (171) T cd03228 97 LSGGQRQRIAIARALL---------RDPPILILDEATSALDPETEALILEALRALAKGKTVIVIAHRLSTIRD-AD--RI 164 (171) T ss_pred CCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-CC--EE T ss_conf 4488999999999997---------489989995776679989999999999998099989999579999970-99--99 Q ss_pred EEECCCE Q ss_conf 9972896 Q gi|254780766|r 365 MRISNHQ 371 (375) Q Consensus 365 ~~i~~g~ 371 (375) +.+++|+ T Consensus 165 ~~l~~Gk 171 (171) T cd03228 165 IVLDDGR 171 (171) T ss_pred EEEECCC T ss_conf 9981969 No 55 >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Probab=99.27 E-value=2.8e-11 Score=92.78 Aligned_cols=79 Identities=24% Similarity=0.323 Sum_probs=66.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCC----EEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417980----9998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQ----IFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Q----v~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|-.||. .+-++++|||.|.||+..++.+++.+.++..| +++.||+-+.+..+.+ T Consensus 137 ~~LSGGqkqRvaIA~vLa~---------~P~iliLDEPta~LD~~~~~~l~~~l~~L~~~~~~tiii~tHd~~~~~~~ad 207 (235) T COG1122 137 FNLSGGQKQRVAIAGVLAM---------GPEILLLDEPTAGLDPKGRRELLELLKKLKEEGGKTIIIVTHDLELVLEYAD 207 (235) T ss_pred CCCCCCCEEEHHHHHHHHC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHCC T ss_conf 1069731665886688871---------8989997499889897899999999999886079769999474789885488 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++.+++|+++. T Consensus 208 ~--v~vl~~G~i~~ 219 (235) T COG1122 208 R--VVVLDDGKILA 219 (235) T ss_pred E--EEEEECCEEEE T ss_conf 9--99988995850 No 56 >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=99.26 E-value=2.3e-09 Score=80.36 Aligned_cols=79 Identities=22% Similarity=0.190 Sum_probs=64.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+++|-.|| .++.++|+|||+|.||+..+..+.+.|.+. +.=+++.|||....-.+.+ T Consensus 135 ~eLSGGq~QRVaiARAl~---------~~P~vlllDEP~s~LD~~~~~~i~~~l~~l~~e~~~T~i~vTHd~~~a~~laD 205 (239) T cd03296 135 AQLSGGQRQRVALARALA---------VEPKVLLLDEPFGALDAKVRKELRRWLRRLHDELHVTTVFVTHDQEEALEVAD 205 (239) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 669998989999999876---------49998997388664699999999999999999859989999889999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|+. T Consensus 206 r--i~vm~~G~iv~ 217 (239) T cd03296 206 R--VVVMNKGRIEQ 217 (239) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 57 >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1). NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate. Probab=99.23 E-value=7.7e-10 Score=83.41 Aligned_cols=77 Identities=16% Similarity=0.211 Sum_probs=61.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+++|-.|. ..++|+|+|||.|.||+.....+++.+.+. +.=+++.||+...+... + + T Consensus 125 ~LSgGqkQrl~iARal~---------~~p~ililDEpts~LD~~~~~~i~~~i~~~~~~~Tvi~itH~l~~~~~~-D--~ 192 (207) T cd03369 125 NLSQGQRQLLCLARALL---------KRPRVLVLDEATASIDYATDALIQKTIREEFTNSTILTIAHRLRTIIDY-D--K 192 (207) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHC-C--E T ss_conf 86989999999999997---------0899999816344489899999999999975999999990799999859-9--9 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|+|.. T Consensus 193 Iivl~~G~Ive 203 (207) T cd03369 193 ILVMDAGEVKE 203 (207) T ss_pred EEEEECCEEEE T ss_conf 99998999998 No 58 >pfam02463 SMC_N RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination. Probab=99.21 E-value=5.7e-09 Score=77.75 Aligned_cols=91 Identities=20% Similarity=0.310 Sum_probs=70.6 Q ss_pred CCCCCCC-HHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECC Q ss_conf 0124551-023312205899999999999999999870899789980122015989999999997417--9809998069 Q gi|254780766|r 275 VDYCDKA-ITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTD 351 (375) Q Consensus 275 ~~~~~~~-~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~ 351 (375) +...|+. ...+.+|.||+-+.+|||.||-.. ....|+.++|||.|-||+.+...+..+|.+. +.|+||+|+. T Consensus 1066 ~~ppgK~~~~l~~LSGGEKtL~ALaLlFAi~~-----~~PaPFyiLDEIDAaLD~~Nv~~ia~~ik~~s~~sQFIvIS~r 1140 (1162) T pfam02463 1066 ARPPGKGVKNLDNLSGGEKTLVALALIFAIQK-----YRPAPFYLLDEIDAALDDQNVSRVANYLKELSKNAQFIVISLR 1140 (1162) T ss_pred EECCCCCCCCHHHHCHHHHHHHHHHHHHHHHH-----CCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEC T ss_conf 98948968896884878899999999999986-----2898378754866366699999999999974999989998607 Q ss_pred HHHHHHHHCCEEEEEECCC Q ss_conf 6785432126007997289 Q gi|254780766|r 352 KSVFDSLNETAKFMRISNH 370 (375) Q Consensus 352 ~~~~~~~~~~~~~~~i~~g 370 (375) +..++.-....-++-.++| T Consensus 1141 ~~~~~~Ad~L~GVtm~e~G 1159 (1162) T pfam02463 1141 EEMLEKADRLVGVYMVENG 1159 (1162) T ss_pred HHHHHHHHHEEEEEECCCC T ss_conf 8999872375887878999 No 59 >COG4938 Uncharacterized conserved protein [Function unknown] Probab=99.17 E-value=9.8e-11 Score=89.28 Aligned_cols=46 Identities=24% Similarity=0.595 Sum_probs=41.9 Q ss_pred EEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCC Q ss_conf 99999922325455367327987999868998644489999997288 Q gi|254780766|r 7 IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPG 53 (375) Q Consensus 7 i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~g 53 (375) |.+++|.||+|+++..|.+.+ +|||.|+|.+|||+.+.|+++...| T Consensus 2 i~sl~l~nfk~y~n~~i~l~~-ltVF~G~NssGKSt~iqsl~li~s~ 47 (374) T COG4938 2 ILSLSLKNFKPYINGKIILKP-LTVFIGPNSSGKSTTIQSLYLIYSG 47 (374) T ss_pred CCEEEECCCCCEECCEEEEEC-CEEEECCCCCCHHHHHHHHHHHHHH T ss_conf 533663475331245699852-3699767877604899999999976 No 60 >TIGR00606 rad50 rad50; InterPro: IPR004584 Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining. It is a component of an exonuclease complex with MRE11 homologs. The Saccharomyces cerevisiae Rad50/MRE11 complex possesses single-stranded endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides an ATP-dependent control of MRE11 by unwinding and repositioning DNA ends into the MRE11 active site. This family is distantly related to the SbcC family of bacterial proteins. When the N- and C-terminal globular regions of Rad50 from Pyrococcus furiosus P58301 from SWISSPROT are co-expressed in Escherichia coli, they spontaneously associate to form a stable complex that possesses ATP-binding and weak ATP-hydrolysing activities. The structure formed is known as the Rad50 catalytic domain (Rad50cd1). In the presence of ATP, two Rad50cd1 molecules interact via their ATP-binding and highly conserved 'signature' motifs to form a dimer. As ATP is buried deep within this dimer interface, the two Rad50cd1 molecules may have to completely disengage after ATP hydrolysis to allow the release of ADP before binding of a new ATP molecule. ATP binding is also accompanied by a 30° rotation of two distinct domains within each Rad50cd1 part of the dimer. This rotation and dimerisation creates a positively charged surface which, potentially, could provide a DNA-binding site capable of accommodating two DNA molecules. The Mre11-docking site within Rad50 has been mapped to two 40-residue heptad-repeat sequences that lie adjacent to the N- and C-terminal ATPase segments. A distinct region within this domain forms a conserved hydrophobic patch that is believed to be the actual Mre11-binding site and lies immediately adjacent to the putative DNA-binding site of Rad50. As Rad50 dimerises in the presence of ATP and forms a stoichiometric complex with Mre11 (one Mre11 subunit binding to one Rad50 subunit), it is possible that the MR complex forms a closely coordinated DNA-binding unit that has the potential to act on two DNA molecules simultaneously. Within this unit, ATP-dependent control of nuclease action might be achieved via Rad50 unwinding or repositioning DNA ends into the active-site of Mre11 . ; GO: 0005524 ATP binding, 0006281 DNA repair, 0030870 Mre11 complex. Probab=99.17 E-value=1.6e-10 Score=87.83 Aligned_cols=157 Identities=20% Similarity=0.227 Sum_probs=84.1 Q ss_pred EEEEEEEECCCCHH--HE---EEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHCCC------CCEEE Q ss_conf 89999992232545--53---673279879998689986444899999972886666787368874898------32058 Q gi|254780766|r 6 KIKFLNISEFRNYA--SL---RLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS------PSFFS 74 (375) Q Consensus 6 ~i~~l~i~nFR~~~--~~---~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li~~~~------~~~~~ 74 (375) ++.+++|.+.|+|. +. .|+|-++.|+|+||||+||||++||+.|+++|.-.-+.+-..||.... -.+.+ T Consensus 2 ~~~~l~I~GvRS~G~ED~D~~~I~F~SP~T~l~GPNG~GKTT~IE~L~y~~TG~~P~~~K~NtFvH~~~VA~~T~V~A~~ 81 (1328) T TIGR00606 2 KFLKLSILGVRSVGIEDKDKQIIDFLSPLTLLVGPNGAGKTTIIEALKYVTTGDFPPGKKGNTFVHDPKVARETDVRAQV 81 (1328) T ss_pred CCCCEEEEEEEECCCCCCCCCEEEEECCCCEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHCCCCEEEE T ss_conf 43201443322026454444233211660101277887525898754332048898888886000372221105320588 Q ss_pred E--EEEECCCCCCEEEEEEEECCCCCC--------CCCCCCCCCCCCCCC-------CCC-------CCCCCCEEECCHH Q ss_conf 9--888628532002667530024663--------332112577433321-------012-------3334520210011 Q gi|254780766|r 75 T--FARVEGMEGLADISIKLETRDDRS--------VRCLQINDVVIRVVD-------ELN-------KHLRISWLVPSMD 130 (375) Q Consensus 75 ~--~~~~~~~~~~~~~~~~~~~~~~~~--------~k~~~~n~~~~~~~~-------~l~-------~~l~~v~~~p~~~ 130 (375) . +..+.|......-.+-++ ..++. .-.-.-+|.+++-.+ ++. ..|+-|.|+.+.+ T Consensus 82 ~L~F~DV~G~~~~~~R~lv~t-~~~K~~~~~~~~~~~~~~~~G~~~~LSSK~~~~~~~l~~~LGV~~aVl~~VIFCHQED 160 (1328) T TIGR00606 82 RLEFRDVKGEEVAVVRSLVVT-QKTKKAELKELEGVIIRYKDGEKVSLSSKVAEIDRELLKHLGVSKAVLKYVIFCHQED 160 (1328) T ss_pred EEEEEEECCCEEEEEEEEEEE-CCCHHHHHHHHCCEEEECCCCCEEEHHHHHHHHHHHHHHHCCCCHHHHCCCEEEEECC T ss_conf 998886176078877644550-5506777662262367637885530155677887999975486345651530321047 Q ss_pred --HCCCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHHH Q ss_conf --001268723412101000135846778887777666 Q gi|254780766|r 131 --RIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLM 166 (375) Q Consensus 131 --~li~~~p~~RR~flD~~i~~~~~~y~~~l~~y~K~L 166 (375) =-+++|-+.+.+| | -||++ ..|.+++...+++. T Consensus 161 S~WPLSE~K~LK~~F-D-~IF~~-T~y~KA~e~l~~v~ 195 (1328) T TIGR00606 161 SNWPLSEGKALKKKF-D-EIFSL-TRYVKALERLRKVR 195 (1328) T ss_pred CCCCCCCCHHHHHHH-H-HHHHH-HHHHHHHHHHHHHH T ss_conf 898988756777777-7-89988-88999999999999 No 61 >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=99.13 E-value=5.3e-09 Score=77.95 Aligned_cols=78 Identities=21% Similarity=0.300 Sum_probs=60.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+-.+++|-.|. ..+||+++||+.|.||+..-..+.+.|.+. +.=+++-+|....+. +-- T Consensus 475 ~~LSgGQrQRiaiARall---------~~p~iliLDEaTSaLD~~tE~~i~~~l~~~~~~~T~i~IaHRlsti~---~aD 542 (593) T PRK10790 475 NTLSVGQKQLLALARVLV---------ETPQILILDEATASIDSGTEQAIQQALAAIREHTTLVVIAHRLSTIV---EAD 542 (593) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHH---HCC T ss_conf 887999999999999995---------59899998387778899999999999999728998999707898999---699 Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++-+++|+|.. T Consensus 543 ~I~vl~~G~ive 554 (593) T PRK10790 543 TILVLHRGQAVE 554 (593) T ss_pred EEEEEECCEEEE T ss_conf 999998999999 No 62 >KOG0964 consensus Probab=99.13 E-value=2.1e-09 Score=80.61 Aligned_cols=199 Identities=17% Similarity=0.151 Sum_probs=109.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC Q ss_conf 46778887777666667988630565432100245653279999999999999999999999985316430112201566 Q gi|254780766|r 153 PRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFL 232 (375) Q Consensus 153 ~~y~~~l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~~~~~l~~~~ 232 (375) .-..+++..|.....||-.+.++...-...-+.+.+-++.+...=..+=...+......|.+.+.++-..... .+.... T Consensus 970 ~VNKkAldQf~nfseQre~L~~R~eELd~s~~sI~eLi~vLdqrK~eai~~TFkqV~knFsevF~~LVp~G~a-~iim~k 1048 (1200) T KOG0964 970 NVNKKALDQFVNFSEQRESLKKRQEELDRSKDSILELITVLDQRKYEAIDLTFKQVKKNFSEVFSRLVPGGTA-LIIMRK 1048 (1200) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCE-EEHHHC T ss_conf 3219999999878898999999999860136689999999987468899999999987799999986789721-201220 Q ss_pred CCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCC---HHHHHCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 6765589678888765455311100000000025732001100124551---0233122058999999999999999998 Q gi|254780766|r 233 DGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKA---ITIAHGSTGEQKVVLVGIFLAHARLISN 309 (375) Q Consensus 233 ~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~---~~~~~~S~Gqqk~~~l~l~La~~~~~~~ 309 (375) ....... .+.+-.-.-.....++..-.||.+| +.+.++++. ....++|.||+...+|||++| -+ T Consensus 1049 ~d~~~d~---~e~d~~~~~~s~~~~~sv~~ytGIs-----I~VSFnskq~E~~~m~QLSGGQKsvvALaLIFa-----IQ 1115 (1200) T KOG0964 1049 RDNANDH---DEDDGDMDGESNEGKDSVEMYTGIS-----IKVSFNSKQGETLEMEQLSGGQKSVVALALIFA-----IQ 1115 (1200) T ss_pred CCCCCCC---CCCCCCCCCCCCCCCCCHHHCCCEE-----EEEEEECCCCHHHHHHHHCCCHHHHHHHHHHHH-----HH T ss_conf 1333542---0003455664545665134214426-----999851475378888883474287999999999-----98 Q ss_pred HCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEEEEEC Q ss_conf 70899789980122015989999999997417--980999806967854321260079972 Q gi|254780766|r 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKFMRIS 368 (375) Q Consensus 310 ~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~~~i~ 368 (375) .+...|..|+|||.|.||++.+..+..++.++ ..|+|+||-.+.++..-. +||.|. T Consensus 1116 rcDPAPFYlfDEIDAaLDaQyR~aVa~lIkelS~~aQFI~TTFRpEll~vAd---KfygV~ 1173 (1200) T KOG0964 1116 RCDPAPFYLFDEIDAALDAQYRTAVADLIKELSDSAQFITTTFRPELLSVAD---KFYGVK 1173 (1200) T ss_pred HCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHH---HHHCEE T ss_conf 2687401447677663068889999999999752561674316489998777---652013 No 63 >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Probab=99.12 E-value=1.6e-08 Score=74.89 Aligned_cols=93 Identities=17% Similarity=0.285 Sum_probs=72.4 Q ss_pred EECCCCCCCHH-HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEE Q ss_conf 10012455102-3312205899999999999999999870899789980122015989999999997417--98099980 Q gi|254780766|r 273 LIVDYCDKAIT-IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTG 349 (375) Q Consensus 273 ~~~~~~~~~~~-~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt 349 (375) |.....|+... .+.+|.||+-+.+|||.+|- ...+..|+.++|||.+.||..|...+..++.+. +.|+||.| T Consensus 1052 i~a~ppgK~~~~l~~LSGGEKsLtAlAllFAi-----~~~~PaPf~vLDEVDAaLD~~Nv~r~~~~i~e~s~~sQFIvIT 1126 (1163) T COG1196 1052 ISARPPGKKLQSLSLLSGGEKSLTALALLFAI-----QKYRPAPFYVLDEVDAALDDANVERVARLIKEMSKETQFIVIT 1126 (1163) T ss_pred EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHH-----HHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEE T ss_conf 99738998656212148618999999999999-----7137998688624543566899999999999817898289997 Q ss_pred CCHHHHHHHHCCEEEEEECCC Q ss_conf 696785432126007997289 Q gi|254780766|r 350 TDKSVFDSLNETAKFMRISNH 370 (375) Q Consensus 350 ~~~~~~~~~~~~~~~~~i~~g 370 (375) |.+..+..-....-++-.++| T Consensus 1127 hr~~~m~~ad~l~GVtm~~~G 1147 (1163) T COG1196 1127 HRKGTMEAADRLVGVTMQEKG 1147 (1163) T ss_pred CCHHHHHHHHHEEEEEEECCC T ss_conf 774888877770148996499 No 64 >COG3910 Predicted ATPase [General function prediction only] Probab=99.11 E-value=2e-09 Score=80.66 Aligned_cols=65 Identities=25% Similarity=0.338 Sum_probs=49.5 Q ss_pred HHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCCEEEEEECCCEE Q ss_conf 99987089978998012201598999999999741---79809998069678543212600799728968 Q gi|254780766|r 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNETAKFMRISNHQA 372 (375) Q Consensus 306 ~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~~~~~~i~~g~~ 372 (375) ++.+..+..-|.++|||+|-|.|.+|-.++..|.+ .+.|+||.||++-++. +. .+.+|.+..+-+ T Consensus 139 i~~~rf~~~GiYiLDEPEa~LSp~RQlella~l~~la~sGaQ~IiATHSPiLlA-iP-~A~I~~~~~~g~ 206 (233) T COG3910 139 IFHNRFNGQGIYILDEPEAALSPSRQLELLAILRDLADSGAQIIIATHSPILLA-IP-GAEIYEISESGI 206 (233) T ss_pred HHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHEE-CC-CCEEEEEECCCC T ss_conf 999983158418856864447888899999999998736783999836814200-78-847999806875 No 65 >KOG0962 consensus Probab=99.08 E-value=4.9e-10 Score=84.73 Aligned_cols=60 Identities=27% Similarity=0.421 Sum_probs=48.0 Q ss_pred EEEEEEEECCCCHHHE---EEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHH Q ss_conf 8999999223254553---67327987999868998644489999997288666678736887 Q gi|254780766|r 6 KIKFLNISEFRNYASL---RLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65 (375) Q Consensus 6 ~i~~l~i~nFR~~~~~---~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~li 65 (375) .|.++.|.+.|+|.+- .|+|..++|+|+|+||+|||||+|++-++++|-..-++.-..+| T Consensus 3 ~i~klsI~GIRSf~~~d~~~i~F~sPlTLIvG~NG~GKTTiIEcLKyatTG~lPpnsk~~~Fi 65 (1294) T KOG0962 3 SIDKLSIRGIRSFDDKDRNTIEFFSPLTLIVGANGTGKTTIIECLKYATTGELPPNSKGGSFI 65 (1294) T ss_pred HHHHHHHHCCCCCCCCCCCEEEECCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCC T ss_conf 067567621014687665536511770567668887716699998888648489987677777 No 66 >TIGR00618 sbcc exonuclease SbcC; InterPro: IPR004592 All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. SbcC may have nuclease activity that is functionally related to one of the nuclease activities of the RecBCD enzyme (IPR004586 from INTERPRO).; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process. Probab=99.06 E-value=2.4e-10 Score=86.78 Aligned_cols=59 Identities=29% Similarity=0.456 Sum_probs=50.0 Q ss_pred EEEEEEEEECCCCHHH-EEEECCC------CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCHHH Q ss_conf 1899999922325455-3673279------879998689986444899999972886666787368 Q gi|254780766|r 5 IKIKFLNISEFRNYAS-LRLVFDA------QHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63 (375) Q Consensus 5 M~i~~l~i~nFR~~~~-~~i~f~~------~~n~i~G~NG~GKT~iLEAI~~l~~gksfR~~~~~~ 63 (375) |++-+|.++||-+|.. ..++|.+ ++-+|.|+||||||||||||.|+.+||..++..... T Consensus 1 m~pl~L~lkn~~~y~~~~~~dfT~~~fasl~~f~i~G~tGAGKtsLldAI~yALYGkP~~~~s~~~ 66 (1063) T TIGR00618 1 MKPLKLELKNFTSYKGESVIDFTALGFASLKLFVICGKTGAGKTSLLDAITYALYGKPVPRESEVV 66 (1063) T ss_pred CCCCEEEECCCCCCCCCCEEECCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCHHHH T ss_conf 965347640635345761010278872125736777889983545999999987288877514678 No 67 >PRK03918 chromosome segregation protein; Provisional Probab=99.06 E-value=6.2e-08 Score=70.99 Aligned_cols=84 Identities=26% Similarity=0.268 Sum_probs=66.7 Q ss_pred EEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHCCCCC-CCCCCHHHHHHCCCCCEEEEEEEECCCC Q ss_conf 189999992232545536732798799986899864448999999728866-6678736887489832058988862853 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRG-FRRASYADVTRIGSPSFFSTFARVEGME 83 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~gks-fR~~~~~~li~~~~~~~~~~~~~~~~~~ 83 (375) |+|++|.|.||+||.+.+|+|++|+|+|+||||||||||+|||.|+++|.+ .++....++++.|+....+ ...+.... T Consensus 1 M~i~kl~L~nF~s~~~~~i~F~~Gi~~I~G~nGsGKStIlDAI~~aL~g~~~~~~~~~~~~~~~~~~~~~V-~l~F~~~~ 79 (882) T PRK03918 1 MKIEELIIKNFRSHSDTKVEFKSGINLIIGQNGSGKSSLLDAILVGLYWPLKPKDLKKDDFTRIGGSGTEI-ELTFEKDG 79 (882) T ss_pred CEEEEEEEECCCCCCCCEEECCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHCCCCCEEE-EEEEEECC T ss_conf 97759999660377778560799927988999998899999999998189888877678887279996599-99999899 Q ss_pred CCEEEE Q ss_conf 200266 Q gi|254780766|r 84 GLADIS 89 (375) Q Consensus 84 ~~~~~~ 89 (375) ..+.+. T Consensus 80 ~~y~i~ 85 (882) T PRK03918 80 TKYQIH 85 (882) T ss_pred EEEEEE T ss_conf 899999 No 68 >PRK02224 chromosome segregation protein; Provisional Probab=99.00 E-value=1e-07 Score=69.59 Aligned_cols=88 Identities=22% Similarity=0.347 Sum_probs=69.4 Q ss_pred CCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCC---CCEEEEECCHHCCCHHHHHHHHHHHHHC---C-CCEEEEEC Q ss_conf 455102331220589999999999999999987089---9789980122015989999999997417---9-80999806 Q gi|254780766|r 278 CDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGF---APILLLDEISAHLDEDKRNALFRIVTDI---G-SQIFMTGT 350 (375) Q Consensus 278 ~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~---~pilLiDdi~s~LD~~~~~~ll~~l~~~---~-~Qv~iTt~ 350 (375) +|...+...+|.||+=+++||+.||-++++....+. .|.++||||+++||+.++..+++.|... + .|+||-|| T Consensus 773 ~g~~~~~~~LSGGE~~~~aLaLrlAl~~~l~~~~~g~~~~~~lilDE~~~~LD~~~~~~l~~~l~~l~~~~~~qiiiITH 852 (880) T PRK02224 773 DGTPLEPKQLSGGERALFNLSLRCAIYRLLAEGIGGDAPLPPLILDEPTVFLDSGHVSQLVKLIEMMRRIGVEQIIVVSH 852 (880) T ss_pred CCEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC T ss_conf 98053688888789999999999999999987337888898078859998879889999999999987289998999955 Q ss_pred CHHHHHHHHCCEEEEEEC Q ss_conf 967854321260079972 Q gi|254780766|r 351 DKSVFDSLNETAKFMRIS 368 (375) Q Consensus 351 ~~~~~~~~~~~~~~~~i~ 368 (375) +...-+... . ++.|+ T Consensus 853 ~~el~~~~d-~--~i~V~ 867 (880) T PRK02224 853 DDELIAAAD-H--VVQVE 867 (880) T ss_pred HHHHHHHCC-E--EEEEE T ss_conf 488998689-6--89999 No 69 >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Probab=98.99 E-value=7e-08 Score=70.65 Aligned_cols=77 Identities=14% Similarity=0.253 Sum_probs=63.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||+.-+.+|.-|+ ....+|++|||.+.||...+..+++.|.++ +.=+++.|||......+.+. T Consensus 153 eLSGGq~QRV~IArAL~---------~~P~lLIaDEPTsaLD~~~q~~Il~ll~~l~~~~g~til~ITHDl~~v~~~aDr 223 (327) T PRK11022 153 QLSGGMSQRVMIAMAIA---------CRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALVLITHDLALVAEAAHK 223 (327) T ss_pred HCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHCCE T ss_conf 46999999999999997---------099999983887657999999999999999997199489992889999986998 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +.-+..|+|. T Consensus 224 --i~VMy~G~iV 233 (327) T PRK11022 224 --IIVMYAGQVV 233 (327) T ss_pred --EEEEECCEEE T ss_conf --9999898899 No 70 >TIGR02168 SMC_prok_B chromosome segregation protein SMC; InterPro: IPR011890 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . The smc gene is often associated with scpB (IPR005234 from INTERPRO) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle , , .; GO: 0005515 protein binding, 0005524 ATP binding, 0005694 chromosome. Probab=98.99 E-value=4.3e-08 Score=72.05 Aligned_cols=164 Identities=16% Similarity=0.227 Sum_probs=109.0 Q ss_pred HHHHHHHHHHHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-EEEEECCC Q ss_conf 677888777766666798863056543-2100245653279999999999999999999999985316430-11220156 Q gi|254780766|r 154 RHRRRMIDFERLMRGRNRLLTEGYFDS-SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPH-IKLSLTGF 231 (375) Q Consensus 154 ~y~~~l~~y~K~LkqRN~lLk~~~~d~-~~l~~~~~qla~~~~~I~~~R~~~l~~l~~~l~~~~~~~~~~~-~~~~l~~~ 231 (375) -.+.++..|+ -+++|-..|.....|- .-...+..-+.++...+...-.+.++.++..|...+..+++.. -.+.+.. T Consensus 999 VNL~AieEy~-~~~eR~~fL~~Q~~DL~~A~~~L~~~I~~iD~e~~~rF~~tF~~vn~~F~~~F~~LFgGG~A~L~LTd- 1076 (1191) T TIGR02168 999 VNLAAIEEYE-ELKERYDFLSAQKEDLTEAKETLEEAIEEIDKETRERFKDTFDQVNENFQRVFPKLFGGGEAELRLTD- 1076 (1191) T ss_pred CCHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEC- T ss_conf 5855899999-99999999999999999999999999999989999999999999998886685864899878988656- Q ss_pred CCCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCC-CHHHHHCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 6676558967888876545531110000000002573200110012455-102331220589999999999999999987 Q gi|254780766|r 232 LDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDK-AITIAHGSTGEQKVVLVGIFLAHARLISNT 310 (375) Q Consensus 232 ~~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~-~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~ 310 (375) ++..++- |. +|....-|| ....+++|-||+=+.++||.+|-+.+ T Consensus 1077 ~~d~Lea----------------------------Gi---eI~A~PPGKk~~~l~LLSGGEKALTA~ALlFAIf~~---- 1121 (1191) T TIGR02168 1077 PEDLLEA----------------------------GI---EIMAQPPGKKNQNLSLLSGGEKALTALALLFAIFKV---- 1121 (1191) T ss_pred CCCCCCC----------------------------CC---EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC---- T ss_conf 8774337----------------------------75---678527639876643020157999999999999600---- Q ss_pred CCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHH Q ss_conf 0899789980122015989999999997417--98099980696785 Q gi|254780766|r 311 TGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVF 355 (375) Q Consensus 311 ~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~ 355 (375) +..|..+||||+|=||+.|..++.++|.++ ..|+||=||++-.- T Consensus 1122 -~P~PFC~LDEVDAPLDdaNV~RF~~ll~~~~~~tQFI~iTHnk~TM 1167 (1191) T TIGR02168 1122 -KPAPFCILDEVDAPLDDANVERFANLLKEMSKKTQFIVITHNKGTM 1167 (1191) T ss_pred -CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHH T ss_conf -7887263212336798266999999999985189278886784899 No 71 >KOG0927 consensus Probab=98.90 E-value=1.8e-07 Score=67.93 Aligned_cols=85 Identities=20% Similarity=0.298 Sum_probs=68.5 Q ss_pred CCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHH Q ss_conf 45510233122058999999999999999998708997899801220159899999999974179809998069678543 Q gi|254780766|r 278 CDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357 (375) Q Consensus 278 ~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~ 357 (375) ..+..+.+++|.|||+.++++..+- ..+.|||+|||+.|||..-...+-++|.+...-|++++||..+++. T Consensus 501 d~q~~p~~~LS~Gqr~rVlFa~l~~---------kqP~lLlLDEPtnhLDi~tid~laeaiNe~~Ggvv~vSHDfrlI~q 571 (614) T KOG0927 501 DAQVVPMSQLSDGQRRRVLFARLAV---------KQPHLLLLDEPTNHLDIETIDALAEAINEFPGGVVLVSHDFRLISQ 571 (614) T ss_pred CCCCCCHHHCCCCCCHHHHHHHHHH---------CCCCEEEECCCCCCCCCHHHHHHHHHHHCCCCCEEEEECHHHHHHH T ss_conf 2101336442610001478999884---------3884798548876788506999999985267851553212348998 Q ss_pred HHCCEEEEEECCCEEE Q ss_conf 2126007997289689 Q gi|254780766|r 358 LNETAKFMRISNHQAL 373 (375) Q Consensus 358 ~~~~~~~~~i~~g~~~ 373 (375) +.+. +|.+++|.+. T Consensus 572 VaeE--i~~c~~~~~~ 585 (614) T KOG0927 572 VAEE--IWVCENGTVT 585 (614) T ss_pred HHHH--HHHHCCCCEE T ss_conf 8777--6701058366 No 72 >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein. Probab=98.87 E-value=1.7e-08 Score=74.60 Aligned_cols=81 Identities=22% Similarity=0.268 Sum_probs=68.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++-+.++.-|+ ..++++++|||.+.||+..++.+.+.+.+. +.=|++|||+.+....+.+ T Consensus 134 ~~~LS~G~kqrv~la~al~---------~~P~lliLDEPt~gLD~~~~~~i~~~l~~l~~~g~til~~sH~l~e~~~l~d 204 (218) T cd03266 134 VGGFSTGMRQKVAIARALV---------HDPPVLLLDEPTTGLDVMATRALREFIRQLRALGKCILFSTHIMQEVERLCD 204 (218) T ss_pred HHHCCCHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 3227826889999999986---------6998999979876769999999999999998579999998987899999699 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) . ++-+++|+++|. T Consensus 205 r--i~vl~~G~iv~~ 217 (218) T cd03266 205 R--VVVLHRGRVVYE 217 (218) T ss_pred E--EEEEECCEEEEE T ss_conf 9--999989999987 No 73 >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.86 E-value=1.9e-08 Score=74.40 Aligned_cols=79 Identities=22% Similarity=0.255 Sum_probs=66.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC---CCEEEEECCHHHHHHHHCC Q ss_conf 3122058999999999999999998708997899801220159899999999974179---8099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG---SQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~---~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+++|-.|| ..++++++|||.|.||+..+..+++.+.+.+ .-|+++||+.+....+.+. T Consensus 137 ~~LSGGqkqRvaiA~aL~---------~~P~lliLDEPtagLDp~~~~~l~~~l~~L~~~G~Tvi~vtHdl~~~~~~aDr 207 (273) T PRK13647 137 YHLSYGQKKRVAIAGVLA---------MEPDIIVLDEPMAYLDPRGKEELTAILNRLNNEGKTVIVATHDVDLALEWADQ 207 (273) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 339998999999999998---------19999999797657999999999999999984899999994178999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 208 --vivl~~G~Iv~ 218 (273) T PRK13647 208 --VVVLNAGRVVA 218 (273) T ss_pred --EEEEECCEEEE T ss_conf --99998999999 No 74 >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Probab=98.85 E-value=6.8e-08 Score=70.73 Aligned_cols=79 Identities=18% Similarity=0.213 Sum_probs=58.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||--++++-.|. .++.++|+|||.|.||...+..+...+.+. +.=+++.|||..-.-.+.+ T Consensus 132 ~~LSGGQrQRVAlaRAlV---------r~P~v~L~DEPlSnLDaklR~~mr~eik~l~~~l~~T~IYVTHDq~EAmtlad 202 (338) T COG3839 132 LQLSGGQRQRVALARALV---------RKPKVFLLDEPLSNLDAKLRVLMRSEIKKLHERLGTTTIYVTHDQVEAMTLAD 202 (338) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCC T ss_conf 117725678999987775---------47887884476467659999999999999998609848998089999984088 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.- T Consensus 203 r--i~Vm~~G~i~Q 214 (338) T COG3839 203 R--IVVMNDGRIQQ 214 (338) T ss_pred E--EEEEECCEEEE T ss_conf 7--99996790432 No 75 >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Probab=98.85 E-value=3.2e-08 Score=72.86 Aligned_cols=80 Identities=26% Similarity=0.427 Sum_probs=68.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||++.+.+|..|+ ..++++++|||.+.||+..++.+.+.|.+. +.-|++|||+.+....+.+. T Consensus 132 ~~LSgG~kqrv~ia~al~---------~~P~lliLDEPt~gLD~~~~~~i~~~l~~~~~~~tii~~tH~l~e~~~l~dr- 201 (220) T cd03263 132 RTLSGGMKRKLSLAIALI---------GGPSVLLLDEPTSGLDPASRRAIWDLILEVRKGRSIILTTHSMDEAEALCDR- 201 (220) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 678999999999999995---------6999999958876889999999999999984899899996878999996999- Q ss_pred EEEEECCCEEEEC Q ss_conf 0799728968959 Q gi|254780766|r 363 KFMRISNHQALCI 375 (375) Q Consensus 363 ~~~~i~~g~~~~~ 375 (375) ++-+.+|+++|. T Consensus 202 -i~vl~~G~i~~~ 213 (220) T cd03263 202 -IAIMSDGKLRCI 213 (220) T ss_pred -EEEEECCEEEEE T ss_conf -999989999998 No 76 >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein. Probab=98.84 E-value=2.3e-08 Score=73.79 Aligned_cols=80 Identities=19% Similarity=0.252 Sum_probs=67.8 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) ...+|.||++.+.+|..|+ ..++++|+|||.+.||+..+..+.+.|.+. +.=|++|||+-+....+. T Consensus 151 ~~~LSgG~rqrv~ia~aL~---------~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~~~g~till~tH~l~ev~~~~ 221 (236) T cd03267 151 VRQLSLGQRMRAEIAAALL---------HEPEILFLDEPTIGLDVVAQENIRNFLKEYNRERGTTVLLTSHYMKDIEALA 221 (236) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHC T ss_conf 4569999999999999996---------7999999979876889999999999999999738989999888789999979 Q ss_pred CCEEEEEECCCEEEE Q ss_conf 260079972896895 Q gi|254780766|r 360 ETAKFMRISNHQALC 374 (375) Q Consensus 360 ~~~~~~~i~~g~~~~ 374 (375) +. ++-+.+|++++ T Consensus 222 Dr--v~vl~~Gkii~ 234 (236) T cd03267 222 RR--VLVIDKGRLLY 234 (236) T ss_pred CE--EEEEECCEEEE T ss_conf 99--99998998998 No 77 >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Probab=98.84 E-value=2.1e-08 Score=73.99 Aligned_cols=80 Identities=14% Similarity=0.112 Sum_probs=67.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++|+++|||.+.||+..+..+++.+.+. +.=++++||+.+....+.+. T Consensus 142 ~~LSgGqkqrl~lA~al~---------~~P~iLiLDEPts~LD~~~~~~i~~~i~~l~~~g~TiilvSH~l~~v~~lcDr 212 (264) T PRK13546 142 KKYSSGMRAKLGFSINIT---------VNPDILVIDEALSVGDQTFAQKCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTK 212 (264) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 347999999999999995---------69999999598754899999999999999996898999984878999986999 Q ss_pred EEEEEECCCEEEEC Q ss_conf 00799728968959 Q gi|254780766|r 362 AKFMRISNHQALCI 375 (375) Q Consensus 362 ~~~~~i~~g~~~~~ 375 (375) +..+.+|+++|. T Consensus 213 --i~vl~~GkIi~~ 224 (264) T PRK13546 213 --IAWIEGGKLKDY 224 (264) T ss_pred --EEEEECCEEEEE T ss_conf --999989889998 No 78 >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.84 E-value=2.2e-08 Score=73.98 Aligned_cols=81 Identities=19% Similarity=0.258 Sum_probs=68.6 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) ...+|.||++-+.++.-|+ ..++++++|||.+.|||..+..+.+++.+. +.=|++|||+-+....+. T Consensus 129 ~~~LS~G~kqrv~ia~Al~---------~~P~lliLDEPt~gLDp~~~~~i~~~i~~l~~~~g~tiilssH~l~eve~l~ 199 (220) T cd03265 129 VKTYSGGMRRRLEIARSLV---------HRPEVLFLDEPTIGLDPQTRAHVWEYIEKLKEEFGMTILLTTHYMEEAEQLC 199 (220) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHC T ss_conf 4347999999999999985---------6999899808866889999999999999999838979999888889999869 Q ss_pred CCEEEEEECCCEEEEC Q ss_conf 2600799728968959 Q gi|254780766|r 360 ETAKFMRISNHQALCI 375 (375) Q Consensus 360 ~~~~~~~i~~g~~~~~ 375 (375) +. +.-+++|+++|. T Consensus 200 dr--i~il~~G~ii~~ 213 (220) T cd03265 200 DR--VAIIDHGRIIAE 213 (220) T ss_pred CE--EEEEECCEEEEE T ss_conf 99--999979999998 No 79 >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.83 E-value=2.5e-08 Score=73.53 Aligned_cols=80 Identities=28% Similarity=0.360 Sum_probs=67.8 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.|||+.+.+|..|+ ...+++|+|||.+.||+..+..+++.|.+. +.-|+++|||.+....+.+ T Consensus 134 ~~~LSgGqkQrv~iAraL~---------~~P~lLlLDEPtagLD~~~~~~i~~ll~~l~~~G~tiiivsHdl~~v~~~aD 204 (271) T PRK13638 134 IQCLSHGQKKRVAIAGALV---------LQARYLLLDEPTAGLDPAGRTQMIAIIRRIVAQGNHVIISSHDIDLIYEISD 204 (271) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 3559999999999999996---------5999899838754589999999999999999789999998488899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 205 r--v~vl~~G~iva 216 (271) T PRK13638 205 A--VYVLRQGQILT 216 (271) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 80 >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.80 E-value=5.7e-08 Score=71.22 Aligned_cols=80 Identities=18% Similarity=0.266 Sum_probs=67.7 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++.+.++..|+ ..++++++|||.+.|||..+..+.+.|.+. +.-|++|||+.+....+.+ T Consensus 126 ~~~LSgG~kqrv~la~al~---------~~p~lllLDEPt~gLDp~~~~~i~~~i~~~~~~g~til~ssH~l~e~~~~~d 196 (210) T cd03269 126 VEELSKGNQQKVQFIAAVI---------HDPELLILDEPFSGLDPVNVELLKDVIRELARAGKTVILSTHQMELVEELCD 196 (210) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 5778998999999999995---------7998999928866799999999999999999689899998884899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|++++ T Consensus 197 ~--i~vl~~G~iv~ 208 (210) T cd03269 197 R--VLLLNKGRAVL 208 (210) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998988998 No 81 >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.80 E-value=3.7e-08 Score=72.47 Aligned_cols=79 Identities=19% Similarity=0.272 Sum_probs=67.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|-.|| .++.|+++|||.|.|||..+..+++.+.+. +.=++++||+-+....+.+ T Consensus 140 ~~LSGGqkqRvaIA~aLa---------~~P~iLlLDEPTagLDp~~~~~i~~ll~~l~~e~g~TiilvtHd~~~v~~~aD 210 (285) T PRK13636 140 HCLSFGQKKRVAIAGVLV---------MEPKVLVLDEPTAGLDPMGVSEIMKLLVEMQKELGLTIIIATHDIDIVPLYCD 210 (285) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 019999999999999997---------49989999787555999999999999999998449899999488999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 211 r--vivl~~G~iv~ 222 (285) T PRK13636 211 N--VFVMKEGRVIL 222 (285) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 82 >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.79 E-value=4e-08 Score=72.23 Aligned_cols=78 Identities=19% Similarity=0.252 Sum_probs=66.5 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|-||++.+++|-.|| ..++||++|||.+.|||..+..+++.+... +.-++++||+-+....+.+. T Consensus 144 ~LSGGqkqRvaiA~aLa---------~~P~vLlLDEPTs~LDp~~~~~i~~ll~~l~~~G~TiI~vtHd~~~v~~~adr- 213 (288) T PRK13643 144 ELSGGQMRRVAIAGILA---------MEPEVLVLDEPTAGLDPKARIEMMQLFESIHQSGQTVVLVTHLMDDVADYADY- 213 (288) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 39999999999999997---------49999999588555899999999999999995399999986089999997999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 214 -vivl~~G~Iv~ 224 (288) T PRK13643 214 -VYLLEKGHIIS 224 (288) T ss_pred -EEEEECCEEEE T ss_conf -99998999999 No 83 >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Probab=98.79 E-value=3.4e-07 Score=66.16 Aligned_cols=79 Identities=19% Similarity=0.221 Sum_probs=58.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||--.+||--|+ .++.+||+|||+|.||...|..+-..+.+. +.=+++-|||..-.=.+.+ T Consensus 135 ~qLSGGQqQRVALARAL~---------~~P~vLLLDEPlSaLD~kLR~~mr~Elk~lq~~~giT~i~VTHDqeEAl~msD 205 (352) T COG3842 135 HQLSGGQQQRVALARALV---------PEPKVLLLDEPLSALDAKLREQMRKELKELQRELGITFVYVTHDQEEALAMSD 205 (352) T ss_pred HHHCHHHHHHHHHHHHHH---------CCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 664827899999999742---------18354434274002318999999999999998559729999789899863236 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.- T Consensus 206 r--i~Vm~~G~I~Q 217 (352) T COG3842 206 R--IAVMNDGRIEQ 217 (352) T ss_pred C--EEECCCCCEEE T ss_conf 2--27821770432 No 84 >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters. Probab=98.78 E-value=3.8e-08 Score=72.40 Aligned_cols=79 Identities=27% Similarity=0.391 Sum_probs=66.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-||++.+++|..|+ ..+.++++|||.+.||+..+..+++.+.+. +.=++++||+-+....+.+ T Consensus 96 ~~LSGGqkQrv~iA~aL~---------~~P~ililDEPts~LD~~~~~~i~~~i~~l~~~~~~tii~itHdl~~~~~~~d 166 (180) T cd03214 96 NELSGGERQRVLLARALA---------QEPPILLLDEPTSHLDIAHQIELLELLRRLARERGKTVVMVLHDLNLAARYAD 166 (180) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 037999999999999998---------68964788587544799999999999999998469899999079899999799 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+++| T Consensus 167 ~--i~vm~~G~ii~ 178 (180) T cd03214 167 R--VILLKDGRIVA 178 (180) T ss_pred E--EEEEECCEEEE T ss_conf 9--99997998998 No 85 >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=98.78 E-value=4.8e-08 Score=71.71 Aligned_cols=78 Identities=14% Similarity=0.260 Sum_probs=65.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+++|..|+ ..++|+|+|||.+.||+..+..+++.+.+. +.-++++|||.+....+.+. T Consensus 125 ~~LSGGqkQrv~iA~aL~---------~~P~illLDEPt~gLD~~~~~~i~~ll~~l~~~g~tvi~itHdl~~~~~~~dr 195 (205) T cd03226 125 LSLSGGQKQRLAIAAALL---------SGKDLLIFDEPTSGLDYKNMERVGELIRELAAQGKAVIVITHDYEFLAKVCDR 195 (205) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 128999999999999997---------59999999799765899999999999999997999999980398999997999 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) ++-+++|+|+ T Consensus 196 --i~vl~~G~iV 205 (205) T cd03226 196 --VLLLANGAIV 205 (205) T ss_pred --EEEEECCEEC T ss_conf --9998199999 No 86 >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Probab=98.77 E-value=5.2e-08 Score=71.50 Aligned_cols=85 Identities=21% Similarity=0.296 Sum_probs=69.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||+.+.+|-.|+|+. .....++++|+|||.+.||+..+..+++.+.+. +.-|+++||+.+....+.+. T Consensus 133 ~~LSGGq~QRv~iAraL~q~~---~~~~~P~lLlLDEPtsgLD~~~~~~i~~ll~~l~~~g~tvl~vtHdl~~~~~~aDr 209 (257) T PRK13548 133 PTLSGGEQQRVQLARVLAQLW---EPGGGPRWLLLDEPTSALDLAHQHHVLRLARQLAERGAAVIVVLHDLNLAARYADR 209 (257) T ss_pred HHCCHHHHHHHHHHHHHHHCC---CCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 669999999999999996200---10479988998898766899999999999999985599999992788999997999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+++|++++ T Consensus 210 --v~vl~~G~iv~ 220 (257) T PRK13548 210 --IVLLHQGRLVA 220 (257) T ss_pred --EEEEECCEEEE T ss_conf --99998999999 No 87 >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates. Probab=98.77 E-value=7e-08 Score=70.63 Aligned_cols=79 Identities=23% Similarity=0.352 Sum_probs=64.8 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++.+.+|..|+ ..++++|+|||.|.||+..+..+++.|.+. +.-|+++||+.+....+.+ T Consensus 130 ~~~LSgGqkQRv~iAraL~---------~~P~lLlLDEPtsgLD~~~~~~~~~~i~~l~~~g~tii~vtHdl~~~~~~~d 200 (213) T cd03235 130 IGELSGGQQQRVLLARALV---------QDPDLLLLDEPFAGVDPKTQEDIYELLRELRREGMTILVVTHDLGLVLEYFD 200 (213) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 4657989999999999996---------6999999818866789999999999999999689999999079899999799 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+ +|.++| T Consensus 201 r--ii~l-~~~iia 211 (213) T cd03235 201 R--VLLL-NRTVVA 211 (213) T ss_pred E--EEEE-CCCEEE T ss_conf 9--9999-995983 No 88 >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Probab=98.76 E-value=8.1e-08 Score=70.21 Aligned_cols=79 Identities=18% Similarity=0.269 Sum_probs=67.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+.+|-.|| ..++|+|+|||.|+||+..+..+++.|.+. +.-|+++|||.+....+.+ T Consensus 142 ~~LSGGq~QRv~iAraL~---------~~P~illLDEPts~LD~~~~~~i~~~i~~l~~~~g~tvi~vtHdl~~a~~~ad 212 (265) T PRK10253 142 DTLSGGQRQRAWIAMVLA---------QETAIMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYAS 212 (265) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC T ss_conf 019988999999999985---------69998998188766899999999999999998509899999359999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 213 r--vivl~~Gkiva 224 (265) T PRK10253 213 H--LIALREGKIVA 224 (265) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 89 >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.76 E-value=5.5e-08 Score=71.34 Aligned_cols=79 Identities=22% Similarity=0.321 Sum_probs=66.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+++|-.|| ..++|+++|||.|.||+..+..+++.+.+. +.=|+++||+-+....+.+. T Consensus 136 ~~LSGGqkqRVaiA~aLa---------~~P~iliLDEPTagLDp~~~~~i~~ll~~l~~~G~Tii~iTHdm~~~~~~adr 206 (275) T PRK13639 136 HHLSGGQKKRVAIAGILA---------MNPEIMVLDEPTSGLDPMGASQIMKLLYDLNKEGITIIISTHDVDLVPIYANK 206 (275) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 449999999999988873---------69989997797554899999999999999997699999993899999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+|++ T Consensus 207 --v~vl~~G~iv~ 217 (275) T PRK13639 207 --IYVLNDGKIIK 217 (275) T ss_pred --EEEEECCEEEE T ss_conf --99998998999 No 90 >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Probab=98.76 E-value=6.7e-08 Score=70.76 Aligned_cols=78 Identities=19% Similarity=0.316 Sum_probs=64.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||+.+++|-.|+ ..++|+|+|||.+.||+..++.+++.|.++ +.-|++.|||.+.... . T Consensus 143 ~~LSgGq~QRvaiAral~---------~~p~vlllDEPT~~LD~~~~~~v~~ll~~l~~~G~tii~vtHd~~~a~~---a 210 (648) T PRK10535 143 SQLSGGQQQRVSIARALM---------NGGQVILADEPTGALDSHSGEEVMAILHQLRDRGHTVIIVTHDPQVAAQ---A 210 (648) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH---C T ss_conf 338999999999999997---------2898999568855579999999999999999779999997648699964---9 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ..++.+++|+|++ T Consensus 211 ~Rii~~~dG~iv~ 223 (648) T PRK10535 211 ERVIEIRDGEIVR 223 (648) T ss_pred CEEEEEECCEEEC T ss_conf 9799995898973 No 91 >TIGR02169 SMC_prok_A chromosome segregation protein SMC; InterPro: IPR011891 The SMC (structural maintenance of chromosomes) family of proteins, exist in virtually all organisms including both bacteria and archaea. The SMC proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms and form three types of heterodimer (SMC1SMC3, SMC2SMC4, SMC5SMC6), which are core components of large multiprotein complexes. The best known complexes are cohesin, which is responsible for sister-chromatid cohesion, and condensin, which is required for full chromosome condensation in mitosis. SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes. The proteins range in size from approximately 110 to 170 kDa, and share a five-domain structure, with globular N- and C-terminal (IPR003395 from INTERPRO) domains separated by a long (circa 100 nm or 900 residues) coiled coil segment in the centre of which is a globular ''hinge'' domain, characterised by a set of four highly conserved glycine residues that are typical of flexible regions in a protein. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif (XXXXD, where X is any hydrophobic residue), and a LSGG motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases . All SMC proteins appear to form dimers, either forming homodimers with themselves, as in the case of prokaryotic SMC proteins, or heterodimers between different but related SMC proteins. The dimers are arranged in an antiparallel alignment. This orientation brings the N- and C-terminal globular domains (from either different or identical protamers) together, which unites an ATP binding site (Walker A motif) within the N-terminal domain with a Walker B motif (DA box) within the C-terminal domain, to form a potentially functional ATPase. Protein interaction and microscopy data suggest that SMC dimers form a ring-like structure which might embrace DNA molecules. Non-SMC subunits associate with the SMC amino- and carboxy-terminal domains. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. SMCs share not only sequence similarity but also structural similarity with ABC proteins. SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression . This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by IPR011890 from INTERPRO. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent .. Probab=98.75 E-value=2.7e-07 Score=66.86 Aligned_cols=174 Identities=15% Similarity=0.198 Sum_probs=114.6 Q ss_pred CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHH-HHHHH---HHHHHHHHHHHHHHC Q ss_conf 01000135846778887777666667988630565432100245653279999999-99999---999999999998531 Q gi|254780766|r 144 LDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINI-ARVEM---INALSSLIMEYVQKE 219 (375) Q Consensus 144 lD~~i~~~~~~y~~~l~~y~K~LkqRN~lLk~~~~d~~~l~~~~~qla~~~~~I~~-~R~~~---l~~l~~~l~~~~~~~ 219 (375) +-.-|..+.|-...++.+|....+-.+-+ +.+ ...|..=-..|.+.-..+.. +|..| +..+|..|..++..+ T Consensus 1000 ~~~~~~~LepVNm~AI~eYe~~~~r~~eL-~~K---~~~L~~Er~~i~~rI~~~e~~Kr~~F~~aF~~IN~~f~~iF~~L 1075 (1202) T TIGR02169 1000 VEEEIRALEPVNMLAIQEYEEVEKRLDEL-KEK---RAKLEEEREEILERIEEYEKKKREVFMEAFEAINENFKEIFAEL 1075 (1202) T ss_pred HHHHHHHHCCCCCCCHHHHHHHHHHHHHH-HHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 99998641430143322179999998769-999---99999989999999999887889999999999999999999853 Q ss_pred C-CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCHHHCCEEECCCCCCEEEECCCCCCCHHH-HHCCCHHHHHHHH Q ss_conf 6-4301122015666765589678888765455311100000000025732001100124551023-3122058999999 Q gi|254780766|r 220 N-FPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLV 297 (375) Q Consensus 220 ~-~~~~~~~l~~~~~~~~~~~~~~~~e~~~~~L~~~~~~d~~~~~t~~Gphr~d~~~~~~~~~~~~-~~~S~Gqqk~~~l 297 (375) + +..-.+-+.+ ++..|.-+. .+...-+||++.. .-.|-||+.+.+| T Consensus 1076 SP~G~g~L~Le~-PdDPF~GGl-------------------------------~l~a~P~~K~vqrleAMSGGEKSLtAL 1123 (1202) T TIGR02169 1076 SPGGTGELILEN-PDDPFAGGL-------------------------------ELKAKPKGKPVQRLEAMSGGEKSLTAL 1123 (1202) T ss_pred CCCCCEEEECCC-CCCCCCCCC-------------------------------EEEEEECCCCEEEHHHCCCCHHHHHHH T ss_conf 889824654358-887436871-------------------------------788873788502022103838999999 Q ss_pred HHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHH Q ss_conf 99999999999870899789980122015989999999997417--98099980696785432 Q gi|254780766|r 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSL 358 (375) Q Consensus 298 ~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~ 358 (375) ||++| -+.+...|+..+|||.+|||..|-.++.+++.+. ..|+||=|.-..+++.- T Consensus 1124 sFIFA-----iQ~y~PsPFYafDEVDmfLD~~Nverva~li~~~s~~AQFIVvSLR~~m~~~A 1181 (1202) T TIGR02169 1124 SFIFA-----IQRYKPSPFYAFDEVDMFLDGVNVERVAKLIKEKSKEAQFIVVSLRKPMIEAA 1181 (1202) T ss_pred HHHHH-----HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHH T ss_conf 99999-----96218985404446777751875999999998604863467776235899876 No 92 >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2. Probab=98.75 E-value=8.8e-08 Score=69.98 Aligned_cols=79 Identities=20% Similarity=0.213 Sum_probs=66.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++-+.+|..|+ ..++|+|+|||.+.||+..+..+++.+.+. +.=++++||+.+....+.+. T Consensus 141 ~~LSgG~kqRl~iA~al~---------~~P~illLDEPt~gLD~~~~~~i~~~i~~l~~~g~tiii~sH~l~~v~~lcdr 211 (224) T cd03220 141 KTYSSGMKARLAFAIATA---------LEPDILLIDEVLAVGDAAFQEKCQRRLRELLKQGKTVILVSHDPSSIKRLCDR 211 (224) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 546999999999999996---------69999999188665699999999999999985899999988988999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+++|+|++ T Consensus 212 --iivl~~G~Iv~ 222 (224) T cd03220 212 --ALVLEKGKIRF 222 (224) T ss_pred --EEEEECCEEEE T ss_conf --99998999998 No 93 >PRK13536 nodulation factor exporter subunit NodI; Provisional Probab=98.75 E-value=6.6e-08 Score=70.80 Aligned_cols=80 Identities=18% Similarity=0.278 Sum_probs=67.3 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++-+.+|.-|+ ..++|+++|||.+.|||..++.+.++|.+. +.=|++|||+-+-...+.+ T Consensus 136 ~~~lSgG~kqrl~iA~aL~---------~~P~lliLDEPT~GLDp~~r~~i~~~i~~l~~~G~TillttH~l~E~e~lcd 206 (306) T PRK13536 136 VSDLSGGMKRRLTLARALI---------NDPQLLILDEPTTGLDPHARHLIWERLRSLLARGKTILLTTHFMEEAERLCD 206 (306) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 7778998999999999995---------5998999758756789999999999999999689899998883899998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|++++ T Consensus 207 r--v~im~~G~iia 218 (306) T PRK13536 207 R--LCVLEAGRKIA 218 (306) T ss_pred E--EEEEECCEEEE T ss_conf 9--99997988999 No 94 >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.75 E-value=9.7e-08 Score=69.72 Aligned_cols=79 Identities=25% Similarity=0.314 Sum_probs=66.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-||+..+++|--|+ ..++|+|+|||+|.||+..+..+++.+.+. +.=+++.|||.+....+.+ T Consensus 127 ~~LSGGqkQRvaiARAL~---------~~P~ilLlDEPts~LD~~~~~~l~~~l~~l~~~~~~Tvi~vTHd~~ea~~~ad 197 (211) T cd03298 127 GELSGGERQRVALARVLV---------RDKPVLLLDEPFAALDPALRAEMLDLVLDLHAETKMTVLMVTHQPEDAKRLAQ 197 (211) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 558989999999999986---------59999997188765598999999999999999749989999889999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++.+.+|+|+. T Consensus 198 r--iivl~~G~Ii~ 209 (211) T cd03298 198 R--VVFLDNGRIAA 209 (211) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998989998 No 95 >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.75 E-value=7.5e-08 Score=70.45 Aligned_cols=78 Identities=23% Similarity=0.255 Sum_probs=66.0 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|-||++.+++|-.|| ..+.||++|||.+.|||..+..+++.+.+. +.-|+++||+-+....+.+. T Consensus 145 ~LSGGqkqRvaiA~aL~---------~~P~iLllDEPTsgLDp~~~~~i~~ll~~l~~~G~Tii~vTHdl~~v~~~aDr- 214 (280) T PRK13649 145 ELSGGQMRRVAIAGILA---------MEPKILVLDEPTAGLDPKGRKELMTIFKKLHQSGMTIVLVTHLMDDVANYADF- 214 (280) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 09999999999999997---------49999998487554899999999999999986399999987589999997999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 215 -v~vl~~G~iv~ 225 (280) T PRK13649 215 -VYVLEKGKIVL 225 (280) T ss_pred -EEEEECCEEEE T ss_conf -99998999999 No 96 >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.74 E-value=9.7e-08 Score=69.72 Aligned_cols=79 Identities=16% Similarity=0.250 Sum_probs=67.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+++|-.|+ .+++|+|+|||.++||+..+..+++.+.+. +.=+++.|||.+....+.+ T Consensus 143 ~~LSGGq~QRVaIARAL~---------~~P~ill~DEPts~LD~~~~~~i~~ll~~l~~~~g~Tii~vtHdl~~a~~~ad 213 (241) T cd03256 143 DQLSGGQQQRVAIARALM---------QQPKLILADEPVASLDPASSRQVMDLLKRINREEGITVIVSLHQVDLAREYAD 213 (241) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 414802899999999985---------59998996287665899999999999999998519899999579899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|.+ T Consensus 214 r--i~~l~~G~iv~ 225 (241) T cd03256 214 R--IVGLKDGRIVF 225 (241) T ss_pred E--EEEEECCEEEE T ss_conf 8--99996999999 No 97 >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.74 E-value=9.6e-08 Score=69.75 Aligned_cols=79 Identities=23% Similarity=0.329 Sum_probs=67.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+.+|..|| ..++++++|||.+.||+..+..+++.|.+. +.-++++||+-+....+.+ T Consensus 136 ~~LSGGqkqRvaiA~aL~---------~~P~lLlLDEPtagLDp~~~~~i~~~l~~l~~~~g~Tii~vtHdl~~v~~~aD 206 (277) T PRK13652 136 HHLSGGEKKRVAIAGILA---------MEPQVLVLDEPTAGLDPQGVKELFDFLNALPETYGMTVIFSTHQVELVAEMAD 206 (277) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 448999999999999998---------29999998397454899999999999999998509899999148999999799 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+|++ T Consensus 207 r--i~vl~~G~ii~ 218 (277) T PRK13652 207 Y--IYVMEKGEIVG 218 (277) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 98 >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein; InterPro: IPR005670 This is a family of phosphate transport system permease proteins.; GO: 0005315 inorganic phosphate transmembrane transporter activity, 0015114 phosphate transmembrane transporter activity, 0006817 phosphate transport, 0016020 membrane. Probab=98.74 E-value=3e-07 Score=66.52 Aligned_cols=71 Identities=20% Similarity=0.266 Sum_probs=50.3 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC--CCEEEEECCHHHHHHHHCCEE Q ss_conf 122058999999999999999998708997899801220159899999999974179--809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG--SQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~--~Qv~iTt~~~~~~~~~~~~~~ 363 (375) -+|-|||=.+-+|=-||- ++=|||||||.|=|||.--.+|-+.+.+++ .=|+|=||+=.--.=+.|.+- T Consensus 144 ~LSGGQQQRLCIARalA~---------ePeVlLlDEPTSALDPIaT~~IEeLi~eLk~~YTivIVTHnMqQA~RiSD~tA 214 (248) T TIGR00972 144 GLSGGQQQRLCIARALAV---------EPEVLLLDEPTSALDPIATGKIEELIQELKKKYTIVIVTHNMQQAARISDRTA 214 (248) T ss_pred CCCCHHHHHHHHHHHHHC---------CCCEECCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHH T ss_conf 787268899999987524---------88521057888757877899999999987652979988177567899999998 Q ss_pred EE Q ss_conf 79 Q gi|254780766|r 364 FM 365 (375) Q Consensus 364 ~~ 365 (375) || T Consensus 215 FF 216 (248) T TIGR00972 215 FF 216 (248) T ss_pred HH T ss_conf 86 No 99 >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Probab=98.73 E-value=8.6e-08 Score=70.06 Aligned_cols=79 Identities=18% Similarity=0.265 Sum_probs=66.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+.+|..|+ ..++++|+|||.+.||+..+..+++.+.+. +.=++++||+.+....+.+ T Consensus 146 ~~LSGGq~QRv~iAraL~---------~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~~~~g~tvi~vtHdl~~~~~~aD 216 (265) T PRK10575 146 DSLSGGERQRAWIAMLVA---------QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCD 216 (265) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHCC T ss_conf 338999999999999875---------69998998177655899999999999999986289899999388899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 217 r--v~vl~~G~iv~ 228 (265) T PRK10575 217 Y--LVALRGGEMIA 228 (265) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998996999 No 100 >PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional Probab=98.73 E-value=1.2e-07 Score=69.01 Aligned_cols=81 Identities=19% Similarity=0.272 Sum_probs=68.3 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++.+.++.-|+ ..+.||++|||.+.|||..++.+++++.+. +.-|++|||..+-...+.+ T Consensus 134 ~~~lSgG~kqrl~ia~al~---------~~P~lliLDEPT~GLDp~~r~~i~~~i~~l~~~G~TillttH~l~E~e~lcD 204 (304) T PRK13537 134 VGELSGGMKRRLTLARALV---------NDPDVLVLDEPTTGLDPQARHLMWERLRSLLARGKTILLTTHFMEEAERLCD 204 (304) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 6679999999999999983---------7999999938866789999999999999999689999998884899998699 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) . +.-+++|+++|. T Consensus 205 r--v~ii~~G~iva~ 217 (304) T PRK13537 205 R--LCVIEEGRKIAE 217 (304) T ss_pred E--EEEEECCEEEEE T ss_conf 9--999989999997 No 101 >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein. Probab=98.73 E-value=9.3e-08 Score=69.84 Aligned_cols=80 Identities=19% Similarity=0.260 Sum_probs=67.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++.+.++..|+ ..++++++|||.+.|||..+..+.+.|.+. +.=|++|||+.+....+.+ T Consensus 124 ~~~LS~G~kqrl~la~al~---------~~p~lliLDEPt~GLD~~~~~~i~~~l~~l~~~g~til~~sH~l~e~~~~~d 194 (208) T cd03268 124 VKGFSLGMKQRLGIALALL---------GNPDLLILDEPTNGLDPDGIKELRELILSLRDQGITVLISSHLLSEIQKVAD 194 (208) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 3569999999999999985---------6999999938876899999999999999999589999998986899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|++++ T Consensus 195 r--i~vl~~G~iv~ 206 (208) T cd03268 195 R--IGIINKGKLIE 206 (208) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999998 No 102 >PRK01156 chromosome segregation protein; Provisional Probab=98.73 E-value=1.6e-07 Score=68.24 Aligned_cols=95 Identities=24% Similarity=0.303 Sum_probs=72.1 Q ss_pred EECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----C--CCCEE Q ss_conf 10012455102331220589999999999999999987089978998012201598999999999741----7--98099 Q gi|254780766|r 273 LIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----I--GSQIF 346 (375) Q Consensus 273 ~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~--~~Qv~ 346 (375) +.+...|...+++.+|.||+=+++|||.||-++++.. ..|+++||||++.||+.++..+.+.|.. . ..||+ T Consensus 788 i~v~~~g~~r~v~~LSGGE~~~~aLaL~laL~~~~~~---~~~~~ilDE~~~~LD~~~~~~l~~~l~~~~~~~~~~~qi~ 864 (895) T PRK01156 788 ITVSRGGMVEGIDSLSGGEKTAVAFALRVAVAQFLNN---DKSLLIMDEPTAFLDEDRRTNLKDIIEYSLKDSSDIPQVI 864 (895) T ss_pred EEEECCCEECCCCCCCHHHHHHHHHHHHHHHHHHHHC---CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEE T ss_conf 6982598254366788779999999999999999845---8995998599877587789999999999986368988799 Q ss_pred EEECCHHHHHHHHCCEEEEEECCC Q ss_conf 980696785432126007997289 Q gi|254780766|r 347 MTGTDKSVFDSLNETAKFMRISNH 370 (375) Q Consensus 347 iTt~~~~~~~~~~~~~~~~~i~~g 370 (375) |=||++.+-+.+.....+...+.| T Consensus 865 IISH~~el~~~~d~~i~V~K~~~~ 888 (895) T PRK01156 865 MISHHRELLSVADVAYEVKKSSGS 888 (895) T ss_pred EEECHHHHHHHCCCEEEEEEECCC T ss_conf 982448899858937999998894 No 103 >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Probab=98.72 E-value=6.8e-07 Score=64.20 Aligned_cols=79 Identities=19% Similarity=0.330 Sum_probs=54.2 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHH Q ss_conf 331220589999999999999999987089978998012201598999999999741----7980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~ 359 (375) ...+|.||.-...+|+.+|| ..--+|+|||...||..+-..+++.|.. .+.-+++--||-+.-+-.. T Consensus 133 Ld~LSGGQrQRAfIAMVlaQ---------dTdyvlLDEPLNNLDmkHsv~iMk~Lrrla~el~KtiviVlHDINfAS~Ys 203 (252) T COG4604 133 LDELSGGQRQRAFIAMVLAQ---------DTDYVLLDEPLNNLDMKHSVQIMKILRRLADELGKTIVVVLHDINFASCYS 203 (252) T ss_pred HHHCCCCHHHHHHHHEEEEC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEECCCHHHHHH T ss_conf 77516604553443104411---------576798658654314688999999999999985894999993142777633 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) +. ++-+++|++. T Consensus 204 D~--IVAlK~G~vv 215 (252) T COG4604 204 DH--IVALKNGKVV 215 (252) T ss_pred HH--EEEECCCEEE T ss_conf 23--3663077887 No 104 >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.72 E-value=9e-08 Score=69.94 Aligned_cols=78 Identities=21% Similarity=0.292 Sum_probs=65.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.||++.+++|-.|| ..+.|+++|||.+.|||..+..+++.+.+. +.=|+++||+-+....+.+. T Consensus 145 ~LSGGqkqRvaiA~aLa---------~~P~iLlLDEPTsgLDp~~~~~i~~ll~~l~~~G~Tii~vtHd~~~v~~~adr- 214 (286) T PRK13641 145 ELSGGQMRRVAIAGVMA---------YEPEILCLDEPAAGLDPEGRKEMMQIFKDYQKAGHTVILVTHNMDDVAEYADD- 214 (286) T ss_pred HCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 29999999999999997---------49999997397343899999999999999996399999991599999997999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+++|+|+. T Consensus 215 -v~vm~~G~iv~ 225 (286) T PRK13641 215 -VLVLEHGKLIK 225 (286) T ss_pred -EEEEECCEEEE T ss_conf -99998999999 No 105 >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=98.72 E-value=1.3e-07 Score=68.85 Aligned_cols=79 Identities=24% Similarity=0.297 Sum_probs=66.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++++|+|||.+.|||..+..+++.+.+. +.-++++||+.+....+.+. T Consensus 136 ~~LSgG~~Qrv~iAraL~---------~~P~lLlLDEPt~gLD~~~~~~i~~~l~~l~~~g~tii~vsH~l~~~~~~aDr 206 (237) T PRK11614 136 GTMSGGEQQMLAIGRALM---------SQPRLLLLDEPSLGLAPIIIQQIFDTIEQLREQGMTIFLVEQNANQALKLADR 206 (237) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 348998859999999985---------69999999597557999999999999999996799999994758999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 207 --v~vl~~G~iv~ 217 (237) T PRK11614 207 --GYVLENGHVVL 217 (237) T ss_pred --EEEEECCEEEE T ss_conf --99997999999 No 106 >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Probab=98.71 E-value=1.3e-07 Score=68.79 Aligned_cols=79 Identities=22% Similarity=0.225 Sum_probs=66.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+.+|..|+ ..+.|||+|||.+.||+..+..+++++.+. +.=|+++||+.+....+.+ T Consensus 132 ~~LSGGqkQRvaiAraL~---------~~P~lLlLDEPtsgLD~~~~~~i~~ll~~L~~e~g~TIi~vTHdl~ea~~laD 202 (257) T PRK11247 132 AALSGGQKQRVALARALI---------HRPRLLLLDEPLGALDALTRIEMQDLIESLWQQHGFTVLLVTHDVSEAVAMAD 202 (257) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 448999999999999984---------59999998098765799999999999999999609899998879999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|.. T Consensus 203 R--I~vm~~G~Iv~ 214 (257) T PRK11247 203 R--VLLIEEGKIGL 214 (257) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 107 >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Probab=98.71 E-value=1.5e-07 Score=68.44 Aligned_cols=80 Identities=25% Similarity=0.363 Sum_probs=68.3 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++.+.||-.|++ +.+|||+|||.++||+.++..+++.|.++ +.=|++++||.+....+.+ T Consensus 136 ~~~LSGGqrQRV~IARALaq---------~P~ILLLDEPTs~LDi~~q~ell~lLr~L~~~G~TVI~vtHDL~lA~~~cD 206 (409) T PRK09536 136 VTSLSGGERQRVLLARALAQ---------ATPVLLLDEPTASLDINHQIRTLELVRDLADDGKTVVAAIHDLNLAARYCD 206 (409) T ss_pred HHHCCHHHHHHHHHHHHHHC---------CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 00289999999999999967---------999899958766799999999999999998589999999568999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|++ T Consensus 207 r--Vivl~~GrIva 218 (409) T PRK09536 207 E--LVLLADGRVHD 218 (409) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998998 No 108 >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.71 E-value=1.5e-07 Score=68.47 Aligned_cols=79 Identities=16% Similarity=0.249 Sum_probs=66.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|-.|| ..++|+|+|||.+.||+..+..+++.|.++ +.-++++|||.+....+.+ T Consensus 143 ~~LSGGqkQRvaiA~aL~---------~~P~iLllDEPTs~LDp~~~~~i~~~l~~L~~e~g~Tvi~vTHdl~~v~~~aD 213 (287) T PRK13637 143 FELSGGQKRRVAIAGVVA---------MEPKVLILDEPTAGLDPKGRDDILEKIKALHKEYNMTIILVSHSMEDVAKIAD 213 (287) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 129988999999999998---------39999998388664899999999999999998509899999579999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|++ T Consensus 214 R--vivl~~G~Iv~ 225 (287) T PRK13637 214 R--IIVMNKGRCEL 225 (287) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 109 >PRK13651 cobalt transporter ATP-binding subunit; Provisional Probab=98.69 E-value=1.7e-07 Score=68.19 Aligned_cols=78 Identities=19% Similarity=0.232 Sum_probs=65.2 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.||++.+++|-.|| ..+.|+|+|||.+.|||..+..+++.+.+. +.-|+++|||-+....+.+. T Consensus 161 ~LSGGqkqRVaIA~~La---------~~P~iLlLDEPTagLDp~~~~~i~~~l~~L~~~G~TVI~vTHdm~~v~~~adR- 230 (304) T PRK13651 161 ELSGGQKRRVALAGILA---------MEPDFLVFDEPTAGLDPQGVKEILEIFDTLNKKGKTIILVTHDLDNVLEWTKR- 230 (304) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 28999999999999884---------59999997298665898999999999999997799999986789999997999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+.+|+|+. T Consensus 231 -vivl~~G~Iv~ 241 (304) T PRK13651 231 -TIFFKDGKIIK 241 (304) T ss_pred -EEEEECCEEEE T ss_conf -99998998999 No 110 >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.69 E-value=1.7e-07 Score=68.08 Aligned_cols=79 Identities=16% Similarity=0.287 Sum_probs=67.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|-.|| ..+.|+++|||.+.|||..+..+++.|.+. +.-+++.|||-+....+.+ T Consensus 144 ~~LSGGqkqRVaiA~aLa---------~~P~iLilDEPTagLDp~~~~~i~~ll~~l~~~~g~TiI~iTHdm~~v~~~ad 214 (286) T PRK13646 144 FQMSGGQMRKIAIVSILA---------MNPDIIVVDEPTAGLDPQSKRQVMRLLKSLQTDENKAIILISHDMNEVARYAD 214 (286) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 329999999999999985---------19899998387443898999999999999999539899999138999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|++ T Consensus 215 r--v~vm~~G~Iv~ 226 (286) T PRK13646 215 E--VIVMKEGSIVS 226 (286) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998989999 No 111 >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Probab=98.69 E-value=1.2e-07 Score=69.09 Aligned_cols=78 Identities=23% Similarity=0.396 Sum_probs=64.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+.+|..|+ ..+.+||+|||.++||+..+..+++.|.+. +.=++++|||.+....+.+ T Consensus 119 ~~LSGGq~QRv~iAraL~---------~~P~lLiLDEPTsgLD~~~~~~i~~li~~L~~e~g~til~vtHDl~~~~~~aD 189 (251) T PRK09544 119 QKLSGGETQRVLLARALL---------NRPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELDCAVLMVSHDLHLVMAKTD 189 (251) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 458999999999999997---------49998998098646899999999999999998329899999068999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) .. .-+ ||+|+| T Consensus 190 rI--ivL-ng~Iia 200 (251) T PRK09544 190 EV--LCL-NHHICC 200 (251) T ss_pred EE--EEE-CCEEEE T ss_conf 99--999-998899 No 112 >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=98.69 E-value=1.4e-07 Score=68.77 Aligned_cols=79 Identities=16% Similarity=0.253 Sum_probs=66.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||+.+.+|..|+ ..+.++|+|||.+.|||..+..+.+.|.+. +.=|++++|+.+....+.+ T Consensus 130 ~~LSGGq~Qrv~iAraL~---------~~P~lLlLDEPt~gLD~~~~~~i~~~i~~l~~~~g~tvl~vtH~l~~~~~~ad 200 (230) T TIGR03410 130 GDLSGGQQQQLAIARALV---------TRPKLLLLDEPTEGIQPSIIKDIGRVIRRLRAEGGMAILLVEQYLDFARELAD 200 (230) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHCC T ss_conf 119999999999999996---------29988999385226999999999999999997179899999088899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 201 r--v~vl~~G~iv~ 212 (230) T TIGR03410 201 R--YYVMERGRVVA 212 (230) T ss_pred E--EEEEECCEEEE T ss_conf 9--99995998999 No 113 >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.68 E-value=1.9e-07 Score=67.86 Aligned_cols=78 Identities=18% Similarity=0.227 Sum_probs=66.3 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||++.+++|-.|| ..+.|||+|||.|.||+..+..+++.+.++ +.-|++.|||.+....+.+. T Consensus 132 ~LSGGqkQRVaIA~aLa---------~~P~iLllDEPTs~LD~~~~~~i~~ll~~L~~e~g~Tii~vTHdl~~~~~~aDr 202 (276) T PRK13634 132 ELSGGQMRRVAIAGVLA---------MEPEVLVLDEPTAGLDPKGRKEIMEMFYKLHKEKGLTTVLVTHSMEDAARYADQ 202 (276) T ss_pred HCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 18999999999999997---------299989976985427999999999999999996199999986799999997999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 203 --vivm~~G~Iv~ 213 (276) T PRK13634 203 --IVVMHKGTVFL 213 (276) T ss_pred --EEEEECCEEEE T ss_conf --99998999999 No 114 >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Probab=98.68 E-value=1.4e-07 Score=68.75 Aligned_cols=79 Identities=19% Similarity=0.320 Sum_probs=67.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||+.+++|-.|+ ..+.++|+|||.+.||+..+..+++.+.+. +.=++++||+.+....+.+. T Consensus 135 ~~LSGGq~QRvaiAraL~---------~~P~lLllDEPt~~LD~~~~~~i~~ll~~l~~~g~tvi~vtHdl~~~~~~adr 205 (240) T PRK09493 135 SELSGGQQQRVAIARALA---------VKPKLMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASR 205 (240) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 728999999999998773---------59999999088766899999999999999997699899994799999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+|++ T Consensus 206 --i~vl~~G~iv~ 216 (240) T PRK09493 206 --LIFIDKGRIAE 216 (240) T ss_pred --EEEEECCEEEE T ss_conf --99998999999 No 115 >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Probab=98.68 E-value=1.2e-07 Score=69.07 Aligned_cols=88 Identities=19% Similarity=0.163 Sum_probs=69.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHH-CCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC----CCEEEEECCHHHHHHHH Q ss_conf 31220589999999999999999987-08997899801220159899999999974179----80999806967854321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNT-TGFAPILLLDEISAHLDEDKRNALFRIVTDIG----SQIFMTGTDKSVFDSLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~-~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~----~Qv~iTt~~~~~~~~~~ 359 (375) ..+|-||++.+.+|-.||+....... ...+.+||+|||.|.||+..+..+++.+.+.. .=+++.|||.+....+. T Consensus 144 ~~LSGGq~qRv~iAraL~~l~~~~~al~~~P~lLlLDEPts~LD~~~~~~i~~~l~~l~~e~g~tvl~vtHdl~~~~~~a 223 (273) T PRK13547 144 TTLSGGELARVQFARVLAQLWPPDPGAAQPPRYLLLDEPTAALDLAHQHRLLDTVRRLAREWNLGVLAIVHDPNLAARHA 223 (273) T ss_pred HHCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHC T ss_conf 12699999999999999851011101368986899728744489999999999999999837989999988999999979 Q ss_pred CCEEEEEECCCEEEE Q ss_conf 260079972896895 Q gi|254780766|r 360 ETAKFMRISNHQALC 374 (375) Q Consensus 360 ~~~~~~~i~~g~~~~ 374 (375) +. ++-+.+|++++ T Consensus 224 Dr--i~vL~~G~iv~ 236 (273) T PRK13547 224 DR--IAMLADGAIVA 236 (273) T ss_pred CE--EEEEECCEEEE T ss_conf 99--99998987999 No 116 >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Probab=98.68 E-value=2e-07 Score=67.65 Aligned_cols=79 Identities=13% Similarity=0.175 Sum_probs=66.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||+.+.+|-.|+ ..+.|+|+|||.+.||+..+..+++.+.+. +.=++++||+-+....+.+ T Consensus 143 ~~LSGGq~QRv~iAraL~---------~~P~iLlLDEPtsgLD~~~~~~i~~li~~l~~~~g~TiiivtHdl~~v~~iaD 213 (269) T PRK11831 143 SELSGGMARRAALARAIA---------LEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIAD 213 (269) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 318999999999999997---------59999998287567999999999999999998529899998649899998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+|++ T Consensus 214 r--v~vl~~G~Iv~ 225 (269) T PRK11831 214 H--AWIVADKKIVA 225 (269) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 117 >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring. Probab=98.68 E-value=1.3e-07 Score=68.94 Aligned_cols=77 Identities=22% Similarity=0.357 Sum_probs=64.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||..+++|-.|+ ..++|+|+|||.+.|||.....+++.+.+. +.=++++||+.+....+.+. T Consensus 135 ~~LSGGqkQRvaIARALv---------~~P~ill~DEPT~~LD~~~~~~i~~ll~~l~~~g~Tii~vTHd~~~~~~~~dr 205 (214) T cd03292 135 AELSGGEQQRVAIARAIV---------NSPTILIADEPTGNLDPDTTWEIMNLLKKINKAGTTVVVATHAKELVDTTRHR 205 (214) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 248889999999999997---------29999998398787798999999999999985099999989898999986897 Q ss_pred EEEEEECCCEE Q ss_conf 00799728968 Q gi|254780766|r 362 AKFMRISNHQA 372 (375) Q Consensus 362 ~~~~~i~~g~~ 372 (375) ++.+++|+| T Consensus 206 --v~~l~~GkI 214 (214) T cd03292 206 --VIALERGKL 214 (214) T ss_pred --EEEEECCCC T ss_conf --999959999 No 118 >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=98.68 E-value=1.5e-07 Score=68.53 Aligned_cols=80 Identities=15% Similarity=0.290 Sum_probs=67.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) ...+|-|||+.+.+|..|+ ..+.+||+|||.+.||+..+..+.+.+.+. +.=|+++||+.+....+. T Consensus 151 ~~~LSgGq~Qrv~iAraL~---------~~P~lLlLDEPt~gLD~~~~~~i~~~i~~l~~~~g~tvl~itHdl~~v~~~a 221 (255) T PRK11300 151 AGNLAYGQQRRLEIARCMV---------TQPRILMLDEPAAGLNPKETKELDELIAELRNEHNVTVLLIEHDMKLVMGIS 221 (255) T ss_pred HHHCCCHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHC T ss_conf 4667948899999999997---------2999699818754699999999999999999715979999927389999869 Q ss_pred CCEEEEEECCCEEEE Q ss_conf 260079972896895 Q gi|254780766|r 360 ETAKFMRISNHQALC 374 (375) Q Consensus 360 ~~~~~~~i~~g~~~~ 374 (375) +. +.-+++|++.| T Consensus 222 Dr--v~vl~~G~iv~ 234 (255) T PRK11300 222 DR--IYVVNQGTPLA 234 (255) T ss_pred CE--EEEEECCEEEE T ss_conf 99--99999999999 No 119 >PRK13543 cytochrome c biogenesis protein CcmA; Provisional Probab=98.68 E-value=1.6e-07 Score=68.38 Aligned_cols=75 Identities=20% Similarity=0.273 Sum_probs=61.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ...||+|+|||.++||+..+..+.+.+... +.=|++||||......+.+. T Consensus 136 ~~LSgGqkqRv~lA~al~---------~~p~illLDEPt~~LD~~~~~~l~~~l~~~~~~g~tvl~~tHd~~~~~~~adR 206 (214) T PRK13543 136 RQLSAGQRKRLALARLWL---------SPAPLWLLDEPYANLDLEGITLVNRMISAHLRGGGAALVTTHGAYAAPPVRTR 206 (214) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 348999999999999985---------79999998099888999999999999999986799999991998999986999 Q ss_pred EEEEEECCC Q ss_conf 007997289 Q gi|254780766|r 362 AKFMRISNH 370 (375) Q Consensus 362 ~~~~~i~~g 370 (375) ++.++.| T Consensus 207 --i~~L~~G 213 (214) T PRK13543 207 --MLTLEAA 213 (214) T ss_pred --EEEEECC T ss_conf --9998088 No 120 >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Probab=98.67 E-value=3.6e-06 Score=59.50 Aligned_cols=88 Identities=23% Similarity=0.286 Sum_probs=70.4 Q ss_pred EEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEE Q ss_conf 1100124551023312205899999999999999999870899789980122015989999999997417---9809998 Q gi|254780766|r 272 DLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMT 348 (375) Q Consensus 272 d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iT 348 (375) ++.+...+...++..+|.||.-++.||+.||-++++.... ..|.|.||||+.+||+.++..+++.|... +-||+|- T Consensus 801 ~~~~~~~~~~r~~~~LSGGE~~~~sLalrLALs~~~~~~~-~l~~l~LDEpf~~LD~e~l~~l~~~l~~i~~~~~qiiII 879 (908) T COG0419 801 VVVVYDGGEVRPIKTLSGGERFLASLALRLALSDLLQGRA-RLELLFLDEPFGTLDEERLEKLAEILEELLSDGRQIIII 879 (908) T ss_pred EEEEEECCCCEECCCCCCHHHHHHHHHHHHHHHHHHHCCC-CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEE T ss_conf 7999817872210204861899999999999999972488-888233428988789899999999999998459979999 Q ss_pred ECCHHHHHHHHC Q ss_conf 069678543212 Q gi|254780766|r 349 GTDKSVFDSLNE 360 (375) Q Consensus 349 t~~~~~~~~~~~ 360 (375) ||+..+-+.+.. T Consensus 880 SH~eel~e~~~~ 891 (908) T COG0419 880 SHVEELKERADV 891 (908) T ss_pred ECHHHHHHHHCC T ss_conf 566999985075 No 121 >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility. Probab=98.67 E-value=2.1e-07 Score=67.52 Aligned_cols=80 Identities=16% Similarity=0.215 Sum_probs=67.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||++.+.+|.-|+ ..++++++|||.+.|||..+..+.+.+.+. +.-|++|||+.+-.+.+.+. T Consensus 132 ~~LS~G~kqrl~la~aL~---------~~P~lliLDEPt~GLDp~~~~~~~~~l~~l~~~~TillssH~l~e~e~lcdr- 201 (301) T TIGR03522 132 GQLSKGYRQRVGLAQALI---------HDPKVLILDEPTTGLDPNQLVEIRNVIKNIGKDKTIILSTHIMQEVEAICDR- 201 (301) T ss_pred HHCCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCE- T ss_conf 677998844599889870---------7998999948866789899999999999875999999987858999986999- Q ss_pred EEEEECCCEEEEC Q ss_conf 0799728968959 Q gi|254780766|r 363 KFMRISNHQALCI 375 (375) Q Consensus 363 ~~~~i~~g~~~~~ 375 (375) +.-+++|+++|. T Consensus 202 -i~ii~~G~iv~~ 213 (301) T TIGR03522 202 -VIIINKGKIVAD 213 (301) T ss_pred -EEEEECCEEEEE T ss_conf -999989999997 No 122 >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in Probab=98.67 E-value=2.5e-07 Score=67.04 Aligned_cols=79 Identities=20% Similarity=0.212 Sum_probs=63.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCH-HHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696-78543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDK-SVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~-~~~~~~~~ 360 (375) ..+|.||++.+.+|.-|+ ..++|+|+|||.+.||+..+..+++.+.+. +.=+++|+|++ .....+.+ T Consensus 142 ~~LSGGqrqRv~iA~aL~---------~~P~illLDEPTsgLD~~~~~~i~~~l~~l~~~~~~vi~~~H~~~~~~~~~~D 212 (226) T cd03234 142 KGISGGERRRVSIAVQLL---------WDPKVLILDEPTSGLDSFTALNLVSTLSQLARRNRIVILTIHQPRSDLFRLFD 212 (226) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCC T ss_conf 328999999999999996---------59998999588656899999999999999997899999998889899999799 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|.. T Consensus 213 r--v~vl~~G~iv~ 224 (226) T cd03234 213 R--ILLLSSGEIVY 224 (226) T ss_pred E--EEEEECCEEEE T ss_conf 9--99995988998 No 123 >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=98.66 E-value=1.2e-07 Score=69.18 Aligned_cols=76 Identities=26% Similarity=0.357 Sum_probs=63.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+++|..|+ ..+.++++|||.+.||+..+..+++.|.+. +.=|+++||+.+....+.+. T Consensus 133 ~~LSGGqkQrv~iAral~---------~~P~ililDEPTsgLD~~~~~~i~~~l~~l~~~g~tii~itHdl~~~~~~~dr 203 (211) T cd03225 133 FTLSGGQKQRVAIAGVLA---------MDPDILLLDEPTAGLDPAGRRELLELLKKLKAEGKTIIIVTHDLDLLLELADR 203 (211) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 459998999999999997---------59999999798555899999999999999997899999992599999997999 Q ss_pred EEEEEECCCE Q ss_conf 0079972896 Q gi|254780766|r 362 AKFMRISNHQ 371 (375) Q Consensus 362 ~~~~~i~~g~ 371 (375) ++.+++|+ T Consensus 204 --i~~m~~G~ 211 (211) T cd03225 204 --VIVLEDGK 211 (211) T ss_pred --EEEEECCC T ss_conf --99982988 No 124 >PRK10908 cell division protein FtsE; Provisional Probab=98.66 E-value=2.2e-07 Score=67.38 Aligned_cols=77 Identities=21% Similarity=0.335 Sum_probs=64.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.|||+.+.+|-.|+ ..++|||+|||.+.||+..+..+++.+.+. +.-|+++|||......+.+. T Consensus 137 ~LSGGq~QRvaiAraL~---------~~P~iLllDEPt~~LD~~~~~~v~~~l~~l~~~g~tvl~vtHd~~~~~~~~dr- 206 (222) T PRK10908 137 QLSGGEQQRVGIARAVV---------NKPAVLLADEPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDIGLISRRSYR- 206 (222) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 68968999999999997---------69999999098766799999999999999986199999994799999986999- Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) ++-+++|+|- T Consensus 207 -i~vl~~Griv 216 (222) T PRK10908 207 -MLTLSDGHLH 216 (222) T ss_pred -EEEEECCEEE T ss_conf -9999799993 No 125 >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Probab=98.66 E-value=2.7e-07 Score=66.81 Aligned_cols=79 Identities=20% Similarity=0.272 Sum_probs=65.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||..+.+|..|+ ..+++||+|||.+.||+..+..+++.+.+. +.=++++||+.+....+.+ T Consensus 128 ~~LSGGq~QRv~iAraL~---------~~P~vLllDEPts~LD~~~~~~i~~ll~~l~~~~~~til~vtHdl~~~~~~ad 198 (233) T PRK10771 128 GELSGGQRQRVALARCLV---------REQPILLLDEPFSALDPALRQEMLTLVSQVCQQRQLTLLMVSHSVEDAARIAP 198 (233) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 559999999999999985---------59999999287755799999999999999998369899999248999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+|.+ T Consensus 199 r--i~vl~~G~Iv~ 210 (233) T PRK10771 199 R--SLVVADGRIAW 210 (233) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 126 >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.65 E-value=1.7e-07 Score=68.07 Aligned_cols=78 Identities=15% Similarity=0.233 Sum_probs=65.5 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||++.+++|-.|| ..+.++++|||.|.|||..+..+++.+.++ +.=|++.|||-+....+.+. T Consensus 150 ~LSGGqkqRVaiA~aLa---------~~P~iLilDEPTagLDp~~~~~i~~ll~~L~~~~g~Tvi~vtHdm~~v~~~aDr 220 (289) T PRK13645 150 ELSGGQKRRVALAGIIA---------MDGNTLVLDEPTGGLDPKGEEDFINLFERLNKEYKKRIIMVTHNMDQVLRIADE 220 (289) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 09999999999999996---------399999995887648989999999999999995699999991599999997999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+|++ T Consensus 221 --viVm~~G~iv~ 231 (289) T PRK13645 221 --VIVMHEGKVIS 231 (289) T ss_pred --EEEEECCEEEE T ss_conf --99998998999 No 127 >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet. Probab=98.65 E-value=2.5e-07 Score=67.03 Aligned_cols=77 Identities=17% Similarity=0.211 Sum_probs=63.4 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHH-HCCE Q ss_conf 2205899999999999999999870899789980122015989999999997417---98099980696785432-1260 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSL-NETA 362 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~-~~~~ 362 (375) +|.||++.+.+|..|+ ..+.++++|||.+.||+..+..+.+.+.+. +.-++++||+......+ .+. T Consensus 105 LSGGekqrv~iaral~---------~~P~lllLDEPtsgLD~~~~~~i~~~i~~l~~~g~tiiiitH~~~~~~~~~~Dr- 174 (200) T cd03217 105 FSGGEKKRNEILQLLL---------LEPDLAILDEPDSGLDIDALRLVAEVINKLREEGKSVLIITHYQRLLDYIKPDR- 174 (200) T ss_pred CCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHCCCE- T ss_conf 7999999999999996---------099999996962269999999999999999857999999996368776646999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+.+|+|++ T Consensus 175 -v~vl~~Gkiv~ 185 (200) T cd03217 175 -VHVLYDGRIVK 185 (200) T ss_pred -EEEEECCEEEE T ss_conf -99987999999 No 128 >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF. Probab=98.65 E-value=1.3e-07 Score=68.92 Aligned_cols=79 Identities=15% Similarity=0.217 Sum_probs=66.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCC----CEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741798----09998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS----QIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~----Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+.-+++|..|+ ..++|||+|||.+.||+..+..+++.|.+... =+++.||+.+....+.+ T Consensus 144 ~~LSGGq~QRv~iAraL~---------~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~~~~~tii~vtHd~~~~~~~aD 214 (228) T cd03257 144 HELSGGQRQRVAIARALA---------LNPKLLIADEPTSALDVSVQAQILDLLKKLQEELGLTLLFITHDLGVVAKIAD 214 (228) T ss_pred CCCCHHHHHHHHHHHHCC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 327988999999821104---------79999999488764799999999999999998509899998689999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|+. T Consensus 215 r--v~vm~~G~iv~ 226 (228) T cd03257 215 R--VAVMYAGKIVE 226 (228) T ss_pred E--EEEEECCEEEE T ss_conf 9--99997989998 No 129 >PRK13544 consensus Probab=98.65 E-value=1.4e-07 Score=68.65 Aligned_cols=80 Identities=15% Similarity=0.213 Sum_probs=62.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++|+|+|||+++||+..+..+++.+... +.=|++|||+.+..-.+.+. T Consensus 125 ~~LSgG~kqrv~la~aL~---------~~~~illLDEPt~gLD~~s~~~i~~~i~~~~~~g~~vIi~sHd~~e~~~~cd~ 195 (208) T PRK13544 125 KELSSGWKRRVALSRLLI---------YNTNVWIIDEPFANLDSATKELILELILTRLEQNGIVIISDHSKTETYGECQV 195 (208) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 357999999999999985---------69999999798666899999999999999986899999986999999976899 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) ..+-..++||.+ T Consensus 196 i~l~~~~~~~~~ 207 (208) T PRK13544 196 INLEPFNNKQTI 207 (208) T ss_pred EEECCCCCCCCC T ss_conf 980348998755 No 130 >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.64 E-value=2.8e-07 Score=66.69 Aligned_cols=78 Identities=19% Similarity=0.294 Sum_probs=64.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|-.|| ..++|+++|||.|.||+..+..+++.+.+. +.-|++.||+-+.. ...+ T Consensus 143 ~~LSGGqkQRvaiA~aLa---------~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~e~g~TvI~itHd~~~a-~~aD 212 (283) T PRK13640 143 ANLSGGQKQRVAIAGILA---------VEPQIIILDESTSMLDPAGKEQILKLIRKLMKDNNLTIISITHDIDEA-AGAD 212 (283) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHH-HHCC T ss_conf 229999999999999997---------199999976874548989999999999999970698999997887899-7099 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) +++-+++|+|++ T Consensus 213 --rv~vm~~G~iv~ 224 (283) T PRK13640 213 --QVLVLDDGKLLA 224 (283) T ss_pred --EEEEEECCEEEE T ss_conf --899999999999 No 131 >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.62 E-value=2.3e-07 Score=67.26 Aligned_cols=78 Identities=22% Similarity=0.296 Sum_probs=64.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|..|| ..++|||+|||.+.||+..+..+++.+.+. +.=+++.||+.+... +.+ T Consensus 136 ~~LSGGQrQRvaIA~aLa---------~~P~lLilDEPTs~LD~~~~~~i~~~l~~l~~~~g~Tvi~iTHdl~~v~-~aD 205 (276) T PRK13650 136 ARLSGGQKQRVAIAGAVA---------MRPKIIILDEATSMLDPEGRLELIKTIKNIRDDYQLTVISITHDLDEVA-LSD 205 (276) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHH-CCC T ss_conf 338999999999999997---------3999999838866589999999999999999842989999957789996-099 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) +++-+++|+|.+ T Consensus 206 --rvivm~~G~Iv~ 217 (276) T PRK13650 206 --RVLVMKDGQVES 217 (276) T ss_pred --EEEEEECCEEEE T ss_conf --999998999999 No 132 >PRK13633 cobalt transporter ATP-binding subunit; Provisional Probab=98.62 E-value=2.4e-07 Score=67.14 Aligned_cols=77 Identities=17% Similarity=0.230 Sum_probs=64.0 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||++.+++|-.|| ..+.|+++|||.|.||+..+..+++.+.+. +.-++++||+.+.... . T Consensus 145 ~LSGGqkQRvaiA~aLa---------~~P~iLilDEPTs~LDp~~~~~i~~~l~~l~~e~g~Tii~vTHdl~~~~~---a 212 (281) T PRK13633 145 LLSGGQKQRVAIAGILA---------MRPECIIFDEPTAMLDPSGRREVVNTIKELNKKYGITIILITHYMEEAVE---A 212 (281) T ss_pred HCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHC---C T ss_conf 08985999999999998---------59999998187343898999999999999998409899998678899973---9 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) .+++-+.+|+|++ T Consensus 213 Drv~vm~~G~Iv~ 225 (281) T PRK13633 213 DRIIVMDKGKVVM 225 (281) T ss_pred CEEEEEECCEEEE T ss_conf 9899998999999 No 133 >PRK10636 putative ABC transporter ATP-binding protein; Provisional Probab=98.62 E-value=3.1e-07 Score=66.43 Aligned_cols=81 Identities=22% Similarity=0.332 Sum_probs=69.2 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCE Q ss_conf 23312205899999999999999999870899789980122015989999999997417980999806967854321260 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ++..+|-||+.-++||..|+ ..+.+|++|||..|||..-+..+-+.|.+...=+++.+||...++.+.+. T Consensus 427 ~v~~LSGGEk~Rl~LA~~l~---------~~pnlLiLDEPTNhLDi~s~e~Le~aL~~y~Gtvl~VSHDr~fl~~~~~~- 496 (638) T PRK10636 427 ETRRFSGGEKARLVLALIVW---------QRPNLLLLDEPTNHLDLDMRQALTEALIDFEGALVVVSHDRHLLRSTTDD- 496 (638) T ss_pred CCCCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE- T ss_conf 11339999999999999982---------59988998588766888999999999984898399997899999975278- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +|.+++|++.. T Consensus 497 -~~~~~~g~~~~ 507 (638) T PRK10636 497 -LYLVHDRKVEP 507 (638) T ss_pred -EEEEECCEEEE T ss_conf -99996997899 No 134 >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Probab=98.62 E-value=2e-07 Score=67.73 Aligned_cols=79 Identities=25% Similarity=0.391 Sum_probs=66.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC----CCEEEEECCHHHHHHHHC Q ss_conf 3122058999999999999999998708997899801220159899999999974179----809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG----SQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~----~Qv~iTt~~~~~~~~~~~ 360 (375) .-+|-||+-.+.+|..||| +.||+|+|||.++||..+|-.+++.+.+.. .=++++.||.+.-.-+.+ T Consensus 137 ~~LSGGerQrv~iAraLaQ---------~~~iLLLDEPTs~LDi~~Q~evl~ll~~l~~~~g~tvv~vlHDln~A~ryad 207 (258) T COG1120 137 DELSGGERQRVLIARALAQ---------ETPILLLDEPTSHLDIAHQIEVLELLRDLNREKGLTVVMVLHDLNLAARYAD 207 (258) T ss_pred CCCCHHHHHHHHHHHHHHC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 1168668899999999845---------8997882797200387779999999999998559789999559889997478 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|++.+ T Consensus 208 ~--~i~l~~G~i~a 219 (258) T COG1120 208 H--LILLKDGKIVA 219 (258) T ss_pred E--EEEEECCEEEE T ss_conf 8--99997993786 No 135 >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Probab=98.61 E-value=3.9e-07 Score=65.75 Aligned_cols=78 Identities=18% Similarity=0.185 Sum_probs=64.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC--CCEEEEECCHHHHHHHHCCEE Q ss_conf 122058999999999999999998708997899801220159899999999974179--809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG--SQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~--~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|-|||.-+++|-.|+ ..+.|||+|||.|.||+..+..+++.+.+.+ .-+++.||+......+.+. T Consensus 141 ~LSGGq~QRvaIArAL~---------~~P~iLllDEPTs~LD~~~~~~i~~li~~l~~~~Tii~vTHdl~~a~~~aDr-- 209 (227) T cd03260 141 GLSGGQQQRLCLARALA---------NEPEVLLLDEPTSALDPISTAKIEELIAELKKEYTIVIVTHNMQQAARVADR-- 209 (227) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCE-- T ss_conf 28999999999999983---------5999999689876579899999999999996688899993699999986999-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.+ T Consensus 210 i~vl~~G~ive 220 (227) T cd03260 210 TAFLLNGRLVE 220 (227) T ss_pred EEEEECCEEEE T ss_conf 99998989999 No 136 >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=98.61 E-value=3.3e-07 Score=66.26 Aligned_cols=79 Identities=25% Similarity=0.286 Sum_probs=64.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+..+.+|..||+ .++|+|+|||.++||+..+..+++.|.+. +.=+++++||.+....+.+ T Consensus 114 ~~LSGGqkQRv~iA~aL~~---------~p~ilLLDEPts~LD~~~~~~i~~~i~~l~~~~~~Tvi~VtHDl~~a~~~aD 184 (246) T cd03237 114 PELSGGELQRVAIAACLSK---------DADIYLLDEPSAYLDVEQRLMASKVIRRFAENNEKTAFVVEHDIIMIDYLAD 184 (246) T ss_pred HHCCHHHHHHHHHHHHHHC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 0289859999999999841---------9999998489876899999999999999998679899998378999998699 Q ss_pred CEEEEEEC-CCEEEE Q ss_conf 60079972-896895 Q gi|254780766|r 361 TAKFMRIS-NHQALC 374 (375) Q Consensus 361 ~~~~~~i~-~g~~~~ 374 (375) . ++-++ .|.+.| T Consensus 185 r--Iivl~G~g~i~~ 197 (246) T cd03237 185 R--LIVFEGEPSVNG 197 (246) T ss_pred E--EEEECCCCEEEE T ss_conf 9--999818864999 No 137 >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus. Probab=98.61 E-value=4.2e-07 Score=65.59 Aligned_cols=77 Identities=22% Similarity=0.305 Sum_probs=62.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCH-HHHHHHHCCE Q ss_conf 2205899999999999999999870899789980122015989999999997417---98099980696-7854321260 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDK-SVFDSLNETA 362 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~-~~~~~~~~~~ 362 (375) +|.||++.+.+|..|+ ..++|+|+|||.+.||+..+..+++.|.+. +.=++++||+. +....+.+. T Consensus 112 LSgGqrqRv~iA~aL~---------~~P~illlDEPTsgLD~~~~~~i~~~l~~l~~~g~tvi~~tH~~~~~~~~~~Dr- 181 (194) T cd03213 112 LSGGERKRVSIALELV---------SNPSLLFLDEPTSGLDSSSALQVMSLLRRLADTGRTIICSIHQPSSEIFELFDK- 181 (194) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCCE- T ss_conf 8889999999999996---------399889994898788989999999999999968989999958885999997999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+++|+++. T Consensus 182 -v~vl~~G~iv~ 192 (194) T cd03213 182 -LLLLSQGRVIY 192 (194) T ss_pred -EEEEECCEEEE T ss_conf -99998988998 No 138 >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.61 E-value=2.7e-07 Score=66.82 Aligned_cols=77 Identities=22% Similarity=0.270 Sum_probs=62.5 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||++.+++|-.|+ ..++|+|+|||.+.||+..+..+++.|.+. +.=|++.||+.+.... . T Consensus 142 ~LSGGqkQRvaiAraL~---------~~P~iLilDEPTs~LD~~~~~~i~~ll~~L~~~~~~TvI~itHdl~~a~~-a-- 209 (269) T PRK13648 142 ALSGGQKQRVAIASVLA---------LNPSVIILDEATSMLDPDARQNLLDLVRKVKSEHNITIISITHDLSEAME-A-- 209 (269) T ss_pred CCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHH-C-- T ss_conf 38999999999999997---------59899998187554899999999999999997379899999767899971-9-- Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) -+++-+.+|+|.+ T Consensus 210 Drvivl~~G~Iv~ 222 (269) T PRK13648 210 DHVIVMNKGTVYK 222 (269) T ss_pred CEEEEEECCEEEE T ss_conf 9899998999999 No 139 >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.61 E-value=4.1e-07 Score=65.63 Aligned_cols=78 Identities=19% Similarity=0.276 Sum_probs=65.1 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.||++.+++|-.|| ..+.|+++|||.|.|||..+..+++.+.+. +.=+++.|||-+....+.+. T Consensus 176 ~LSGGqkQRVaIA~aLa---------~~P~iLilDEPTagLDp~~~~~i~~li~~l~~~g~TiilvTHdm~~v~~~aDr- 245 (320) T PRK13631 176 GLSGGQKRRVAIAGILA---------IQPEILIFDEPTAGLDPKGEHEMMQLILDAKANNKTVFVITHTMEHVLEVADE- 245 (320) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 09999999999999972---------39999997587555998999999999999996299999994789999997999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+.+|+|+. T Consensus 246 -viVm~~GkIv~ 256 (320) T PRK13631 246 -VIVMDKGKILK 256 (320) T ss_pred -EEEEECCEEEE T ss_conf -99998988999 No 140 >TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly . The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen . This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport. Probab=98.60 E-value=4.5e-06 Score=58.85 Aligned_cols=76 Identities=16% Similarity=0.233 Sum_probs=57.5 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCC-----EEEEECCHHHHHHHHCCE Q ss_conf 205899999999999999999870899789980122015989999999997417980-----999806967854321260 Q gi|254780766|r 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQ-----IFMTGTDKSVFDSLNETA 362 (375) Q Consensus 288 S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Q-----v~iTt~~~~~~~~~~~~~ 362 (375) |-||+|-.=+ |.|+-+ ++-+.+|||+.|.||-.-.+-+.+-+.+...| ++|=||...+++.+.=+. T Consensus 149 SGGEKKrnEI-LQm~~L--------~P~laiLDE~DSGLDiDALk~V~~~in~lr~~~P~~~~liiTHY~rlL~~I~PD~ 219 (248) T TIGR01978 149 SGGEKKRNEI-LQMALL--------EPKLAILDEIDSGLDIDALKIVAEGINRLREEHPDRAFLIITHYQRLLNYIKPDV 219 (248) T ss_pred CCCCCHHHHH-HHHHHC--------CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECHHHHHHHCCCCE T ss_conf 3871157689-988751--------9957986068887637888999999998730689800899875178841318988 Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) +.-+=+|+|. T Consensus 220 -VhVl~~GrIV 229 (248) T TIGR01978 220 -VHVLVDGRIV 229 (248) T ss_pred -EEEEECCEEE T ss_conf -9997467587 No 141 >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.59 E-value=3.9e-07 Score=65.77 Aligned_cols=80 Identities=23% Similarity=0.250 Sum_probs=66.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||+-+.+|.-|+ ..++|+|+|||.+.||+..++.+.+.+.+. +.=++++|||.+....+.+ T Consensus 129 ~~LSGG~kQrv~iAraL~---------~~P~illlDEPt~gLD~~~~~~i~~li~~l~~~~g~tii~vtHdl~~~~~~~d 199 (213) T cd03259 129 HELSGGQQQRVALARALA---------REPSLLLLDEPLSALDAKLREELREELKELQRELGITTIYVTHDQEEALALAD 199 (213) T ss_pred CCCCHHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 338989999999987622---------79999998398643799999999999999999629999999689999999699 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) . ++-+.+|+|++. T Consensus 200 r--i~vm~~Gkiv~~ 212 (213) T cd03259 200 R--IAVMNEGRIVQV 212 (213) T ss_pred E--EEEEECCEEEEE T ss_conf 9--999989999987 No 142 >PRK10744 phosphate transporter subunit; Provisional Probab=98.59 E-value=4.7e-07 Score=65.25 Aligned_cols=78 Identities=15% Similarity=0.132 Sum_probs=64.6 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.|||..+.+|..|+ ..+.|||+|||.|.||+..+..+++.+.+. +.-+++.||+-.....+.+. T Consensus 153 ~LSGGqkQRvaiArAL~---------~~P~vLllDEPts~LD~~~~~~i~~ll~~l~~~~Tvi~itHdl~~a~~~~Dr-- 221 (257) T PRK10744 153 SLSGGQQQRLCIARGIA---------IRPEVLLLDEPCSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDH-- 221 (257) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEEECHHHHHHHCCE-- T ss_conf 58988989999987775---------1999888778855369999999999999997199699996199999986999-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+.+|+|+. T Consensus 222 i~vm~~G~Iv~ 232 (257) T PRK10744 222 TAFMYLGELIE 232 (257) T ss_pred EEEEECCEEEE T ss_conf 99997999999 No 143 >PRK11147 ABC transporter ATPase component; Reviewed Probab=98.59 E-value=3.9e-07 Score=65.80 Aligned_cols=81 Identities=17% Similarity=0.230 Sum_probs=66.8 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCE Q ss_conf 23312205899999999999999999870899789980122015989999999997417980999806967854321260 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ++..+|-||+.-++||..|+ ..+.+|++|||.+|||..-++.+-+.|.+.+.-+++.+||...++.+.+. T Consensus 437 ~v~~LSGGEk~Rl~LA~~l~---------~~pnlLiLDEPTNhLDi~s~e~Le~aL~~y~Gtvl~VSHDr~fl~~~~~~- 506 (632) T PRK11147 437 PVKALSGGERNRLLLARLFL---------KPSNLLILDEPTNDLDVETLELLEELLDSYQGTLLLVSHDRQFVDNTVTE- 506 (632) T ss_pred CCCCCCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE- T ss_conf 15539999999999999857---------79978999898765799999999999985898399997989999853456- Q ss_pred EEEEEC-CCEEEE Q ss_conf 079972-896895 Q gi|254780766|r 363 KFMRIS-NHQALC 374 (375) Q Consensus 363 ~~~~i~-~g~~~~ 374 (375) +|.++ +|.+.. T Consensus 507 -~~~~~~~g~~~~ 518 (632) T PRK11147 507 -CWIFEGNGKIGE 518 (632) T ss_pred -EEEEECCCEEEE T ss_conf -999956981798 No 144 >PRK10418 nikD nickel transporter ATP-binding protein; Provisional Probab=98.58 E-value=3.5e-07 Score=66.05 Aligned_cols=79 Identities=18% Similarity=0.266 Sum_probs=66.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+..+++|..|| .++++|++|||.+.||+..+..+++.|.+. +.=+++.|||-.....+.+ T Consensus 139 ~qLSGGq~QRvaiArAL~---------~~P~lLilDEPTs~LD~~~~~~il~ll~~l~~~~g~tii~vTHDl~~a~~~aD 209 (254) T PRK10418 139 FEMSGGMLQRMMIALALL---------CEAPFIIADEPTTDLDVVAQARILDLLESIVQKRALGMLLVTHDMGVVARLAD 209 (254) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC T ss_conf 634879999999999985---------49998985587543799999999999999999709979999699999999689 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+|+. T Consensus 210 r--i~Vm~~G~Ive 221 (254) T PRK10418 210 D--VAVMSHGRIVE 221 (254) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998988999 No 145 >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Probab=98.58 E-value=4.5e-07 Score=65.37 Aligned_cols=80 Identities=15% Similarity=0.318 Sum_probs=66.1 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC----CCEEEEECCHHHHHHHH Q ss_conf 33122058999999999999999998708997899801220159899999999974179----80999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG----SQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~----~Qv~iTt~~~~~~~~~~ 359 (375) ...+|.||++-+.++.-|+ ..+.++++|||.+.|||..+..+.+.|.+.. .=|++|||.......+. T Consensus 134 ~~~lS~G~kqrl~ia~aL~---------~~P~lliLDEPt~GLDp~~~~~~~~~l~~l~~~g~~tvlissH~l~e~~~~~ 204 (293) T COG1131 134 VRTLSGGMKQRLSIALALL---------HDPELLILDEPTSGLDPESRREIWELLRELAKEGGVTILLSTHILEEAEELC 204 (293) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHC T ss_conf 0237988999999999996---------6999999969977879999999999999999679959999838869999868 Q ss_pred CCEEEEEECCCEEEE Q ss_conf 260079972896895 Q gi|254780766|r 360 ETAKFMRISNHQALC 374 (375) Q Consensus 360 ~~~~~~~i~~g~~~~ 374 (375) + .+.-+++|++++ T Consensus 205 d--~v~il~~G~~~~ 217 (293) T COG1131 205 D--RVIILNDGKIIA 217 (293) T ss_pred C--EEEEEECCEEEE T ss_conf 9--999998998999 No 146 >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Probab=98.58 E-value=6.1e-07 Score=64.51 Aligned_cols=78 Identities=17% Similarity=0.353 Sum_probs=64.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+..+++|-.|+ ..++|+|+|||.+.||+..+..+++.|.+. +.=++++|||.+....+ + T Consensus 144 ~~LSGGqkQRvaiAraL~---------~~P~illlDEPTs~LD~~~~~~i~~~l~~l~~~~g~tvi~vtHdl~~a~~~-~ 213 (233) T PRK11629 144 SELSGGERQRVAIARALV---------NNPRLVLADEPTGNLDARNADSIFQLLGELNRLQGTAFLVVTHDLQLAKRM-S 213 (233) T ss_pred CEECHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHH-C T ss_conf 663899999999999996---------599999992888879999999999999999997098999986899999960-9 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) .++.+.+|+|.+ T Consensus 214 --r~i~m~dG~iv~ 225 (233) T PRK11629 214 --RQLEMRDGRLTA 225 (233) T ss_pred --CEEEEECCEEEE T ss_conf --899997999999 No 147 >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=98.58 E-value=6.6e-07 Score=64.27 Aligned_cols=80 Identities=16% Similarity=0.282 Sum_probs=66.5 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCC Q ss_conf 3312205899999999999999999870899789980122015989999999997417--98099980696785432126 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~ 361 (375) ...+|.|||+.+.++..|+ ..+.++|+|||.+.||+..+..+++.+.+. +.-|++++|+.+....+.+. T Consensus 141 ~~~LSgGqkqrv~iA~aL~---------~~P~lllLDEPt~gLD~~~~~~i~~ll~~l~~~~tvi~isHdl~~~~~~~dr 211 (242) T TIGR03411 141 AGLLSHGQKQWLEIGMLLM---------QDPKLLLLDEPVAGMTDEETEKTAELLKSLAGKHSVVVVEHDMEFVRSIADK 211 (242) T ss_pred HHHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 3459978999999999997---------3899899918643699899999999999985799799997859999997999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+++| T Consensus 212 --v~vl~~G~iv~ 222 (242) T TIGR03411 212 --VTVLHQGSVLA 222 (242) T ss_pred --EEEEECCEEEE T ss_conf --99997999999 No 148 >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.57 E-value=5.3e-07 Score=64.91 Aligned_cols=78 Identities=17% Similarity=0.207 Sum_probs=61.7 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCH-HHHHHHHC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696-78543212 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDK-SVFDSLNE 360 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~-~~~~~~~~ 360 (375) .+|.||++.+.+|..|+ ..++|+|+|||.+.||+..+..+++.|.+. +.-+++|+|+. +....+.+ T Consensus 118 ~LSgGqkqRv~iA~aL~---------~~P~illlDEPt~gLD~~~~~~i~~~l~~l~~~~~~t~ii~~~~~~~~~~~~~D 188 (202) T cd03233 118 GISGGERKRVSIAEALV---------SRASVLCWDNSTRGLDSSTALEILKCIRTMADVLKTTTFVSLYQASDEIYDLFD 188 (202) T ss_pred CCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHCC T ss_conf 58999999999999995---------299889983876568999999999999999987799899999069899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+++. T Consensus 189 r--i~vl~~G~iv~ 200 (202) T cd03233 189 K--VLVLYEGRQIY 200 (202) T ss_pred E--EEEEECCEEEE T ss_conf 9--99995986998 No 149 >PRK11701 phnK phosphonates transport ATP-binding protein; Provisional Probab=98.57 E-value=6.1e-07 Score=64.51 Aligned_cols=79 Identities=16% Similarity=0.249 Sum_probs=66.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||+.+.+|..|+ ..+.++|+|||.+.||+..+..+++.|.+. +.=++++|||.+....+.+ T Consensus 150 ~~LSGG~~QRv~iAraL~---------~~P~llllDEPtsgLD~~~~~~i~~~l~~l~~~~g~til~vtHdl~~~~~laD 220 (258) T PRK11701 150 TTFSGGMQQRLQIARNLV---------THPRLVFMDEPTGGLDVSVQARLLDLLRGLVVELGLAVVIVTHDLAVARLLAH 220 (258) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 214789999999999986---------49999998598656899999999999999999609899999378899999799 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 221 r--i~vl~~G~iv~ 232 (258) T PRK11701 221 R--LLVMKQGRVVE 232 (258) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998988999 No 150 >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=98.57 E-value=2.7e-07 Score=66.80 Aligned_cols=76 Identities=18% Similarity=0.370 Sum_probs=62.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ++|.||++.+.+|..|+ ..++++++|||.+.||+..+..+++.+.+. +.=|+++||+.+....+.+. T Consensus 104 ~LSGG~~Qrv~lAral~---------~~p~llllDEPT~gLD~~~~~~i~~~i~~l~~~g~tvi~isHdl~~~~~~~Dr- 173 (182) T cd03215 104 LLSGGNQQKVVLARWLA---------RDPRVLILDEPTRGVDVGAKAEIYRLIRELADAGKAVLLISSELDELLGLCDR- 173 (182) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE- T ss_conf 79989999999999997---------19999998687545899999999999999997899999996879999997999- Q ss_pred EEEEECCCEE Q ss_conf 0799728968 Q gi|254780766|r 363 KFMRISNHQA 372 (375) Q Consensus 363 ~~~~i~~g~~ 372 (375) ++-+++|+| T Consensus 174 -v~vl~~G~i 182 (182) T cd03215 174 -ILVMYEGRI 182 (182) T ss_pred -EEEECCCCC T ss_conf -999839999 No 151 >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=98.57 E-value=5e-07 Score=65.08 Aligned_cols=83 Identities=23% Similarity=0.246 Sum_probs=66.8 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.||++.+.+|..|+ ..++|+|+|||.++||+..+..+++.|.+. +.-|+++|||-.....+.| T Consensus 137 ~~~LSGGq~QRvaIAraL~---------~~P~iLlLDEPTs~LD~~~~~~v~~li~~L~~~G~Tvi~vtHDl~~~~~laD 207 (255) T cd03236 137 IDQLSGGELQRVAIAAALA---------RDADFYFFDEPSSYLDIKQRLNAARLIRELAEDDNYVLVVEHDLAVLDYLSD 207 (255) T ss_pred HHHCCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 5558999999999999736---------8999999979876589999999999999999789999999078999998699 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) ..-+.+=+.|.+-|+ T Consensus 208 rI~Vm~G~~~~~~~~ 222 (255) T cd03236 208 YIHCLYGEPGAYGVV 222 (255) T ss_pred EEEEEECCCCEEEEE T ss_conf 899981898038875 No 152 >PRK13538 cytochrome c biogenesis protein CcmA; Provisional Probab=98.56 E-value=3.5e-07 Score=66.10 Aligned_cols=74 Identities=19% Similarity=0.270 Sum_probs=57.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+.+|..|+ ..++++|+|||.++||+..+..+.+.|.+. +.=|+++||+ .+..+.+. T Consensus 128 ~~LSgGqkqRv~lAral~---------~~p~lllLDEPt~~LD~~~~~~l~~~l~~~~~~g~~vi~~tH~--dl~~~ad~ 196 (204) T PRK13538 128 RQLSAGQQRRVALARLWL---------TRAPLWILDEPFTAIDKQGVARLEQLLAQHAEQGGMVILTTHQ--DLPGASDK 196 (204) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECH--HHHHHCCE T ss_conf 248999999999999996---------0999899978865789999999999999998589989999866--98987699 Q ss_pred EEEEEECCCE Q ss_conf 0079972896 Q gi|254780766|r 362 AKFMRISNHQ 371 (375) Q Consensus 362 ~~~~~i~~g~ 371 (375) ++.+..|| T Consensus 197 --v~vl~~Gq 204 (204) T PRK13538 197 --VRKLRLGQ 204 (204) T ss_pred --EEEECCCC T ss_conf --99973979 No 153 >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.56 E-value=7.3e-07 Score=64.02 Aligned_cols=79 Identities=22% Similarity=0.197 Sum_probs=65.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||+-+++|-.|+ ..+.|+|+|||.+.|||..+..+++.+.++ +.=++++|||-.....+.+ T Consensus 135 ~~LSGGq~QRvaIARALv---------~~P~illlDEPts~LDp~~~~~i~~li~~l~~~~g~T~i~vTHd~~~a~~~~D 205 (235) T cd03261 135 AELSGGMKKRVALARALA---------LDPELLLYDEPTAGLDPIASGVIDDLIRSLKKELGLTSIMVTHDLDTAFAIAD 205 (235) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 106999999999999985---------48998998088664798999999999999999729999998989899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 206 r--i~vm~~G~iv~ 217 (235) T cd03261 206 R--IAVLYDGKIVA 217 (235) T ss_pred E--EEEEECCEEEE T ss_conf 8--99998999999 No 154 >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Probab=98.55 E-value=4.5e-07 Score=65.40 Aligned_cols=77 Identities=22% Similarity=0.326 Sum_probs=63.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||+.+.+|-.|+ ..++++|+|||.+.||+..+..+++.|.+. +.=+++.|||...... . T Consensus 145 ~~LSGGq~QRv~iAraL~---------~~P~llllDEPT~~LD~~~~~~i~~~l~~l~~~~g~tii~vtHd~~~~~~-~- 213 (228) T PRK10584 145 AQLSGGEQQRVALARAFN---------GRPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLILVTHDLQLAAR-C- 213 (228) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH-C- T ss_conf 889979999999999987---------59999998499767899999999999999999729899998866999985-8- Q ss_pred CEEEEEECCCEEE Q ss_conf 6007997289689 Q gi|254780766|r 361 TAKFMRISNHQAL 373 (375) Q Consensus 361 ~~~~~~i~~g~~~ 373 (375) ..++.+.+|+|. T Consensus 214 -drvi~l~~G~Iv 225 (228) T PRK10584 214 -DRRLRLVNGQLQ 225 (228) T ss_pred -CCEEEEECCEEE T ss_conf -979999899999 No 155 >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). Probab=98.55 E-value=8.3e-07 Score=63.64 Aligned_cols=80 Identities=23% Similarity=0.341 Sum_probs=66.7 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.|||+.+.+|-.|+ ..+.++++|||.+.||+..+..+++.|.+. +.=|+++||+.+....+.+ T Consensus 141 ~~~LSGG~~Qrv~iAral~---------~~P~lliLDEPT~gLD~~~~~~i~~~l~~l~~~G~tii~vsHdl~~~~~~~D 211 (236) T cd03219 141 AGELSYGQQRRLEIARALA---------TDPKLLLLDEPAAGLNPEETEELAELIRELRERGITVLLVEHDMDVVMSLAD 211 (236) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 2669999999999999996---------5999999948765899999999999999999659999999174899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++.+ T Consensus 212 r--v~vm~~G~iv~ 223 (236) T cd03219 212 R--VTVLDQGRVIA 223 (236) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 156 >PRK11819 putative ABC transporter ATP-binding protein; Reviewed Probab=98.55 E-value=7.8e-07 Score=63.82 Aligned_cols=81 Identities=19% Similarity=0.227 Sum_probs=68.7 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCE Q ss_conf 23312205899999999999999999870899789980122015989999999997417980999806967854321260 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~ 362 (375) +...+|-||+.-++||..|+ ..+.+|++|||.+|||..-++.|-+.|.+.+.=+++-+||...++.+.+. T Consensus 442 ~v~~LSGGek~Rv~lA~~l~---------~~p~lLiLDEPTn~LDi~s~e~Le~aL~~y~Gtvl~VSHDr~fi~~va~~- 511 (556) T PRK11819 442 KVGVLSGGERNRLHLAKTLK---------SGGNVLLLDEPTNDLDVETLRALEDALLEFPGCAVVISHDRWFLDRIATH- 511 (556) T ss_pred CCCCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE- T ss_conf 70318899999999999996---------29898999297756799999999999987799699997899999986888- Q ss_pred EEEEEC-CCEEEE Q ss_conf 079972-896895 Q gi|254780766|r 363 KFMRIS-NHQALC 374 (375) Q Consensus 363 ~~~~i~-~g~~~~ 374 (375) +|.++ +|.+-. T Consensus 512 -i~~~~~~g~v~~ 523 (556) T PRK11819 512 -ILAFEGDSKVEW 523 (556) T ss_pred -EEEEECCCEEEE T ss_conf -999988987999 No 157 >PRK11124 artP arginine transporter ATP-binding subunit; Provisional Probab=98.54 E-value=6.5e-07 Score=64.35 Aligned_cols=79 Identities=22% Similarity=0.267 Sum_probs=64.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||..+++|-.|+ ..++|||+|||.+.|||..+..+++.|.+. +.=+++.||+.+....+.+. T Consensus 140 ~~LSGGq~QRvaiAraL~---------~~P~iLllDEPTs~LD~~~~~~i~~ll~~l~~~g~tii~vtHdl~~~~~~adr 210 (242) T PRK11124 140 LHLSGGQQQRVAIARALM---------MEPQVLLFDEPTAALDPEITAQIVSIIRELAETGITQVIVTHEVEVARKTASR 210 (242) T ss_pred HHCCHHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 227999989999876433---------79979997688654899999999999999984299899988899999996999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+++|+|+. T Consensus 211 --i~vl~~G~iv~ 221 (242) T PRK11124 211 --VVYMENGHIVE 221 (242) T ss_pred --EEEEECCEEEE T ss_conf --99997989999 No 158 >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Probab=98.54 E-value=5.9e-07 Score=64.62 Aligned_cols=78 Identities=21% Similarity=0.280 Sum_probs=65.7 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.|||..+++|-.|+ ..+.++|+|||.+.||+..+..+++.+.+. +.=+++.|||.+....+.+. T Consensus 152 ~LSGGq~QRv~IAraL~---------~~P~lLllDEPts~LD~~~~~~i~~ll~~l~~~g~tii~vtHdl~~~~~~adr- 221 (257) T PRK10619 152 HLSGGQQQRVSIARALA---------MEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH- 221 (257) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 58999999999999986---------39989997688665898999999999999997599999994899999986999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +.-+.+|+|.+ T Consensus 222 -i~vl~~G~iv~ 232 (257) T PRK10619 222 -VIFLHQGKIEE 232 (257) T ss_pred -EEEEECCEEEE T ss_conf -99998999999 No 159 >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.54 E-value=8.4e-07 Score=63.61 Aligned_cols=78 Identities=17% Similarity=0.260 Sum_probs=62.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||++.+++|-.|| ..+.|+++|||.|.||+..+..+++.+.++ +.=|++.||+-+.+.. . T Consensus 135 ~~LSGGqkQRvaiA~aLa---------~~P~iLiLDEPTs~LD~~~~~~i~~~l~~L~~~g~TvI~itHdl~~~~~---a 202 (274) T PRK13644 135 KTLSGGQGQCVALAGILT---------MEPECLIFDEVTSMLDPDSGIAVLERIKKLHEKGKTIVYITHNLEELHD---A 202 (274) T ss_pred CCCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHC---C T ss_conf 109976999999999998---------2999999979866789999999999999998689999998337899971---9 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) -.++-+.+|+|++ T Consensus 203 Drvivl~~G~Iv~ 215 (274) T PRK13644 203 DRIIVMDRGKIVL 215 (274) T ss_pred CEEEEEECCEEEE T ss_conf 9899998999999 No 160 >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.54 E-value=5.9e-07 Score=64.61 Aligned_cols=78 Identities=22% Similarity=0.302 Sum_probs=63.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|..|| ..+.|+++|||.+.||+..+..+++.+.++ +.=+++.|||.+.... . T Consensus 139 ~~LSGGqrQRvaIA~aLa---------~~P~ililDEPTs~LD~~~~~~i~~ll~~L~~~~~~Tii~iTHdl~~~~~-a- 207 (277) T PRK13642 139 ARLSGGQKQRVAVAGIIA---------LRPEIIILDESTSMLDPTGRSEIMRVIHEIKDKYHLTVLSITHDLDEAAS-S- 207 (277) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHH-C- T ss_conf 228999999999999996---------69999999588765898999999999999998169899999458899971-9- Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) -+++-+.+|+|.. T Consensus 208 -Drv~vm~~G~Iv~ 220 (277) T PRK13642 208 -DRILVMRAGEIIK 220 (277) T ss_pred -CEEEEEECCEEEE T ss_conf -9899998999999 No 161 >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.54 E-value=8.4e-07 Score=63.61 Aligned_cols=78 Identities=22% Similarity=0.290 Sum_probs=63.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||++.+++|-.|| ..++|+++|||.|.||+..+..+++.|.+. +.-+++.||+-+... . T Consensus 142 ~~LSGGqkQRvaiA~aLa---------~~P~iliLDEPTs~LD~~~~~~l~~~l~~l~~~~g~TvI~iTHd~~~~~-~-- 209 (273) T PRK13632 142 QNLSGGQKQRVAIASVLA---------LNPEIIIFDESTSMLDPKGKREIKKIMVDLRKDRKKTLISITHDMDEAI-L-- 209 (273) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHH-C-- T ss_conf 009999999999999997---------1999999807755699899999999999999846989999942888997-1-- Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) .-.++-+++|+|++ T Consensus 210 aDrv~vm~~G~iv~ 223 (273) T PRK13632 210 ADKVIVFSNGKLIA 223 (273) T ss_pred CCEEEEEECCEEEE T ss_conf 99999998999999 No 162 >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Probab=98.53 E-value=6.8e-07 Score=64.21 Aligned_cols=78 Identities=15% Similarity=0.223 Sum_probs=64.7 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.||+..+.+|-.|+ ..+.|+|+|||.+.||+..+..+++.|.+. +.=+++.||+......+.+. T Consensus 142 ~LSGGq~QRvaiAraL~---------~~P~iLllDEPTs~LD~~~~~~i~~~l~~l~~~g~tii~vtHdl~~~~~~adr- 211 (248) T PRK11264 142 RLSGGQQQRVAIARALA---------MRPEVILFDEPTSALDPELVGEVLNTIRQLAQEKRTMVIVTHEMSFARDVADR- 211 (248) T ss_pred CCCHHHHHHHHHHHHCC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHCCE- T ss_conf 08999988999876314---------79999998798765899999999999999997699289998999999996998- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+.+|+|.. T Consensus 212 -v~vm~~G~Iv~ 222 (248) T PRK11264 212 -AIFMDQGRIVE 222 (248) T ss_pred -EEEEECCEEEE T ss_conf -99998989999 No 163 >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.53 E-value=8.9e-07 Score=63.42 Aligned_cols=79 Identities=25% Similarity=0.238 Sum_probs=64.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+.-+++|--|+ ..++++|+|||.+.||+..+..+++.|.+. +.=++++||+......+.+ T Consensus 130 ~~LSGGqkQRvaiARaL~---------~~P~llllDEPts~LD~~~~~~i~~~l~~l~~~~g~tii~vTHdl~~a~~laD 200 (220) T cd03293 130 HQLSGGMRQRVALARALA---------VDPDVLLLDEPFSALDALTREQLQEELLDIWRETGKTVLLVTHDIDEAVFLAD 200 (220) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 129999999999999986---------69999998088765699999999999999998519999998888999999699 Q ss_pred CEEEEEECC--CEEEE Q ss_conf 600799728--96895 Q gi|254780766|r 361 TAKFMRISN--HQALC 374 (375) Q Consensus 361 ~~~~~~i~~--g~~~~ 374 (375) . ++-+++ |+|+. T Consensus 201 r--i~vm~~r~GrIve 214 (220) T cd03293 201 R--VVVLSARPGRIVA 214 (220) T ss_pred E--EEEEECCCCEEEE T ss_conf 9--9998589949999 No 164 >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane. Probab=98.53 E-value=1.5e-06 Score=62.02 Aligned_cols=77 Identities=19% Similarity=0.308 Sum_probs=61.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+++|-.|+ ..++|+++|||.|+||+.....+++.|.+. +.-+++.||+...+.. .-+ T Consensus 140 ~LSgGqkQri~lARal~---------~~~~ililDEpts~LD~~~~~~i~~~l~~~~~~~Tvi~itH~~~~~~~---~D~ 207 (220) T cd03245 140 GLSGGQRQAVALARALL---------NDPPILLLDEPTSAMDMNSEERLKERLRQLLGDKTLIIITHRPSLLDL---VDR 207 (220) T ss_pred EECHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH---CCE T ss_conf 21899999999999995---------599999996875688989999999999987699989999359889984---999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|+|+. T Consensus 208 Iivl~~G~Iv~ 218 (220) T cd03245 208 IIVMDSGRIVA 218 (220) T ss_pred EEEEECCEEEE T ss_conf 99998999998 No 165 >PRK13549 xylose transporter ATP-binding subunit; Provisional Probab=98.52 E-value=1.1e-06 Score=62.93 Aligned_cols=78 Identities=17% Similarity=0.287 Sum_probs=66.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.|||+.+++|-.|+ ..++||++|||.+.||+..+..+++.|.+. +.-|++.|||.+....+.+. T Consensus 405 ~LSGGq~QRv~iAraL~---------~~P~iLilDEPT~GLD~~~~~~i~~ll~~l~~~G~tvl~iSHDl~~v~~~aDR- 474 (513) T PRK13549 405 RLSGGNQQKAILAKCLL---------LNPRILILDEPTRGIDVGAKYEIYKLINQLVQQGVAIIVISSELPEVLGLSDR- 474 (513) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE- T ss_conf 39999999999999997---------19989999798668999999999999999995799999991868999986999- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +.-+++|+|.+ T Consensus 475 -V~Vm~~G~I~~ 485 (513) T PRK13549 475 -VLVMHEGKLKG 485 (513) T ss_pred -EEEEECCEEEE T ss_conf -99998999998 No 166 >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.52 E-value=1e-06 Score=63.05 Aligned_cols=79 Identities=25% Similarity=0.269 Sum_probs=65.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+++|--|+ ..+.++|+|||++.||+..+..+.+.|.+. +.=+++.|||......+.+ T Consensus 130 ~~LSGGq~QRVaiARAL~---------~~P~llLlDEP~saLD~~~~~~i~~~l~~l~~~~~~t~i~VTHd~~e~~~lad 200 (214) T cd03297 130 AQLSGGEKQRVALARALA---------AQPELLLLDEPFSALDRALRLQLLPELKQIKKNLNIPVIFVTHDLSEAEYLAD 200 (214) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 779929999999999987---------19999998088766699999999999999999859989999899999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+++|+|.- T Consensus 201 r--v~vm~dG~Ivq 212 (214) T cd03297 201 R--IVVMEDGRLQY 212 (214) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998989998 No 167 >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane. Probab=98.52 E-value=6e-07 Score=64.57 Aligned_cols=76 Identities=20% Similarity=0.361 Sum_probs=62.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+.-+++|..|+ ..++++|+|||.+.||+..+..+++.|.+. +.=|+++||+.+.. .+.+ T Consensus 139 ~~LSGG~kQRv~iAraL~---------~~P~llllDEPTs~LD~~~~~~i~~~l~~l~~~~~~tii~itHd~~~~-~~aD 208 (218) T cd03255 139 SELSGGQQQRVAIARALA---------NDPKIILADEPTGNLDSETGKEVMELLRELNKEAGTTIVVVTHDPELA-EYAD 208 (218) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHCC T ss_conf 638999999999999985---------599999981888768999999999999999996298999989688999-8699 Q ss_pred CEEEEEECCCEE Q ss_conf 600799728968 Q gi|254780766|r 361 TAKFMRISNHQA 372 (375) Q Consensus 361 ~~~~~~i~~g~~ 372 (375) . ++-+++|+| T Consensus 209 r--v~~m~~G~I 218 (218) T cd03255 209 R--IIELRDGKI 218 (218) T ss_pred E--EEEEECCCC T ss_conf 8--999989999 No 168 >CHL00131 ycf16 sulfate ABC transporter protein; Validated Probab=98.50 E-value=1.1e-06 Score=62.73 Aligned_cols=78 Identities=17% Similarity=0.149 Sum_probs=61.5 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|.||++.+.+|..|+ ..++|+|+|||.|.||+..+..+++.|.+. +.-+++.||+......+.-+ . T Consensus 151 LSGGqkqRv~iaral~---------~~P~iLiLDEPTsgLD~~~~~~i~~~l~~l~~~g~tii~itH~~~~~~~~~aD-r 220 (252) T CHL00131 151 FSGGEKKRNEILQMAL---------LDSKLAILDETDSGLDIDALKIIAEGINKLATSDNAIILITHYQRLLDYIKPD-Y 220 (252) T ss_pred CCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHCCC-E T ss_conf 7899999999999996---------39999999798766999999999999999985899999999866989877399-9 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 221 i~vm~~G~Iv~ 231 (252) T CHL00131 221 VHVMQNGKIIK 231 (252) T ss_pred EEEEECCEEEE T ss_conf 99987989999 No 169 >PRK03695 vitamin B12-transporter ATPase; Provisional Probab=98.50 E-value=9.3e-07 Score=63.32 Aligned_cols=86 Identities=21% Similarity=0.242 Sum_probs=62.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCC Q ss_conf 31220589999999999999999987089978998012201598999999999741---798099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||+..+.++..|.+.. ....-.+.|+|+|||.+.||+..+..+.+.+.+ .+.=|++++|+.+....+.+. T Consensus 122 ~~LSgGq~Qrv~la~all~i~--~a~~p~p~illLDEPt~gLD~~~~~~l~~~i~~l~~~g~tIi~vtHdl~~~~~~~dr 199 (245) T PRK03695 122 NQLSGGEWQRVRLAAVVLQVW--PDINPAGQLLLLDEPMNSLDVAQQSALDRLLSELCQQGIAVVMSSHDLNHTLRHADR 199 (245) T ss_pred HHCCHHHHHHHHHHHHHHHCC--CCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 668988999999999996327--232788878997387667899999999999999984799999994268999997999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+++| T Consensus 200 --i~vl~~G~iv~ 210 (245) T PRK03695 200 --VWLLKQGKLLA 210 (245) T ss_pred --EEEEECCEEEE T ss_conf --99998998999 No 170 >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.50 E-value=1.2e-06 Score=62.63 Aligned_cols=79 Identities=27% Similarity=0.251 Sum_probs=64.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-+++|-.|| ..+.|||+|||+|.||+..+..+.+.|.+. +.=++++|||.+....+.+ T Consensus 134 ~~LSGGqkQRvaiARAl~---------~~P~ilLlDEP~saLD~~~~~~i~~~l~~l~~~~~~T~i~vTHd~~ea~~~aD 204 (242) T cd03295 134 HELSGGQQQRVGVARALA---------ADPPLLLMDEPFGALDPITRDQLQEEFKRLQQELGKTIVFVTHDIDEAFRLAD 204 (242) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 668999999999999996---------29999998187654698999999999999999759999999989999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|.. T Consensus 205 r--i~vm~~G~iv~ 216 (242) T cd03295 205 R--IAIMKNGEIVQ 216 (242) T ss_pred E--EEEEECCEEEE T ss_conf 8--99998999999 No 171 >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.49 E-value=2.6e-06 Score=60.42 Aligned_cols=77 Identities=17% Similarity=0.298 Sum_probs=60.7 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+++|-.|+ ..+||+++||+.|.||+.....+++.|.+. +.=+++.||+...+.. .-+ T Consensus 138 ~LSgGQ~QRi~lARal~---------~~~~iliLDEpts~LD~~~e~~i~~~l~~~~~~~TvI~itH~l~~l~~---~D~ 205 (234) T cd03251 138 KLSGGQRQRIAIARALL---------KDPPILILDEATSALDTESERLVQAALERLMKNRTTFVIAHRLSTIEN---ADR 205 (234) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH---CCE T ss_conf 58999999999999996---------499989996876689989999999999998199989999278889985---999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|+|.. T Consensus 206 Iivl~~G~ive 216 (234) T cd03251 206 IVVLEDGKIVE 216 (234) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 172 >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Probab=98.49 E-value=1.2e-06 Score=62.48 Aligned_cols=78 Identities=15% Similarity=0.099 Sum_probs=60.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|.||++.+.+|..|+ ..++++++|||.+.||+..+..+.+.+... +.=++++||+....+.+. .-. T Consensus 146 lSGGqkqRv~iaral~---------~~P~lllLDEPtsgLD~~~~~~i~~~i~~l~~~~~tviivtH~~~~~~~~~-~Dr 215 (248) T PRK09580 146 FSGGEKKRNDILQMAV---------LEPELCILDESDSGLDIDALKIVADGVNSLRDGKRSFIIVTHYQRILDYIK-PDY 215 (248) T ss_pred CCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHHHHC-CCE T ss_conf 8988999999999997---------689989997962239999999999999999838999999998748787673-999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|++ T Consensus 216 i~vl~~GkIv~ 226 (248) T PRK09580 216 VHVLYQGRIVK 226 (248) T ss_pred EEEEECCEEEE T ss_conf 99998987999 No 173 >PRK13540 cytochrome c biogenesis protein CcmA; Provisional Probab=98.48 E-value=4.4e-07 Score=65.43 Aligned_cols=64 Identities=20% Similarity=0.244 Sum_probs=53.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHH Q ss_conf 312205899999999999999999870899789980122015989999999997417---9809998069678543 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDS 357 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~ 357 (375) ..+|.||++.++++..|+ ..++|+|+|||.++||+..+..+++.+.+. +.=|++++|+...++. T Consensus 126 ~~LSgGqkqrv~lar~l~---------~~p~illLDEPt~gLD~~~~~~i~~~l~~~~~~g~tiii~sH~~~~l~~ 192 (200) T PRK13540 126 GLLSSGQKRQVALLRLWM---------SKAKLWLLDEPLVALDELSLLTIITKIQEHRAKGGAVLLTSHQDLPLNK 192 (200) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH T ss_conf 249999999999999998---------3999899917764389999999999999998689999999426477776 No 174 >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.48 E-value=1.6e-06 Score=61.85 Aligned_cols=77 Identities=16% Similarity=0.314 Sum_probs=61.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..++||-.|. ...||+++|||.|+||+.....+++.|.+. +.=+++.||+...+.. .+ + T Consensus 139 ~LSgGq~Qri~lARal~---------~~~~illlDEpts~LD~~t~~~i~~~l~~~~~~~TvI~itH~~~~~~~-~D--~ 206 (229) T cd03254 139 NLSQGERQLLAIARAML---------RDPKILILDEATSNIDTETEKLIQEALEKLMKGRTSIIIAHRLSTIKN-AD--K 206 (229) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-CC--E T ss_conf 49999999999999995---------189989998977789989999999999998099889999269889985-99--9 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|+|.+ T Consensus 207 iivl~~G~Iv~ 217 (229) T cd03254 207 ILVLDDGKIIE 217 (229) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 175 >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=98.48 E-value=1.3e-06 Score=62.30 Aligned_cols=77 Identities=22% Similarity=0.295 Sum_probs=63.0 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||++.+++|-.|| ..++|+++|||.|.||+..+..+++.+.++ +.-+++.||+.+.... . T Consensus 140 ~LSGGQrQRvaIAraL~---------~~P~iLilDEPTs~LD~~~~~~i~~~l~~L~~~~g~TvI~itHdl~~~~~---a 207 (279) T PRK13635 140 RLSGGQKQRVAIAGVLA---------LQPDILILDEATSMLDPQGRREVLETVRQLKEQKGITVLSITHDLDEAAQ---A 207 (279) T ss_pred HCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHC---C T ss_conf 39999999999999997---------09998997387454898999999999999998379899999767899963---9 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) -+++-+++|+|.. T Consensus 208 DRiivm~~G~Iv~ 220 (279) T PRK13635 208 DRVIVMNKGEILE 220 (279) T ss_pred CEEEEEECCEEEE T ss_conf 9899998999999 No 176 >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=98.48 E-value=9e-07 Score=63.41 Aligned_cols=77 Identities=21% Similarity=0.318 Sum_probs=59.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCC--EEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHH Q ss_conf 3122058999999999999999998708997--89980122015989999999997417---980999806967854321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAP--ILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~p--ilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~ 359 (375) ..+|-||++.+.+|-.|+. .++ |+++|||.+.||+..+..+++.+.+. +.-|++.||+.+.+.. . T Consensus 86 ~~LSGGqkQRvaiAraL~~---------~p~~~ililDEPtsgLD~~~~~~l~~~l~~l~~~g~TvI~vtHd~~~~~~-a 155 (176) T cd03238 86 STLSGGELQRVKLASELFS---------EPPGTLFILDEPSTGLHQQDINQLLEVIKGLIDLGNTVILIEHNLDVLSS-A 155 (176) T ss_pred CCCCHHHHHHHHHHHHHHH---------CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH-C T ss_conf 8689999999999999986---------89986899717744589879999999999999879989999478799983-9 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) |. ++.+++|++. T Consensus 156 Dr--ii~l~~G~i~ 167 (176) T cd03238 156 DW--IIDFGPGSGK 167 (176) T ss_pred CE--EEEECCCCCC T ss_conf 99--9994599766 No 177 >PRK10636 putative ABC transporter ATP-binding protein; Provisional Probab=98.47 E-value=1.4e-06 Score=62.14 Aligned_cols=80 Identities=20% Similarity=0.254 Sum_probs=68.1 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEE Q ss_conf 33122058999999999999999998708997899801220159899999999974179809998069678543212600 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) ...+|-||++.+.||-.|+ ..+.+||+|||.+|||...+.++.++|...+.-+++.+||...++.+.+. T Consensus 147 ~~~LSGGqkqRvaLA~aL~---------~~PdlLLLDEPTnhLD~~~i~~L~~~L~~~~gtvilVSHDr~fL~~v~dr-- 215 (638) T PRK10636 147 VSDFSGGWRMRLNLAQALI---------CRSDLLLLDEPTNHLDLDAVIWLEKWLKSYQGTLILISHDRDFLDPIVDK-- 215 (638) T ss_pred CCCCCHHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHCCCC-- T ss_conf 2008999999999999855---------89998997088888998999999999997698199996668988714771-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++++++|++.. T Consensus 216 i~~l~~g~l~~ 226 (638) T PRK10636 216 IIHIEQQSLFE 226 (638) T ss_pred EEEECCCCEEE T ss_conf 69982895257 No 178 >PRK10762 D-ribose transporter ATP binding protein; Provisional Probab=98.47 E-value=1.7e-06 Score=61.57 Aligned_cols=79 Identities=15% Similarity=0.269 Sum_probs=66.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||+.+++|-.|+ ..+.||++|||.+.||+..+..+.+.|.+. +.-|++.|||.+....+.+. T Consensus 394 ~~LSGGq~Qrv~iAraL~---------~~p~lLilDEPT~GLD~~~~~~i~~ll~~l~~~G~til~isHDl~~v~~~aDR 464 (501) T PRK10762 394 GLLSGGNQQKVAIARGLM---------TRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEVLGMSDR 464 (501) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 209999999999999997---------29988999798668999999999999999996799999991868999986999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+|.+ T Consensus 465 --v~vm~~G~i~~ 475 (501) T PRK10762 465 --IIVMHEGHISG 475 (501) T ss_pred --EEEEECCEEEE T ss_conf --99996998998 No 179 >cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.47 E-value=1.5e-06 Score=61.91 Aligned_cols=79 Identities=25% Similarity=0.211 Sum_probs=65.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||..+++|-.|+ ..+.++|+|||+|.||+..+..+++.+.+. +.=+++.|||......+.+ T Consensus 128 ~~LSGGq~QRVaiARAl~---------~~P~llllDEP~s~LD~~~~~~i~~~l~~l~~~~~~T~i~vTHd~~~a~~~aD 198 (235) T cd03299 128 ETLSGGEQQRVAIARALV---------VNPKILLLDEPFSALDVRTKEKLREELKKIRKEFGVTVLHVTHDFEEAWALAD 198 (235) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 458999999999999997---------38998999288764699999999999999999829999998789999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|.. T Consensus 199 r--i~vl~~G~iv~ 210 (235) T cd03299 199 K--VAIMLNGKLIQ 210 (235) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 180 >PRK11819 putative ABC transporter ATP-binding protein; Reviewed Probab=98.47 E-value=1e-06 Score=63.00 Aligned_cols=79 Identities=22% Similarity=0.327 Sum_probs=65.3 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEE Q ss_conf 33122058999999999999999998708997899801220159899999999974179809998069678543212600 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) ...+|-||+..+.||-.|+ ..+.+||+|||.+|||+..+.++.++|.+.+.=+++.+||...++.+.+. T Consensus 161 ~~~LSGGqkqRv~LA~aL~---------~~PdlLlLDEPTn~LD~~~i~~L~~~L~~~~gtvivVSHDr~fLd~v~~~-- 229 (556) T PRK11819 161 VTKLSGGERRRVALCRLLL---------SKPDMLLLDEPTNHLDAESVAWLEQFLHDYPGTVVAVTHDRYFLDNVAGW-- 229 (556) T ss_pred CCCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHE-- T ss_conf 1338999999999999984---------69998998488777897789999999763378779999157999855233-- Q ss_pred EEEECCCEEE Q ss_conf 7997289689 Q gi|254780766|r 364 FMRISNHQAL 373 (375) Q Consensus 364 ~~~i~~g~~~ 373 (375) ++++++|+++ T Consensus 230 Il~l~~g~~~ 239 (556) T PRK11819 230 ILELDRGRGI 239 (556) T ss_pred EEECCCCCCC T ss_conf 5301488230 No 181 >PRK11147 ABC transporter ATPase component; Reviewed Probab=98.46 E-value=1.3e-06 Score=62.34 Aligned_cols=80 Identities=19% Similarity=0.253 Sum_probs=67.9 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEE Q ss_conf 33122058999999999999999998708997899801220159899999999974179809998069678543212600 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) ...+|-||+..+.||..|+ ..+.+||+|||.+|||...+.++.++|.+.+.-+++-+||...++.+.+. T Consensus 154 ~~~LSGGqkqRvaLA~aL~---------~~PdlLlLDEPTn~LD~~~~~~L~~~L~~~~gtvliISHDr~fL~~v~dr-- 222 (632) T PRK11147 154 LSSLSGGWLRKAALARALV---------SNPDVLLLDEPTNHLDIETIEWLEGFLKTFQGSIIFISHDRSFIRNMATR-- 222 (632) T ss_pred CCCCCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCC-- T ss_conf 2108999999999999856---------89999998488765899999999999997598499997568998752450-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|++.. T Consensus 223 i~~l~~g~l~~ 233 (632) T PRK11147 223 IVDLDRGKLVS 233 (632) T ss_pred CEECCCCCEEE T ss_conf 00014981688 No 182 >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM Probab=98.46 E-value=1e-06 Score=63.02 Aligned_cols=77 Identities=18% Similarity=0.301 Sum_probs=61.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|-|||.-+++|--|| ..+.|+|+|||.+.||+..+..+++.+.+. +.=+++.|||......+.+. T Consensus 134 ~~LSGGqqQRVAIARALa---------~~P~ilL~DEPts~LD~~~~~~i~~ll~~l~~~g~T~i~VTHD~~~a~~~aDr 204 (213) T cd03262 134 AQLSGGQQQRVAIARALA---------MNPKVMLFDEPTSALDPELVGEVLDVMKDLAEEGMTMVVVTHEMGFAREVADR 204 (213) T ss_pred HHCCCHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 446929999999999963---------79999997088887798999999999999986299999999899999996898 Q ss_pred EEEEEECCCEE Q ss_conf 00799728968 Q gi|254780766|r 362 AKFMRISNHQA 372 (375) Q Consensus 362 ~~~~~i~~g~~ 372 (375) ++.+++|+| T Consensus 205 --i~~l~~G~I 213 (213) T cd03262 205 --VIFMDDGRI 213 (213) T ss_pred --EEEEECCCC T ss_conf --999979999 No 183 >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Probab=98.45 E-value=1.5e-06 Score=61.91 Aligned_cols=80 Identities=18% Similarity=0.196 Sum_probs=65.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+++|--|+ ..+.|||+|||.|.||+..+..+...|.++ +.=+++.|||....-.+.+ T Consensus 146 ~~LSGGqqQRVaiARAL~---------~~P~vLLLDEPts~LD~~~r~~~~~~l~~l~~~~g~T~i~VTHD~~eA~~laD 216 (378) T PRK09452 146 HQLSGGQQQRVAIARAVV---------NKPKVLLLDESLSALDYKLRKQMQNELKALQRKLGITFVFVTHDQEEALTMSD 216 (378) T ss_pred CCCCHHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 549988999999999862---------39989995786444799999999999999999849989999889999998699 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) . +.-+++|+|..+ T Consensus 217 r--I~VM~~G~I~q~ 229 (378) T PRK09452 217 R--IVVMRDGRIEQD 229 (378) T ss_pred E--EEEEECCEEEEE T ss_conf 8--999989989999 No 184 >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Probab=98.45 E-value=1.7e-06 Score=61.63 Aligned_cols=79 Identities=18% Similarity=0.200 Sum_probs=63.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..++||--|+ .++.++|+|||+|.||+..+..+...|.+ .+.-++++|||..---.+.+ T Consensus 133 ~~LSGGq~QRvalARAL~---------~~P~vlllDEP~s~LD~~~r~~~~~~l~~l~~~~g~T~i~vTHd~~eA~~laD 203 (358) T PRK11650 133 RELSGGQRQRVAMGRAIV---------REPAVFLFDEPLSNLDAKLRVQMRLEIQRLHRRLGTTSLYVTHDQVEAMTLAD 203 (358) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC T ss_conf 478956789999835750---------49986887388776799899999999999999759779999899999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 204 r--i~vm~~G~i~q 215 (358) T PRK11650 204 R--VVVMNGGVAEQ 215 (358) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 185 >cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=98.44 E-value=4e-06 Score=59.16 Aligned_cols=77 Identities=17% Similarity=0.219 Sum_probs=59.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+.+|-.|+ ...+|+++|||.|.||+.....+.+.+... +.=+++.||+...+.. .+ + T Consensus 156 ~LSgGQrQri~lARAll---------~~~~iliLDEpts~LD~~te~~i~~~l~~~~~~~TvI~ItHrl~~~~~-~D--~ 223 (257) T cd03288 156 NFSVGQRQLFCLARAFV---------RKSSILIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVSTILD-AD--L 223 (257) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-CC--E T ss_conf 36999999999999995---------599999995876678999999999999997499999999238989985-99--9 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 224 Iivl~~G~Ive 234 (257) T cd03288 224 VLVLSRGILVE 234 (257) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 186 >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Probab=98.44 E-value=1.7e-06 Score=61.57 Aligned_cols=79 Identities=15% Similarity=0.339 Sum_probs=65.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||..++++-.|+ ..+.||++|||.+.||...+..+++.|.+. +.=|++.|||.+..-.+.+. T Consensus 395 ~~LSGGq~QRvaiAraL~---------~~p~vLilDEPT~GLD~~~~~~i~~ll~~l~~~G~tvl~ITHDl~~~~~~aDR 465 (501) T PRK11288 395 MNLSGGNQQKAILGRWLS---------EDMKVILLDEPTRGIDVGAKHEIYNVIYELAAQGVAVLVVSSDLPEVLGVADR 465 (501) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 028999999999999997---------09998999798778999999999999999996899999990768999986999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +..+.+|+|.+ T Consensus 466 --v~vm~~G~Iv~ 476 (501) T PRK11288 466 --IVVMREGRIAG 476 (501) T ss_pred --EEEEECCEEEE T ss_conf --99998999999 No 187 >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=98.43 E-value=3.3e-06 Score=59.71 Aligned_cols=77 Identities=21% Similarity=0.261 Sum_probs=60.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+.+|-.|. ...+|+|+|||.|+||+.....+.+.|.+. +.=|++.||....+.. .-+ T Consensus 138 ~LSgGqkQrl~lARaLl---------~~p~IllLDEpTs~LD~~te~~i~~~l~~~~~~~TvI~itHrl~~~~~---~Dr 205 (275) T cd03289 138 VLSHGHKQLMCLARSVL---------SKAKILLLDEPSAHLDPITYQVIRKTLKQAFADCTVILSEHRIEAMLE---CQR 205 (275) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH---CCE T ss_conf 23999999999999995---------199989997976689999999999999997299989999438888986---999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 206 Ilvld~G~Ive 216 (275) T cd03289 206 FLVIEENKVRQ 216 (275) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 188 >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.43 E-value=2.2e-06 Score=60.87 Aligned_cols=79 Identities=19% Similarity=0.206 Sum_probs=65.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+++|--|| ..+.++|+|||++.||+..+..+.+.+.+. +.=+++.|||......+.+ T Consensus 129 ~~LSGGqkQRVaiARAl~---------~~P~llllDEP~s~LD~~~~~~i~~~l~~l~~~~~~T~i~VTHd~~ea~~lad 199 (232) T cd03300 129 SQLSGGQQQRVAIARALV---------NEPKVLLLDEPLGALDLKLRKDMQLELKRLQKELGITFVFVTHDQEEALTMSD 199 (232) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 669989999999999986---------59999998088764699999999999999999859999999999999999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|.. T Consensus 200 r--i~vm~~G~i~~ 211 (232) T cd03300 200 R--IAVMNKGKIQQ 211 (232) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 189 >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=98.42 E-value=2.5e-06 Score=60.53 Aligned_cols=74 Identities=14% Similarity=0.151 Sum_probs=55.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHH-H---HCCCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997-4---1798099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIV-T---DIGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l-~---~~~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||+..+++|-.|+ ..+||+|+|||.|.||+...+.+++.+ . ..+.=|++.||+...+.. . T Consensus 127 ~LSgGQkQRvalARal~---------~~~~illlDEPts~LD~~~~~~i~~~l~~~~~~~~~Tvi~itH~~~~~~~---~ 194 (204) T cd03250 127 NLSGGQKQRISLARAVY---------SDADIYLLDDPLSAVDAHVGRHIFENCILGLLLNNKTRILVTHQLQLLPH---A 194 (204) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH---C T ss_conf 57999999999999995---------39999999698766699999999999999986089899998079999970---9 Q ss_pred EEEEEECCCE Q ss_conf 0079972896 Q gi|254780766|r 362 AKFMRISNHQ 371 (375) Q Consensus 362 ~~~~~i~~g~ 371 (375) -+++.+++|+ T Consensus 195 D~ii~l~~Gk 204 (204) T cd03250 195 DQIVVLDNGR 204 (204) T ss_pred CEEEEECCCC T ss_conf 9999972989 No 190 >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Probab=98.42 E-value=1.6e-06 Score=61.75 Aligned_cols=79 Identities=25% Similarity=0.369 Sum_probs=67.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-||+.-+.+|.-|| ..+.|||+|||.|-|||..+..+++.|.+. +.=+++.||+-+....+.+ T Consensus 139 ~~LSGGqkQRV~IArALa---------~~P~iLl~DEPTsaLDp~t~~~Il~lL~~l~~e~g~TivlITHdm~~v~~icd 209 (343) T PRK11153 139 ANLSGGQKQRVAIARALA---------SNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICD 209 (343) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 118999999999999986---------69999999288765899999999999999999619899998889999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 210 r--VaVm~~G~IVE 221 (343) T PRK11153 210 C--VAVISNGELIE 221 (343) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998988999 No 191 >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.41 E-value=1.9e-06 Score=61.31 Aligned_cols=74 Identities=23% Similarity=0.279 Sum_probs=61.0 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCCE Q ss_conf 2205899999999999999999870899789980122015989999999997417----980999806967854321260 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~~ 362 (375) +|-|||.-+++|--|+ ..+.|+|+|||.|.||+..+..+.+.+.+. +.-+++.|||......+.+. T Consensus 101 LSGGq~QRvaIARAL~---------~~P~ill~DEPts~LD~~~~~~i~~~l~~l~~~~~~t~i~vTHd~~~a~~~aDr- 170 (178) T cd03229 101 LSGGQQQRVALARALA---------MDPDVLLLDEPTSALDPITRREVRALLKSLQAQLGITVVLVTHDLDEAARLADR- 170 (178) T ss_pred CCCHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCE- T ss_conf 7726889999999985---------299999970897647999999999999999996499999998999999986999- Q ss_pred EEEEECCCE Q ss_conf 079972896 Q gi|254780766|r 363 KFMRISNHQ 371 (375) Q Consensus 363 ~~~~i~~g~ 371 (375) +.-+++|+ T Consensus 171 -i~vm~~Gk 178 (178) T cd03229 171 -VVVLRDGK 178 (178) T ss_pred -EEEEECCC T ss_conf -99992889 No 192 >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Probab=98.41 E-value=1.7e-06 Score=61.65 Aligned_cols=79 Identities=19% Similarity=0.362 Sum_probs=65.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||.-+++|-.|+ ..+.||++|||.+.||...+..+++.|.++ +.=+++.|||.+....+.+. T Consensus 390 ~~LSGGq~QRv~iAraL~---------~~p~iLilDEPTsGLD~~~~~~i~~ll~~l~~~G~~il~iSHDl~~~~~~~DR 460 (491) T PRK10982 390 GSLSGGNQQKVIIGRWLL---------TQPEILMLDEPTRGIDVGAKFEIYQLIAELAKKDKGIIIISSEMPELLGITDR 460 (491) T ss_pred CCCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 449999999999999998---------49988999787557999999999999999996899999995858999986999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+.+|+|.. T Consensus 461 --v~vm~~G~iv~ 471 (491) T PRK10982 461 --ILVMSNGLVAG 471 (491) T ss_pred --EEEEECCEEEE T ss_conf --99997999998 No 193 >PRK11144 modC molybdate transporter ATP-binding protein; Provisional Probab=98.41 E-value=2.4e-06 Score=60.62 Aligned_cols=79 Identities=20% Similarity=0.254 Sum_probs=65.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+..+++|--|+ ..+.+||+|||.+.||+..+..++++|.+. +.=+++.|||..-...+.+ T Consensus 127 ~~LSGGq~QRvaiARAL~---------~~P~lLllDEP~s~LD~~~~~~i~~~l~~l~~~~~~til~VTHd~~e~~~laD 197 (352) T PRK11144 127 GSLSGGEKQRVAIGRALL---------TAPELLLMDEPLASLDLPRKRELLPYLERLAQEINIPILYVSHSLDEILRLAD 197 (352) T ss_pred HHCCCCHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC T ss_conf 465924523499999872---------49999998784002797799999999999999739889999399999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 198 ~--v~vm~~G~i~~ 209 (352) T PRK11144 198 H--VVVLEQGKVKA 209 (352) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 194 >COG4717 Uncharacterized conserved protein [Function unknown] Probab=98.40 E-value=6.9e-06 Score=57.63 Aligned_cols=49 Identities=20% Similarity=0.446 Sum_probs=44.8 Q ss_pred EEEEEEEEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHHCCC Q ss_conf 189999992232545536732798-7999868998644489999997288 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFLSPG 53 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l~~g 53 (375) |+|.+|.|.+|--|.+.+++|++. +.+|+|+|-||||||.--|+=+..| T Consensus 1 MrI~sl~I~gYGKFs~r~~df~~s~f~vI~G~NEAGKSTl~sFI~smlFG 50 (984) T COG4717 1 MRIQSLEIVGYGKFSERHFDFGESKFQVIYGENEAGKSTLFSFIHSMLFG 50 (984) T ss_pred CCEEEEEEEECCCHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHCC T ss_conf 91268886401406665540467844798457631177799999999817 No 195 >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Probab=98.39 E-value=1.6e-06 Score=61.69 Aligned_cols=79 Identities=19% Similarity=0.243 Sum_probs=63.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-++||-.|+ .++.|+|+|||.|.||+..+..+...|.+ .+.=+++.|||..-.-.+.+ T Consensus 132 ~~LSGGq~QRvaiARAL~---------~~P~illlDEP~s~LD~~~r~~~~~~l~~l~~~~g~T~i~vTHD~~eA~~laD 202 (369) T PRK11000 132 KALSGGQRQRVAIGRTLV---------AEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLAD 202 (369) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHEEHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC T ss_conf 466942779999998862---------59985884366678886665247899999999869859999089999998599 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 203 r--I~Vm~~G~i~q 214 (369) T PRK11000 203 K--IVVLDAGRVAQ 214 (369) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 196 >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.39 E-value=3.4e-06 Score=59.61 Aligned_cols=77 Identities=21% Similarity=0.298 Sum_probs=57.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCH-HHHHHHHCCE Q ss_conf 2205899999999999999999870899789980122015989999999997417---98099980696-7854321260 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDK-SVFDSLNETA 362 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~-~~~~~~~~~~ 362 (375) +|.||++.+.+|..|+ ..+.++|+|||.+.||+..+..+++.+.+. +.-+++|+|+. ..+....+. T Consensus 109 LS~gqrqrv~iA~aL~---------~~P~lllLDEPt~gLD~~~~~~i~~~l~~l~~~g~tiii~th~~~~~i~~~~Dr- 178 (192) T cd03232 109 LSVEQRKRLTIGVELA---------AKPSILFLDEPTSGLDSQAAYNIVRFLKKLADSGQAILCTIHQPSASIFEKFDR- 178 (192) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCCE- T ss_conf 7976765899999984---------499889984887688989999999999999969999999983637999987999- Q ss_pred EEEEECC-CEEEE Q ss_conf 0799728-96895 Q gi|254780766|r 363 KFMRISN-HQALC 374 (375) Q Consensus 363 ~~~~i~~-g~~~~ 374 (375) ++-+++ |+++. T Consensus 179 -iivl~~GG~ivy 190 (192) T cd03232 179 -LLLLKRGGKTVY 190 (192) T ss_pred -EEEECCCCEEEE T ss_conf -999979999998 No 197 >PRK13539 cytochrome c biogenesis protein CcmA; Provisional Probab=98.38 E-value=9e-07 Score=63.41 Aligned_cols=66 Identities=21% Similarity=0.262 Sum_probs=54.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHH Q ss_conf 331220589999999999999999987089978998012201598999999999741---798099980696785432 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSL 358 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~ 358 (375) ...+|.||++.+.++..|+ ...+++|+|||+++||+..+..+.+.+.+ .+.=||++||++..++.- T Consensus 124 ~~~LSgG~kqrv~la~al~---------~~p~vllLDEPtsgLD~~~~~~v~~~i~~~~~~g~tiIi~tH~p~~~~~~ 192 (206) T PRK13539 124 FGYLSAGQKRRVALARLLV---------SNRPIWLLDEPTAALDSASQALFAELIRAHLAQGGIVIAATHIPLGLPGA 192 (206) T ss_pred HHHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCC T ss_conf 1249999999999999998---------69898999799777899999999999999995899999993898878889 No 198 >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed. Probab=98.38 E-value=3.6e-06 Score=59.49 Aligned_cols=79 Identities=16% Similarity=0.213 Sum_probs=63.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||.-+++|--|+ .++.++|+|||+|.||+..+..+.+.+.+ .+.=+++.|||..---.+.+ T Consensus 129 ~~LSGGqkQRVaiARAl~---------~~P~lLLlDEP~saLD~~~r~~i~~~l~~~~~~~~~T~i~vTHd~~ea~~l~d 199 (213) T cd03301 129 KQLSGGQRQRVALGRAIV---------REPKVFLMDEPLSNLDAKLRVQMRAELKRLQQRLGTTTIYVTHDQVEAMTMAD 199 (213) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 569999999999999987---------59998998388764298999999999999999749989999999899999699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|.- T Consensus 200 r--i~vm~~G~I~q 211 (213) T cd03301 200 R--IAVMNDGQIQQ 211 (213) T ss_pred E--EEEEECCEEEE T ss_conf 8--99998989999 No 199 >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport. Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.38 E-value=2.3e-06 Score=60.79 Aligned_cols=79 Identities=22% Similarity=0.331 Sum_probs=66.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-+++|.-|+ ..+.|+|.|||.+.||+..+..+++.|.+. +.=+++.|||......+.+ T Consensus 139 ~eLSGGq~QRVaIARAL~---------~~P~lllaDEPTs~LD~~~~~~il~ll~~l~~e~g~t~i~vTHDl~~~~~~ad 209 (233) T cd03258 139 AQLSGGQKQRVGIARALA---------NNPKVLLCDEATSALDPETTQSILALLRDINRELGLTIVLITHEMEVVKRICD 209 (233) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 526778889999999983---------39989996597664698899999999999999729899998989999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +..+.+|+|.. T Consensus 210 r--v~vm~~G~Ive 221 (233) T cd03258 210 R--VAVMEKGEVVE 221 (233) T ss_pred E--EEEEECCEEEE T ss_conf 7--99997989999 No 200 >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Probab=98.38 E-value=3.2e-06 Score=59.82 Aligned_cols=77 Identities=22% Similarity=0.308 Sum_probs=59.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.||+..+.+|-.|+ ..++|+|+|||.|.||+..+..+++.|.+. +.=|++.||+.+.+.. .| T Consensus 136 ~~LSGGqkQRv~iARaL~---------~~p~iLllDEPts~LD~~~~~~i~~~i~~l~~~~~~tvi~vtHd~~~~~~-aD 205 (225) T PRK10247 136 AELSGGEKQRISLIRNLQ---------FMPKVLLLDEITSALDESNKHNVNEIIHRYVREQNIAVLWVTHDKDEINH-AD 205 (225) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHC-CC T ss_conf 118999999999999986---------09999999597666899999999999999998389899999039999970-99 Q ss_pred CEEEEEEC--CCEEE Q ss_conf 60079972--89689 Q gi|254780766|r 361 TAKFMRIS--NHQAL 373 (375) Q Consensus 361 ~~~~~~i~--~g~~~ 373 (375) . ++.++ .|+|- T Consensus 206 r--IivL~~~~G~i~ 218 (225) T PRK10247 206 K--VITLQPHAGEMQ 218 (225) T ss_pred E--EEEEECCCCEEE T ss_conf 8--999968997998 No 201 >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Probab=98.37 E-value=3.4e-06 Score=59.63 Aligned_cols=79 Identities=22% Similarity=0.217 Sum_probs=63.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHH----HCCCCEEEEECCHHHHHHHHC Q ss_conf 3122058999999999999999998708997899801220159899999999974----179809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT----DIGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~----~~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+.+|.-|+ ....+||+|||.+.||+..+..+...|. +.+.=++++|||...--.+.+ T Consensus 148 ~~LSGGqrQRVaiArAL~---------~~P~lLllDEPts~LD~~~r~~l~~~l~~l~~~~g~Tii~VTHD~~eA~~laD 218 (377) T PRK11607 148 HQLSGGQRQRVALARSLA---------KRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAG 218 (377) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 578986878999999874---------49978996487544799999999999999999739999999989999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.. T Consensus 219 r--I~Vm~~G~Ivq 230 (377) T PRK11607 219 R--IAIMNRGKFVQ 230 (377) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 202 >PRK09700 D-allose transporter ATP-binding protein; Provisional Probab=98.37 E-value=3.8e-06 Score=59.35 Aligned_cols=80 Identities=16% Similarity=0.340 Sum_probs=66.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||+.+.++-.|+ ..+.|+++|||.+.||+..+..+++.|.+. +.-|++.|||-+..-.+.+. T Consensus 408 ~~LSGGq~Qrv~iAraL~---------~~p~lLilDEPT~GlD~~~~~~i~~li~~l~~~G~tvl~ishdl~ev~~~~DR 478 (510) T PRK09700 408 TELSGGNQQKVLISKWLC---------CCPEVIIFDEPTRGIDVGAKAEIYKVMRQLADDGKVILMVSSELPEIITVCDR 478 (510) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 459999999999999998---------59988999797558999999999999999996899999990758999986999 Q ss_pred EEEEEECCCEEEEC Q ss_conf 00799728968959 Q gi|254780766|r 362 AKFMRISNHQALCI 375 (375) Q Consensus 362 ~~~~~i~~g~~~~~ 375 (375) ++-+.+|+|..+ T Consensus 479 --i~Vm~~G~iv~~ 490 (510) T PRK09700 479 --IAVFCEGRLTQI 490 (510) T ss_pred --EEEEECCEEEEE T ss_conf --999989999999 No 203 >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.36 E-value=4e-06 Score=59.15 Aligned_cols=79 Identities=22% Similarity=0.132 Sum_probs=63.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-+++|--|| ..+.|+|+|||+|.||+..+..+.+.+.+. +.=+++-|||....-.+.+ T Consensus 159 ~qLSGGq~QRVaIARALa---------~~P~iLLlDEPtsaLD~~~~~~i~~~l~~l~~~~~~T~i~VTHD~~eA~~laD 229 (269) T cd03294 159 DELSGGMQQRVGLARALA---------VDPDILLMDEAFSALDPLIRREMQDELLRLQAELQKTIVFITHDLDEALRLGD 229 (269) T ss_pred HHHCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 784948888999999986---------39989997587542599999999999999999749999999998999999799 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|.- T Consensus 230 r--I~vm~~G~Ivq 241 (269) T cd03294 230 R--IAIMKDGRLVQ 241 (269) T ss_pred E--EEEEECCEEEE T ss_conf 8--99998999999 No 204 >PRK10762 D-ribose transporter ATP binding protein; Provisional Probab=98.36 E-value=2.4e-06 Score=60.60 Aligned_cols=79 Identities=18% Similarity=0.315 Sum_probs=65.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||+..+.++..|+ ..+.+|++|||.+.||+..+..+++.+.++ +.-+++.+|+...+..+.+. T Consensus 140 ~~LSgG~kQrv~iA~aL~---------~~p~lliLDEPt~~Ld~~~~~~l~~~l~~l~~~g~til~isH~l~~~~~~~dr 210 (501) T PRK10762 140 GELSIGDQQMVEIAKVLS---------FESKVIIMDEPTDALTDTETESLFRVIRELKSQGRGIVYISHRMKEIFEICDD 210 (501) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHCCCC T ss_conf 458999999999999984---------59987753587557887888999998878774484147751425766421464 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+++|+++. T Consensus 211 --v~vl~~G~iv~ 221 (501) T PRK10762 211 --VTVLRDGQFIG 221 (501) T ss_pred --CEEECCCEEEE T ss_conf --11312781897 No 205 >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Probab=98.35 E-value=4.4e-06 Score=58.89 Aligned_cols=79 Identities=20% Similarity=0.272 Sum_probs=65.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||+..+.++..|| ..+.|+++|||.+.||+..+..+++.|... +.-+++.||+.+....+.+. T Consensus 133 ~~LSgG~~Qrv~ia~al~---------~~p~ililDEPt~~LD~~~~~~l~~~l~~l~~~g~til~itH~l~~v~~~~Dr 203 (491) T PRK10982 133 ATLSVSQMQMIEIAKAFS---------YNAKIVIMDEPTSSLTEKEVNHLFTIIRKLKERGCGIVYISHKMEEIFQLCDE 203 (491) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCCE T ss_conf 558999999999999985---------39988981587345587888999888888774285367862436744215867 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+++|++++ T Consensus 204 --v~vm~~G~iv~ 214 (491) T PRK10982 204 --ITILRDGQWIA 214 (491) T ss_pred --EEECCCCEEEE T ss_conf --89756974985 No 206 >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2. Probab=98.34 E-value=5.1e-06 Score=58.47 Aligned_cols=79 Identities=14% Similarity=0.169 Sum_probs=65.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||..+++|-.|+ ..+.|+++|||.+.||+..+..+++.|.+ .+.-|++.|||.+....+.+ T Consensus 426 ~~LSGGq~QRvaiAraL~---------~~P~vlilDEPT~glD~~~~~~i~~~l~~~~~~~g~tvi~iShDl~~~~~~~d 496 (520) T TIGR03269 426 DELSEGERHRVALAQVLI---------KEPRIVILDEPTGTMDPITKVDVTHSILKAREEMEQTFIIVSHDMDFVLDVCD 496 (520) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 118999999999999999---------79898999386011338999999999999998329899997788899998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+|.. T Consensus 497 R--v~vm~~G~iv~ 508 (520) T TIGR03269 497 R--AALMRDGKIVK 508 (520) T ss_pred E--EEEEECCEEEE T ss_conf 9--99997999999 No 207 >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. Probab=98.34 E-value=1.3e-05 Score=55.85 Aligned_cols=78 Identities=21% Similarity=0.310 Sum_probs=60.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+..+.+|--|. ..++|+++||+.|+||+.....+.+.|.+. +.=+++.||....+.. -- T Consensus 600 ~~LSgGqrQri~lARAl~---------~~p~ililDE~ts~LD~~~e~~i~~~l~~~~~~~T~i~itHrls~i~~---aD 667 (694) T TIGR03375 600 RSLSGGQRQAVALARALL---------RDPPILLLDEPTSAMDNRSEERFKDRLKRWLAGKTLVLVTHRTSLLDL---VD 667 (694) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH---CC T ss_conf 946899999999999995---------799989997875688999999999999986699989998168999984---99 Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++-+++|+|.. T Consensus 668 ~i~vl~~G~iv~ 679 (694) T TIGR03375 668 RIIVMDNGRIVA 679 (694) T ss_pred EEEEEECCEEEE T ss_conf 999998988999 No 208 >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes. Probab=98.33 E-value=4.1e-06 Score=59.10 Aligned_cols=76 Identities=16% Similarity=0.278 Sum_probs=59.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+..+++|-.|. ..+||+|+||+.|.||+.....+++.|.+. +.=+++.||+...+.. .+ T Consensus 149 ~~LSgGqkQRialARal~---------~~p~ililDEptSaLD~~te~~i~~~l~~~~~~~Tvi~ItH~l~~~~~-~D-- 216 (226) T cd03248 149 SQLSGGQKQRVAIARALI---------RNPQVLILDEATSALDAESEQQVQQALYDWPERRTVLVIAHRLSTVER-AD-- 216 (226) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH-CC-- T ss_conf 876999999999999997---------599999997976688999999999999986699999999379999984-99-- Q ss_pred EEEEECCCEE Q ss_conf 0799728968 Q gi|254780766|r 363 KFMRISNHQA 372 (375) Q Consensus 363 ~~~~i~~g~~ 372 (375) +++.+++|+| T Consensus 217 rIivme~G~I 226 (226) T cd03248 217 QILVLDGGRI 226 (226) T ss_pred EEEEEECCCC T ss_conf 9999939999 No 209 >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Probab=98.33 E-value=5.6e-06 Score=58.24 Aligned_cols=80 Identities=19% Similarity=0.205 Sum_probs=62.0 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) ...+|.|||+.+++|-.|+ ..+.||++|||.++||...+..+.+.|.++ +.-+++.|||...+.... T Consensus 399 ~~~LSGGqqqrv~lAr~L~---------~~P~vLiLDEPT~gLD~~~~~~i~~ll~~l~~~g~~~il~vSHd~e~~~~~~ 469 (490) T PRK10938 399 FHSLSWGQQRLALIVRALV---------KHPTLLILDEPLQGLDPLNRQLVRRFVDVLISEGETQLLFVSHHAEDAPACI 469 (490) T ss_pred CCCCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHC T ss_conf 2319999999999999997---------1999899968754769999999999999999779929999748999999855 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) .+ .+.-+.+|+|. T Consensus 470 ~~-r~~~~~dG~i~ 482 (490) T PRK10938 470 TH-RLEFVPDGDLY 482 (490) T ss_pred CC-EEEEEECCEEE T ss_conf 99-99998699999 No 210 >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=98.32 E-value=6e-06 Score=58.03 Aligned_cols=77 Identities=22% Similarity=0.327 Sum_probs=59.6 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+++|-.|. ..+||+++|||.|+||+.....+++.+.+. +.=+|+.||+...+.. .+ + T Consensus 137 ~LSgGQ~QrialARal~---------~~~~ililDEpts~LD~~te~~i~~~l~~~~~~~Tvi~itHr~~~~~~-~D--~ 204 (236) T cd03253 137 KLSGGEKQRVAIARAIL---------KNPPILLLDEATSALDTHTEREIQAALRDVSKGRTTIVIAHRLSTIVN-AD--K 204 (236) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH-CC--E T ss_conf 26999999999999996---------499999996875679989999999999998099989998268788985-99--9 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++.+++|+|.. T Consensus 205 Iivl~~G~iv~ 215 (236) T cd03253 205 IIVLKDGRIVE 215 (236) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 211 >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Probab=98.32 E-value=6.4e-06 Score=57.82 Aligned_cols=77 Identities=23% Similarity=0.364 Sum_probs=64.3 Q ss_pred HHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCC Q ss_conf 02331220589999999999999999987089978998012201598999999999741798099980696785432126 Q gi|254780766|r 282 ITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 282 ~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~ 361 (375) .++.-+|-||+.-+.||..|.+ .+-+||+|||..|||..-+..+-+.|.+.+.=|++.+||...++.+.+ T Consensus 435 ~~v~~LSGGEk~Rl~La~ll~~---------~pNvLlLDEPTNhLDi~s~eaLe~aL~~f~Gtvl~VSHDr~Fl~~va~- 504 (530) T COG0488 435 KPVGVLSGGEKARLLLAKLLLQ---------PPNLLLLDEPTNHLDIESLEALEEALLDFEGTVLLVSHDRYFLDRVAT- 504 (530) T ss_pred CCHHHCCHHHHHHHHHHHHHCC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC- T ss_conf 9522258779999999998566---------997899728987679889999999998589869999489999983332- Q ss_pred EEEEEECC Q ss_conf 00799728 Q gi|254780766|r 362 AKFMRISN 369 (375) Q Consensus 362 ~~~~~i~~ 369 (375) .+|.+++ T Consensus 505 -~i~~~~~ 511 (530) T COG0488 505 -RIWLVED 511 (530) T ss_pred -EEEEECC T ss_conf -3999848 No 212 >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines. Probab=98.31 E-value=6.6e-06 Score=57.75 Aligned_cols=79 Identities=22% Similarity=0.151 Sum_probs=61.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-+.+|--|| ..++|+|+|||+|.||+..+..+.+.|.+ .+.=+++-|||.+---.+.+ T Consensus 163 ~eLSGGqqQRVaIARALa---------~~P~iLLmDEPfsaLD~~~r~~l~~~l~~L~~~~~~TiifVTHD~~EA~~laD 233 (382) T TIGR03415 163 GELSGGMQQRVGLARAFA---------MDADILLMDEPFSALDPLIRTQLQDELLELQAKLNKTIIFVSHDLDEALKIGN 233 (382) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 557988999999999986---------38998997088765599999999999999999869989998799999998689 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.- T Consensus 234 R--IaVM~~G~IvQ 245 (382) T TIGR03415 234 R--IAIMEGGRIIQ 245 (382) T ss_pred E--EEEEECCEEEE T ss_conf 8--99998998999 No 213 >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE. Probab=98.31 E-value=3.1e-06 Score=59.91 Aligned_cols=69 Identities=20% Similarity=0.279 Sum_probs=56.0 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHC Q ss_conf 331220589999999999999999987089978998012201598999999999741---79809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|.|||+-+.+|..|+ ..++|+|+|||.++||+..+..+.+.+.+ .+.-+++++|+...+....+ T Consensus 123 ~~~LSgGqkqRv~lA~al~---------~~p~llllDEPt~gLD~~s~~~~~~~l~~~~~~g~~ii~~sH~~~~~~~~~~ 193 (201) T cd03231 123 VAQLSAGQQRRVALARLLL---------SGRPLWILDEPTTALDKAGVARFAEAMAGHCARGGMVVLTTHQDLGLSEAGA 193 (201) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 2347999999999999997---------4999999808865579999999999999998689999999867146787229 Q ss_pred C Q ss_conf 6 Q gi|254780766|r 361 T 361 (375) Q Consensus 361 ~ 361 (375) + T Consensus 194 r 194 (201) T cd03231 194 R 194 (201) T ss_pred C T ss_conf 6 No 214 >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=98.31 E-value=3.8e-06 Score=59.34 Aligned_cols=81 Identities=15% Similarity=0.242 Sum_probs=61.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|-||++.+.+|-.|+. +. ..+.|+++|||.|.||+.....+++.+... +.-|++.+|+.+.+. ..|. T Consensus 168 ~~LSGGqkQRvaiAraL~~-----~~-~~P~lllLDEPTs~LD~~~~~~l~~~l~~l~~~G~Tvi~itH~l~~~~-~aD~ 240 (261) T cd03271 168 TTLSGGEAQRIKLAKELSK-----RS-TGKTLYILDEPTTGLHFHDVKKLLEVLQRLVDKGNTVVVIEHNLDVIK-CADW 240 (261) T ss_pred CCCCHHHHHHHHHHHHHHH-----CC-CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHH-HCCE T ss_conf 5668899999999999972-----58-889679954863459989999999999999978999999847788997-3899 Q ss_pred EEEEEE------CCCEEEE Q ss_conf 007997------2896895 Q gi|254780766|r 362 AKFMRI------SNHQALC 374 (375) Q Consensus 362 ~~~~~i------~~g~~~~ 374 (375) ++-+ ++|+|++ T Consensus 241 --IivLg~~~g~~~G~iv~ 257 (261) T cd03271 241 --IIDLGPEGGDGGGQVVA 257 (261) T ss_pred --EEECCCCCCCCCCEEEE T ss_conf --99934877789958998 No 215 >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Probab=98.30 E-value=5.2e-06 Score=58.45 Aligned_cols=75 Identities=23% Similarity=0.243 Sum_probs=60.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|.|||..+.+|-.|+ ..++|||+|||++.||+..+..+.+.|.+. +.-++++|||-+....+.+ T Consensus 127 ~~LSGGqkQRVaiArAL~---------~~P~iLllDEPt~~LD~~~r~~l~~ll~~l~~~~g~Til~vTHdl~ea~~lad 197 (255) T PRK11248 127 WQLSGGQRQRVGIARALA---------ANPQLLLLDEPFGALDAFTREQMQELLLKLWQETGKQVLLITHDIEEAVFMAT 197 (255) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCC T ss_conf 349999999999999997---------29999998088777998999999999999999619999998868999999699 Q ss_pred CEEEEEECCC Q ss_conf 6007997289 Q gi|254780766|r 361 TAKFMRISNH 370 (375) Q Consensus 361 ~~~~~~i~~g 370 (375) . ++-+.+| T Consensus 198 r--v~vm~~g 205 (255) T PRK11248 198 E--LVLLSPG 205 (255) T ss_pred E--EEEEECC T ss_conf 9--9998289 No 216 >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate. Probab=98.30 E-value=7.2e-06 Score=57.51 Aligned_cols=79 Identities=20% Similarity=0.174 Sum_probs=62.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC-----CCCEEEEECCHHHHHHHH Q ss_conf 312205899999999999999999870899789980122015989999999997417-----980999806967854321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI-----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~-----~~Qv~iTt~~~~~~~~~~ 359 (375) ..+|-|||..++||--|+ .++.|||+|||+|.||+..+..+...|.++ +.=+++.|||..---.+. T Consensus 136 ~~LSGGq~QRVAlARAL~---------~~P~ilLlDEP~saLD~~~r~~l~~~l~~l~~~l~~~T~i~VTHD~~EA~~la 206 (362) T TIGR03258 136 AQLSGGMQQRIAIARAIA---------IEPDVLLLDEPLSALDANIRANMREEIAALHEELPELTILCVTHDQDDALTLA 206 (362) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHC T ss_conf 678998999999999975---------59998998188765599999999999999999767988999899989999858 Q ss_pred CCEEEEEECCCEEEE Q ss_conf 260079972896895 Q gi|254780766|r 360 ETAKFMRISNHQALC 374 (375) Q Consensus 360 ~~~~~~~i~~g~~~~ 374 (375) +. +.-+++|+|.- T Consensus 207 Dr--I~Vm~~G~i~Q 219 (362) T TIGR03258 207 DK--AGIMKDGRLAA 219 (362) T ss_pred CE--EEEEECCEEEE T ss_conf 99--99998999999 No 217 >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=98.29 E-value=1.3e-05 Score=55.94 Aligned_cols=77 Identities=17% Similarity=0.242 Sum_probs=59.6 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+-.+++|-.| ...+||+++||+.|.||+..-..+.+.|.+. +.=+++-+|....+. +--+ T Consensus 485 ~LSGGQrQRiaiARAl---------l~~~~ILILDEaTSaLD~~tE~~i~~~L~~~~~~rTviiIaHRlsti~---~aD~ 552 (588) T PRK11174 485 GLSVGQAQRLALARAL---------LQPCQLLLLDEPTASLDAHSEQLVMQALNAASQGQTTLMVTHQLEDLA---QMDQ 552 (588) T ss_pred CCCHHHHHHHHHHHHH---------HCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHH---HCCE T ss_conf 7799999999999998---------379898999898779899999999999998679998999806799998---4999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 553 Iivld~G~Ive 563 (588) T PRK11174 553 ILVMQDGKIVQ 563 (588) T ss_pred EEEEECCEEEE T ss_conf 99998988999 No 218 >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy. Probab=98.29 E-value=1.2e-05 Score=56.15 Aligned_cols=78 Identities=21% Similarity=0.340 Sum_probs=60.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+..+.+|-.|. ...||+|+|||.|.||+.....+++.+.+. +.=+++.||+...+.. .+ T Consensus 137 ~~LSgGqkQRlalARall---------~~~~illlDEpts~LD~~te~~i~~~l~~~~~~~Tvi~itHrl~~l~~-aD-- 204 (237) T cd03252 137 AGLSGGQRQRIAIARALI---------HNPRILIFDEATSALDYESEHAIMRNMHDICAGRTVIIIAHRLSTVKN-AD-- 204 (237) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH-CC-- T ss_conf 848999999999999996---------699999994864568989999999999998299999998078889984-99-- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++-+++|+|.. T Consensus 205 ~Iivl~~G~iv~ 216 (237) T cd03252 205 RIIVMEKGRIVE 216 (237) T ss_pred EEEEEECCEEEE T ss_conf 999998999999 No 219 >PTZ00265 multidrug resistance protein (mdr1); Provisional Probab=98.29 E-value=8.4e-05 Score=50.56 Aligned_cols=78 Identities=21% Similarity=0.300 Sum_probs=48.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCC Q ss_conf 31220589999999999999999987089978998012201598999999999741---798099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||+=.+.||--| + .++.||||||.-|-||.+--..+-+.|.+ ...-+.||-+| -++.+.+- T Consensus 1358 ~nLSgGQKQrIaIARAL-----L----R~pkILLLDEATSaLD~eSE~~VQ~aL~~~~~~~~rTvI~IAH--RLsTI~~a 1426 (1467) T PTZ00265 1358 KSLSGGQKQRIAIARAL-----L----REPKILLLDEATSSLDSNSEKLIEKTIVDIKDKADKTIITIAH--RIASIKRS 1426 (1467) T ss_pred CCCCHHHHHHHHHHHHH-----H----HCCCEEEEECCHHCCCHHHHHHHHHHHHHHHHCCCCEEEEEHH--HHHHHHHC T ss_conf 33699999999999999-----7----6499899968020589899999999999988528998998564--27789968 Q ss_pred EEEEEECC----CEEE Q ss_conf 00799728----9689 Q gi|254780766|r 362 AKFMRISN----HQAL 373 (375) Q Consensus 362 ~~~~~i~~----g~~~ 373 (375) -+|+-+++ |++. T Consensus 1427 D~I~Vld~g~~~G~iV 1442 (1467) T PTZ00265 1427 DKIVVFNNPDRNGSFV 1442 (1467) T ss_pred CEEEEEECCCCCCCEE T ss_conf 9899994787688789 No 220 >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Probab=98.28 E-value=5.4e-06 Score=58.35 Aligned_cols=80 Identities=18% Similarity=0.287 Sum_probs=63.2 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|-||+..+.++-.|+ ..+.++++|||.++||+.-++.+++.|.+. +.=++++||+.+....+.+ T Consensus 138 ~~~LSgG~kQrv~ia~aL~---------~~p~lliLDEPts~LD~~~~~~l~~~l~~l~~~G~til~isH~l~~~~~~~D 208 (501) T PRK11288 138 LKYLSIGQRQMVEIAKALM---------RNARVIAFDEPTSSLSAREIEQLFRVIRELRAEGRVILYVSHRMEEIFALCD 208 (501) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHCC T ss_conf 2669999999999999986---------0998999658745689899999988999998727612651332899997588 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+++. T Consensus 209 r--v~vl~~G~iv~ 220 (501) T PRK11288 209 A--ITVFRDGRYVA 220 (501) T ss_pred E--EEEEECCEEEE T ss_conf 7--89711885997 No 221 >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=98.28 E-value=1.7e-05 Score=55.00 Aligned_cols=77 Identities=17% Similarity=0.252 Sum_probs=59.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+-.+++|--| ...+||+++||+.|.||+..-..+.+.|.+. +.=+++-+|.... +.+--+ T Consensus 451 ~LSGGQrQRialARAl---------l~~p~iliLDEaTSaLD~~tE~~i~~~l~~~~~~~T~i~IaHRlst---i~~aD~ 518 (569) T PRK10789 451 MLSGGQKQRISIARAL---------LLNAEILILDDALSAVDGRTEHQILHNLRQWGEGRTVIISAHRLSA---LTEASE 518 (569) T ss_pred CCCHHHHHHHHHHHHH---------HCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHH---HHHCCE T ss_conf 9699999999999999---------5499989980876668999999999999997499989997158888---985998 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 519 I~vl~~G~ive 529 (569) T PRK10789 519 IIVMQHGHIAQ 529 (569) T ss_pred EEEEECCEEEE T ss_conf 99998988999 No 222 >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another. Probab=98.27 E-value=2.2e-05 Score=54.35 Aligned_cols=77 Identities=19% Similarity=0.242 Sum_probs=59.3 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+-.+++|-.|. ..+||+++||+.|.||+.....+++.|.+. +.=+++.||....+.. --+ T Consensus 139 ~LSgGQ~QRialARAl~---------~~~~ililDE~tsaLD~~te~~i~~~l~~~~~~~TvI~ItHrl~~l~~---~D~ 206 (238) T cd03249 139 QLSGGQKQRIAIARALL---------RNPKILLLDEATSALDAESEKLVQEALDRAMKGRTTIVIAHRLSTIRN---ADL 206 (238) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH---CCE T ss_conf 58999999999999996---------599999997876678999999999999998099989998488889985---999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 207 Iivl~~G~Ive 217 (238) T cd03249 207 IAVLQNGQVVE 217 (238) T ss_pred EEEEECCEEEE T ss_conf 99998999999 No 223 >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Probab=98.26 E-value=1e-05 Score=56.57 Aligned_cols=79 Identities=19% Similarity=0.232 Sum_probs=62.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..++|+--|+ .++.++|+|||+|.||+..+..+...|.+. +.=+++.|||..---.+.+ T Consensus 135 ~~LSGGq~QRValARAL~---------~~P~vlLlDEP~s~LD~~lR~~~~~~l~~l~~~~~~T~i~VTHD~~EA~~laD 205 (351) T PRK11432 135 DQISGGQQQRVALARALV---------LKPKVLLFDEPLSNLDANLRRSMREKIRELQQQFNITSLYVTHDQSEAFAVSD 205 (351) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 578998999999999984---------49989998687543699999999999999999869999999999899998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.- T Consensus 206 r--I~vm~~G~i~Q 217 (351) T PRK11432 206 T--VIVMNKGKIMQ 217 (351) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998999999 No 224 >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Probab=98.25 E-value=1.1e-05 Score=56.44 Aligned_cols=79 Identities=20% Similarity=0.156 Sum_probs=61.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-+++|--|| ..++|+|+|||+|-||+..+..+.+.+.++ +.=+++-|||.+---.+.+ T Consensus 163 ~eLSGGqqQRVaiARALa---------~~P~iLL~DEP~SALDp~~r~~i~~~l~~L~~~~~~TiifVTHDl~eA~~laD 233 (400) T PRK10070 163 DELSGGMRQRVGLARALA---------INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGD 233 (400) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 448999999999999986---------29999997087654598999999999999999859999998999999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+.+|+|.- T Consensus 234 R--IaVM~~G~Ivq 245 (400) T PRK10070 234 R--IAIMQNGEVVQ 245 (400) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998988999 No 225 >PRK13549 xylose transporter ATP-binding subunit; Provisional Probab=98.24 E-value=6.2e-06 Score=57.91 Aligned_cols=79 Identities=23% Similarity=0.335 Sum_probs=63.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.||+..+.++..|+ ..+.+|++|||.+.||+..+..+++.+... +.-+++.+|+.+.+..+.+. T Consensus 142 ~~LSgGqkQrv~iA~aL~---------~~p~lLilDEPt~~LD~~~~~~l~~~l~~l~~~g~til~isH~l~~v~~~aDr 212 (513) T PRK13549 142 GNLGLGQQQLVEIAKALN---------KQARLLILDEPTASLTESETAILLDIIRDLKQHGIACIYISHKLNEVKAISDT 212 (513) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCE T ss_conf 558999999999988775---------29988640667578885777999999999875596799994571430300987 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+++|+++. T Consensus 213 --v~vl~~G~iv~ 223 (513) T PRK13549 213 --ICVIRDGRHIG 223 (513) T ss_pred --EEECCCCCEEE T ss_conf --40448985885 No 226 >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=98.24 E-value=1.3e-05 Score=55.83 Aligned_cols=77 Identities=22% Similarity=0.297 Sum_probs=60.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+..+++|--|. ..+||+++||+.|+||+..-..+.+.|.+. +.=+++-+|....+.. --+ T Consensus 476 ~LSGGQrQRiaiARAll---------~~~~iliLDEaTs~LD~~te~~i~~~l~~~~~~rT~i~IaHRlsti~~---aD~ 543 (575) T PRK11160 476 QLSGGEQRRLGIARALL---------HDAPLLLLDEPTEGLDAETERQILELLFEHAQNKTVLMITHRLTGLEQ---FDQ 543 (575) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHH---CCE T ss_conf 59999999999999994---------599999984986667999999999999986699999997166989995---999 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 544 I~vl~~G~i~e 554 (575) T PRK11160 544 ICVMDNGQIIE 554 (575) T ss_pred EEEEECCEEEE T ss_conf 99998989999 No 227 >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2. Probab=98.23 E-value=1.1e-05 Score=56.26 Aligned_cols=79 Identities=20% Similarity=0.245 Sum_probs=66.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-||+..+.+|..|| ..+.+|++|||.|.||+..+..+++.|.+ .+.-+++.+|+.+.+..+.+ T Consensus 167 ~~LSgGqkQrv~IA~aL~---------~~P~lLilDEPTa~LD~~~~~~l~~~l~~l~~~~g~tii~isH~l~~~~~~~D 237 (520) T TIGR03269 167 RDLSGGEKQRVVLARQLA---------KEPFLFLADEPTGTLDPQTAKLVHNALEEAVKASGISMVLTSHWPEVIEDLSD 237 (520) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 559999978899999984---------59989997076335799999999999999999839659997486999998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++.+++|++.+ T Consensus 238 r--v~vl~~G~iv~ 249 (520) T TIGR03269 238 K--AIWLENGEIKE 249 (520) T ss_pred E--EEEEECCEEEE T ss_conf 9--99998998999 No 228 >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Probab=98.22 E-value=2.8e-05 Score=53.62 Aligned_cols=78 Identities=19% Similarity=0.310 Sum_probs=59.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+-.+++|=- ....+||+++||+.|.||+..-..+.+.|.+. +.=+++-+|....+.. -- T Consensus 470 ~~LSGGQrQRialARA---------ll~~p~IliLDEaTSaLD~~tE~~i~~~l~~~~~~~T~iiIaHRlsti~~---aD 537 (585) T PRK13657 470 RQLSGGERQRLAIARA---------LLKDPPILILDEATSALDAETEAKVKAALDEVMKGRTTFIIAHRLSTVRN---AD 537 (585) T ss_pred CCCCHHHHHHHHHHHH---------HHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHH---CC T ss_conf 8689999999999999---------94698989986887689999999999999998489989996068888996---99 Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++-+++|+|.. T Consensus 538 ~Iivl~~G~Ive 549 (585) T PRK13657 538 RILVFDNGRVVE 549 (585) T ss_pred EEEEEECCEEEE T ss_conf 999998988999 No 229 >PRK11176 lipid transporter ATP-binding/permease protein; Provisional Probab=98.22 E-value=2.8e-05 Score=53.68 Aligned_cols=77 Identities=17% Similarity=0.295 Sum_probs=58.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|.||+-.+++|-.| ...+||+++||+.|.||+..-..+.+.|.+. +.=+++-+|....+.. .-+ T Consensus 479 ~LSgGQrQRialARal---------l~~~~iliLDE~TSalD~~te~~i~~~l~~~~~~~Tvi~IaHrl~~i~~---~D~ 546 (581) T PRK11176 479 LLSGGQRQRIAIARAL---------LRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEK---ADE 546 (581) T ss_pred CCCHHHHHHHHHHHHH---------HCCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHH---CCE T ss_conf 7899999999999999---------6799989985863358999999999999997399999997188989984---998 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+++|+|.. T Consensus 547 I~vl~~G~ive 557 (581) T PRK11176 547 ILVVEDGEIVE 557 (581) T ss_pred EEEEECCEEEE T ss_conf 99998988999 No 230 >TIGR01188 drrA daunorubicin resistance ABC transporter, ATP-binding protein; InterPro: IPR005894 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains the daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. In other words it functions as an ATP dependent antiporter. . Probab=98.21 E-value=4.5e-06 Score=58.86 Aligned_cols=81 Identities=21% Similarity=0.291 Sum_probs=67.6 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) +...|-|+||-+-||.-|- ..+-||.||||-..|||+-++.+++++.++ +.=||+|||.-+--+.+. T Consensus 126 V~tySGGMrRRL~iA~sli---------~~P~vLFLDEPT~GLDP~tR~~iWd~i~~lk~~~g~TilLTThYmeEAd~L~ 196 (343) T TIGR01188 126 VKTYSGGMRRRLEIAASLI---------HQPEVLFLDEPTTGLDPRTRRAIWDYIEALKKEEGVTILLTTHYMEEADKLC 196 (343) T ss_pred CCCCCCCCEEHHHHHHHHH---------CCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHC T ss_conf 3226771121445431110---------3882565148876888866999999999987407969997437869998236 Q ss_pred CCEEEEEECCCEEEEC Q ss_conf 2600799728968959 Q gi|254780766|r 360 ETAKFMRISNHQALCI 375 (375) Q Consensus 360 ~~~~~~~i~~g~~~~~ 375 (375) +. +--|.+|+|+|. T Consensus 197 Dr--iaiId~G~iiA~ 210 (343) T TIGR01188 197 DR--IAIIDHGRIIAE 210 (343) T ss_pred CE--EEEEECCEEEEE T ss_conf 88--788616489986 No 231 >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=98.21 E-value=1.1e-05 Score=56.31 Aligned_cols=73 Identities=26% Similarity=0.280 Sum_probs=57.8 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCCE Q ss_conf 2205899999999999999999870899789980122015989999999997417----980999806967854321260 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~~ 362 (375) +|-||+..+.+|..|+ ..+.++|+|||.++||+..+..+++.+.+. +.=++++|||......+.+. T Consensus 72 LSGGqrQRv~iAral~---------~~p~lllLDEPts~LD~~~r~~i~~~ik~l~~~~~~Tvl~vsHdl~~a~~~aDr- 141 (177) T cd03222 72 LSGGELQRVAIAAALL---------RNATFYLFDEPSAYLDIEQRLNAARAIRRLSEEGKKTALVVEHDLAVLDYLSDR- 141 (177) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE- T ss_conf 7989999999999982---------399999974886538999999999999999996597799985889999986999- Q ss_pred EEEEECCC Q ss_conf 07997289 Q gi|254780766|r 363 KFMRISNH 370 (375) Q Consensus 363 ~~~~i~~g 370 (375) ++-++++ T Consensus 142 -I~vl~g~ 148 (177) T cd03222 142 -IHVFEGE 148 (177) T ss_pred -EEEEECC T ss_conf -9999389 No 232 >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=98.21 E-value=1.8e-05 Score=54.84 Aligned_cols=77 Identities=14% Similarity=0.157 Sum_probs=56.7 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHH-HHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 1220589999999999999999987089978998012201598999999999-7417--980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRI-VTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~-l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .+|.||+..+++|-.|. ..+||+++||+.|.||+.....+++. +.+. +.-+|+-||....+. ..- T Consensus 159 ~LSGGQkQRlaiARALl---------~~p~IliLDEpTS~LD~~tE~~I~~~~l~~~~~~kTvI~ItHrL~~i~---~aD 226 (282) T cd03291 159 TLSGGQRARISLARAVY---------KDADLYLLDSPFGYLDVFTEKEIFESCVCKLMANKTRILVTSKMEHLK---KAD 226 (282) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHH---HCC T ss_conf 58999999999999984---------289989986877668987899999999999868998999937888898---699 Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++-+++|+|.. T Consensus 227 rIiVL~~G~Ive 238 (282) T cd03291 227 KILILHEGSSYF 238 (282) T ss_pred EEEEEECCEEEE T ss_conf 999998988999 No 233 >PRK13541 cytochrome c biogenesis protein CcmA; Provisional Probab=98.20 E-value=8.9e-06 Score=56.92 Aligned_cols=64 Identities=27% Similarity=0.383 Sum_probs=52.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHH Q ss_conf 31220589999999999999999987089978998012201598999999999741---79809998069678543 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDS 357 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~ 357 (375) ..+|.||++.+.+|..|| ..++++|+|||.+.||+..+..+.+++.+ .+.=|++|+|....+.. T Consensus 122 ~~LS~G~kqrv~iAral~---------~~p~llllDEPt~~LD~~~~~~i~~li~~~~~~g~~ili~sH~~~~i~~ 188 (195) T PRK13541 122 YSLSSGMQKVVALARLIA---------CQSDLWLLDEVETNLSKENRDLLNNLIVMKANSGGIVLLSSHLESSIKS 188 (195) T ss_pred HHCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHH T ss_conf 459999999999999997---------0999999978765599999999999999998399999998379899941 No 234 >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt Probab=98.19 E-value=1.4e-05 Score=55.55 Aligned_cols=71 Identities=21% Similarity=0.455 Sum_probs=56.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEEEEE Q ss_conf 22058999999999999999998708997899801220159899999999974179809998069678543212600799 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~~~~ 366 (375) +|.||+..+.+|-.|. ..++|+++|||.|+||+.....+++.|.+.+.=+++.||+..... ..+. ++. T Consensus 92 LSGGqkQRvalARal~---------~~p~iliLDEpTs~LD~~~~~~l~~~l~~~~~Tvi~VtH~~~~~~-~aDr--vl~ 159 (166) T cd03223 92 LSGGEQQRLAFARLLL---------HKPKFVFLDEATSALDEESEDRLYQLLKELGITVISVGHRPSLWK-FHDR--VLD 159 (166) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHH-CCCE--EEE T ss_conf 8999999999999996---------499999975853328999999999999977998999943469997-2999--999 Q ss_pred ECC Q ss_conf 728 Q gi|254780766|r 367 ISN 369 (375) Q Consensus 367 i~~ 369 (375) ++. T Consensus 160 Ldg 162 (166) T cd03223 160 LDG 162 (166) T ss_pred EEC T ss_conf 918 No 235 >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely. Probab=98.19 E-value=1.7e-05 Score=55.05 Aligned_cols=79 Identities=24% Similarity=0.235 Sum_probs=62.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..++|+--|+ ..+.++|+|||+|.||+..+..+...|.+ .+.=+++.|||..---.+.+ T Consensus 133 ~~LSGGq~QRVAlARAL~---------~~P~vlLlDEPlsaLD~~lr~~l~~~l~~l~~~~~~T~i~VTHD~~EA~~laD 203 (353) T TIGR03265 133 GQLSGGQQQRVALARALA---------TSPGLLLLDEPLSALDARVREHLRTEIRQLQRRLGVTTIMVTHDQEEALSMAD 203 (353) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 468988879999999985---------49989999087653599999999999999999869989999989899998699 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+++|+|.- T Consensus 204 r--i~Vm~~G~i~q 215 (353) T TIGR03265 204 R--IVVMNHGVIEQ 215 (353) T ss_pred E--EEEEECCEEEE T ss_conf 8--99998999999 No 236 >KOG0059 consensus Probab=98.19 E-value=8.1e-06 Score=57.17 Aligned_cols=82 Identities=26% Similarity=0.346 Sum_probs=68.6 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCC---CEEEEECCHHHHHHHH Q ss_conf 2331220589999999999999999987089978998012201598999999999741798---0999806967854321 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS---QIFMTGTDKSVFDSLN 359 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~---Qv~iTt~~~~~~~~~~ 359 (375) .+..+|.|++|-+.+++.|. +.++++++|||.+++||.-|+.+.+.+.+... =+++|||+-+-.+.+. T Consensus 695 ~~~~ySgG~KRkLs~aiali---------g~p~vi~LDEPstGmDP~arr~lW~ii~~~~k~g~aiiLTSHsMeE~EaLC 765 (885) T KOG0059 695 QVRTYSGGNKRRLSFAIALI---------GDPSVILLDEPSTGLDPKARRHLWDIIARLRKNGKAIILTSHSMEEAEALC 765 (885) T ss_pred CCCCCCCCCCHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH T ss_conf 56547887512579999871---------698679981787668988999999999999855957999935699999986 Q ss_pred CCEEEEEECCCEEEEC Q ss_conf 2600799728968959 Q gi|254780766|r 360 ETAKFMRISNHQALCI 375 (375) Q Consensus 360 ~~~~~~~i~~g~~~~~ 375 (375) +. +-.+-+|++.|+ T Consensus 766 tR--~aImv~G~l~ci 779 (885) T KOG0059 766 TR--TAIMVIGQLRCI 779 (885) T ss_pred CC--EEEEECCEEEEE T ss_conf 24--346875779992 No 237 >PRK13542 consensus Probab=98.17 E-value=6.9e-06 Score=57.65 Aligned_cols=60 Identities=17% Similarity=0.222 Sum_probs=49.5 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCH Q ss_conf 3312205899999999999999999870899789980122015989999999997417---98099980696 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDK 352 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~ 352 (375) ...+|.||++.+.++..++ ...+|+|+|||.++||+..+..+.+.+.+. +.-++++||+. T Consensus 145 ~~~LSgGqrqRv~lA~al~---------~~p~illLDEPtagLD~~~~~~l~~~i~~~~~~g~tvIi~tH~l 207 (224) T PRK13542 145 ARTLSQGQRRRVALARLAL---------TPRALWLLDEPLTSLDDASAACFHTLLDEHLRRGGMAVVATHQL 207 (224) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCC T ss_conf 1249999999999999980---------79988997385354899999999999999996899899995887 No 238 >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein; InterPro: IPR005968 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Thiamine pyrophosphate (TPP) is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism. The model describes thiamine ABC transporter, ATP-binding protein, believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate or thiamine pyrophosphate. ; GO: 0005524 ATP binding, 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=98.17 E-value=9.9e-06 Score=56.60 Aligned_cols=78 Identities=22% Similarity=0.285 Sum_probs=59.0 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||+--++||==| - ..+||+|+|||||=|||.-|.-++..+.+. +-=+.+-||+.+-.-.+. T Consensus 128 ~LSGGQrQRVALARCl------v---r~~PIlLLDEPFSALDp~LR~EMLaLv~~lc~e~~~TllmVtH~~sda~~ia-- 196 (213) T TIGR01277 128 ELSGGQRQRVALARCL------V---REKPILLLDEPFSALDPKLREEMLALVKKLCDEKKLTLLMVTHSLSDAAAIA-- 196 (213) T ss_pred HCCCCHHHHHHHHHHH------C---CCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH-- T ss_conf 1167337899998864------1---7887300158811226788999999999765103646899845889998766-- Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +++.-|++|+|-. T Consensus 197 ~q~~vv~~G~i~~ 209 (213) T TIGR01277 197 SQVVVVEDGKIKV 209 (213) T ss_pred HEEEEEECCEEEE T ss_conf 2044422683764 No 239 >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=98.16 E-value=1.3e-05 Score=55.81 Aligned_cols=80 Identities=15% Similarity=0.255 Sum_probs=58.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|-|||.-+.+|-.|+. + -..+++++|||.+.||+..+..+++.|.++ +.=|++.||+.+... ..|. T Consensus 136 ~~LSGGq~QRv~iAraL~~-----~--~~~~lliLDEPTsgLD~~~~~~i~~~i~~l~~~G~Tvi~VsHd~~~~~-~aDr 207 (226) T cd03270 136 PTLSGGEAQRIRLATQIGS-----G--LTGVLYVLDEPSIGLHPRDNDRLIETLKRLRDLGNTVLVVEHDEDTIR-AADH 207 (226) T ss_pred CCCCHHHHHHHHHHHHHHH-----C--CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEECHHHHH-HCCE T ss_conf 8689999999999999973-----8--987168832873337989999999999999976998999972578998-4899 Q ss_pred EEEEEE------CCCEEEE Q ss_conf 007997------2896895 Q gi|254780766|r 362 AKFMRI------SNHQALC 374 (375) Q Consensus 362 ~~~~~i------~~g~~~~ 374 (375) ++.+ .+|+|.+ T Consensus 208 --iivm~~G~~~~~G~iv~ 224 (226) T cd03270 208 --VIDIGPGAGVHGGEIVA 224 (226) T ss_pred --EEEECCCCCCCCCEEEE T ss_conf --99944997556968987 No 240 >KOG0065 consensus Probab=98.15 E-value=1.8e-05 Score=54.97 Aligned_cols=64 Identities=23% Similarity=0.411 Sum_probs=43.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCH---HHHHHH Q ss_conf 2205899999999999999999870899789980122015989999999997417--98099980696---785432 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDK---SVFDSL 358 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~---~~~~~~ 358 (375) +|..|+|.+.++.-|+. +..+|++||||.|+||.+---.++..+.++ ..|.|+-|+|. ++|+.+ T Consensus 930 Ls~eQRKrLTIgVELvA--------~P~~ilFLDEPTSGLDsqaA~~i~~~lrkla~tGqtIlCTIHQPS~~ife~F 998 (1391) T KOG0065 930 LSTEQRKRLTIGVELVA--------NPSSILFLDEPTSGLDSQAAAIVMRFLRKLADTGQTILCTIHQPSIDIFEAF 998 (1391) T ss_pred CCHHHHCEEEEEEEEEC--------CCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHH T ss_conf 89778323568999832--------8755688569987745789999999999998648869998158708999987 No 241 >PRK09700 D-allose transporter ATP-binding protein; Provisional Probab=98.15 E-value=1.9e-05 Score=54.76 Aligned_cols=80 Identities=16% Similarity=0.345 Sum_probs=63.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ...+|-||+..+.++-.||. .+++|++|||.+.||+.-+..+++.+... +.=+++.+|+......+.+ T Consensus 143 ~~~LS~G~kQrv~ia~al~~---------~p~llilDEPTa~Ld~~~~~~l~~~l~~l~~~g~tii~isH~l~~v~~~~D 213 (510) T PRK09700 143 VANLSISHKQMLEIAKTLML---------DAKVIIMDEPTSSLTNKEVDYLFLIMNQLRKEGTAIVYISHKLAEIRRICD 213 (510) T ss_pred HHHCCHHHHHHHHHHHHHHH---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHCC T ss_conf 12499999999999999985---------988499878856668678999999988888728717999523677886488 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|++++ T Consensus 214 r--v~vl~~G~iv~ 225 (510) T PRK09700 214 R--YTVMKDGSSVC 225 (510) T ss_pred E--EEECCCCCEEE T ss_conf 6--99714981996 No 242 >KOG0927 consensus Probab=98.15 E-value=5.2e-06 Score=58.45 Aligned_cols=78 Identities=17% Similarity=0.204 Sum_probs=60.2 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCC-CEEEEECCHHHHHHHHCCEE Q ss_conf 31220589999999999999999987089978998012201598999999999741798-09998069678543212600 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS-QIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~-Qv~iTt~~~~~~~~~~~~~~ 363 (375) .-+|.|+++-+.||-.| ...+.+||||||..|||.....++=++|.+... -..|++++.+.++.+. ++ T Consensus 220 ~~~SgGwrmR~aLAr~L---------f~kP~LLLLDEPtnhLDleA~~wLee~L~k~d~~~lVi~sh~QDfln~vC--T~ 288 (614) T KOG0927 220 KDLSGGWRMRAALARAL---------FQKPDLLLLDEPTNHLDLEAIVWLEEYLAKYDRIILVIVSHSQDFLNGVC--TN 288 (614) T ss_pred HCCCCHHHHHHHHHHHH---------HCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHH--HH T ss_conf 13573499999999988---------34998787438756788999999999998535761899935055554675--46 Q ss_pred EEEECCCEEE Q ss_conf 7997289689 Q gi|254780766|r 364 FMRISNHQAL 373 (375) Q Consensus 364 ~~~i~~g~~~ 373 (375) |+++.+++.+ T Consensus 289 Ii~l~~kkl~ 298 (614) T KOG0927 289 IIHLDNKKLI 298 (614) T ss_pred HHEECCCCEE T ss_conf 5122356315 No 243 >PRK10419 nikE nickel transporter ATP-binding protein; Provisional Probab=98.14 E-value=2.1e-05 Score=54.51 Aligned_cols=78 Identities=22% Similarity=0.308 Sum_probs=64.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-||+.-+++|.-|+ ..+.+|+.|||.+.||+..+..+++.|.+. +.=+++-|||......+.+ T Consensus 150 ~eLSGGq~QRVaIArAL~---------~~P~lLi~DEPtsaLD~~~q~~il~ll~~l~~~~g~t~i~ITHDl~~a~~~ad 220 (266) T PRK10419 150 PQLSGGQLQRVCLARALA---------VEPKLLILDEAVSNLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQ 220 (266) T ss_pred HHCCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCC T ss_conf 337927877789866640---------69878999688653699999999999999999759899998899999999689 Q ss_pred CEEEEEECCCEEE Q ss_conf 6007997289689 Q gi|254780766|r 361 TAKFMRISNHQAL 373 (375) Q Consensus 361 ~~~~~~i~~g~~~ 373 (375) . +.-+.+|+|. T Consensus 221 r--i~Vm~~G~iV 231 (266) T PRK10419 221 R--VMVMDNGQIV 231 (266) T ss_pred E--EEEEECCEEE T ss_conf 8--9999898899 No 244 >TIGR02673 FtsE cell division ATP-binding protein FtsE; InterPro: IPR005286 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division. Probab=98.13 E-value=1.3e-05 Score=55.78 Aligned_cols=77 Identities=17% Similarity=0.343 Sum_probs=63.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|.|||=-+++|= ...+.+|+||-|||--.||+..-+.|+..+++. +.=|+|+|||.++.+... . T Consensus 136 ~~LSGGEQQRvaIAR---------Aiv~~P~lLLADEPTGNLD~~~~~~iL~ll~~~n~~GtTV~vATHD~~L~~~~P-~ 205 (215) T TIGR02673 136 EQLSGGEQQRVAIAR---------AIVNSPELLLADEPTGNLDPALSERILDLLKELNKRGTTVIVATHDLELVERVP-A 205 (215) T ss_pred CCCCCCHHHHHHHHH---------HHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHCCC-C T ss_conf 100472578888876---------530489679877889996876789999999998418987999807879984378-9 Q ss_pred EEEEEECCCE Q ss_conf 0079972896 Q gi|254780766|r 362 AKFMRISNHQ 371 (375) Q Consensus 362 ~~~~~i~~g~ 371 (375) ..+.++++|+ T Consensus 206 ~R~~~L~~G~ 215 (215) T TIGR02673 206 HRVLILDDGR 215 (215) T ss_pred CCEEEECCCC T ss_conf 9778735879 No 245 >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Probab=98.12 E-value=6.2e-06 Score=57.92 Aligned_cols=34 Identities=29% Similarity=0.467 Sum_probs=26.0 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 32545536732798-79998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -+-+++.++++.+| +..|+|+|||||||++-+|. T Consensus 16 ~~~L~~vsl~i~~Ge~~~LvG~NGaGKSTL~k~l~ 50 (490) T PRK10938 16 TKTLQLPSLTLNAGDSWAFVGSNGSGKSALARALA 50 (490) T ss_pred EEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 88893159899899899999799977999999995 No 246 >PRK10261 glutathione transporter ATP-binding protein; Provisional Probab=98.10 E-value=1.7e-05 Score=55.02 Aligned_cols=78 Identities=18% Similarity=0.256 Sum_probs=64.2 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||+..+++|-.|| ....+|++|||.+.||...+..+++.|.++ +.=+++-|||-.....+.+. T Consensus 463 eLSGGqrQRv~IAraL~---------~~P~lLI~DEPTs~LDv~~qa~il~Ll~~L~~~~g~til~IsHDl~~v~~~adr 533 (623) T PRK10261 463 EFSGGQRQRICIARALA---------LNPKVIIADEAVSALDVSIRGQIINLLLDLQRDFGIAYLFISHDMAVVERISHR 533 (623) T ss_pred HCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEECCCHHHHHHHCCE T ss_conf 18999999999999999---------699999996886667999999999999999997298999986899999986999 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+.+|+|.- T Consensus 534 --v~Vm~~G~iVe 544 (623) T PRK10261 534 --VAVMYLGQIVE 544 (623) T ss_pred --EEEEECCEEEE T ss_conf --99998988999 No 247 >cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=98.08 E-value=3.7e-05 Score=52.86 Aligned_cols=74 Identities=15% Similarity=0.200 Sum_probs=53.1 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHH-----HHHHHCCCCEEEEECCHHHHHHHHC Q ss_conf 12205899999999999999999870899789980122015989999999-----9974179809998069678543212 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALF-----RIVTDIGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll-----~~l~~~~~Qv~iTt~~~~~~~~~~~ 360 (375) .+|.||+..+.+|-.|+ ..++|+|+|||.|.||+.....++ +++.+.+.=|++.||+...+.. .| T Consensus 140 ~LSGGQ~QRi~iARal~---------~~~~illlDEptsaLD~~~~~~i~~~~i~~~~~~~~~TvI~itH~l~~l~~-aD 209 (218) T cd03290 140 NLSGGQRQRICVARALY---------QNTNIVFLDDPFSALDIHLSDHLMQEGILKFLQDDKRTLVLVTHKLQYLPH-AD 209 (218) T ss_pred CCCHHHHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHH-CC T ss_conf 77989999999999984---------489999998965578867899999999999970799399999069889983-99 Q ss_pred CEEEEEECCCE Q ss_conf 60079972896 Q gi|254780766|r 361 TAKFMRISNHQ 371 (375) Q Consensus 361 ~~~~~~i~~g~ 371 (375) +++.+++|. T Consensus 210 --~Iivm~~G~ 218 (218) T cd03290 210 --WIIAMKDGS 218 (218) T ss_pred --EEEEECCCC T ss_conf --999985999 No 248 >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Probab=98.07 E-value=3.6e-05 Score=52.93 Aligned_cols=78 Identities=22% Similarity=0.292 Sum_probs=59.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||.--.+|+--| ....||+|+|||||-|||..+.-++..+.+. +.-+.+-||+++....+.+. T Consensus 129 ~LSGGqRQRvALARcl---------vR~~PilLLDEPFsALdP~LR~eMl~Lv~~l~~E~~~TllmVTH~~~Da~~ia~~ 199 (231) T COG3840 129 ELSGGQRQRVALARCL---------VREQPILLLDEPFSALDPALRAEMLALVSQLCDERKMTLLMVTHHPEDAARIADR 199 (231) T ss_pred CCCCHHHHHHHHHHHH---------HCCCCEEEECCCHHHCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHC T ss_conf 2474077899999988---------0268757754811331978899999999999884287799995788899976520 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +..+.+|+|-. T Consensus 200 --~~~l~~Gri~~ 210 (231) T COG3840 200 --VVFLDNGRIAA 210 (231) T ss_pred --EEEEECCEEEE T ss_conf --69985777876 No 249 >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Probab=98.06 E-value=2.7e-05 Score=53.78 Aligned_cols=78 Identities=17% Similarity=0.286 Sum_probs=64.7 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||+.-+.+|..|+ ....+|++|||.+.||...+..+++.|.+. +.=+++.|||......+.+. T Consensus 161 eLSGGq~QRV~IArAL~---------~~P~lLI~DEPTsaLDv~~q~~Il~ll~~l~~e~g~til~ITHDl~~v~~~~Dr 231 (330) T PRK09473 161 EFSGGMRQRVMIAMALL---------CRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDK 231 (330) T ss_pred HCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCE T ss_conf 33988999999999997---------099999973875547999999999999999997499479982889999986998 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+-.|+|.- T Consensus 232 --I~VMy~G~iVE 242 (330) T PRK09473 232 --VLVMYAGRTME 242 (330) T ss_pred --EEEEECCEEEE T ss_conf --99998988999 No 250 >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Probab=98.04 E-value=2.6e-05 Score=53.88 Aligned_cols=81 Identities=19% Similarity=0.229 Sum_probs=66.5 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCE Q ss_conf 23312205899999999999999999870899789980122015989999999997417980999806967854321260 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~ 362 (375) +.+-+|-||++-+.||-.|. ..+-|||+|||..|||...+.++-++|...+.=|++.+||-..++..... T Consensus 150 ~~~~LSGG~r~Rv~LA~aL~---------~~pDlLLLDEPTNHLD~~~i~WLe~~L~~~~gtviiVSHDR~FLd~V~t~- 219 (530) T COG0488 150 PVSSLSGGWRRRVALARALL---------EEPDLLLLDEPTNHLDLESIEWLEDYLKRYPGTVIVVSHDRYFLDNVATH- 219 (530) T ss_pred CHHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHH- T ss_conf 54435988999999999873---------49997887498864588899999999986899489996898999998635- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++++.|++.. T Consensus 220 -I~~ld~g~l~~ 230 (530) T COG0488 220 -ILELDRGKLTP 230 (530) T ss_pred -EEEECCCCEEE T ss_conf -07831881367 No 251 >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=98.04 E-value=4e-05 Score=52.64 Aligned_cols=79 Identities=24% Similarity=0.233 Sum_probs=60.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHH----HCCCCEEEEECCHHHHHHHHC Q ss_conf 3122058999999999999999998708997899801220159899999999974----179809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT----DIGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~----~~~~Qv~iTt~~~~~~~~~~~ 360 (375) .++|-||+..++||-.|| -++++||+|||++-||...+..+-..|. ..+.-+.+.|||..-.-.+.+ T Consensus 136 ~qLSGGQrQRVALARALA---------~eP~vLLLDEPf~ALDa~vr~~lr~wLr~~~~~~~~ttvfVTHD~eea~~lad 206 (345) T COG1118 136 AQLSGGQRQRVALARALA---------VEPKVLLLDEPFGALDAKVRKELRRWLRKLHDRLGVTTVFVTHDQEEALELAD 206 (345) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCC T ss_conf 212717889999998753---------49986863587214519999999999999998609639999589999986416 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++.+++|+|-- T Consensus 207 r--vvvl~~G~Ieq 218 (345) T COG1118 207 R--VVVLNQGRIEQ 218 (345) T ss_pred E--EEEECCCEEEE T ss_conf 5--99952880553 No 252 >TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=98.04 E-value=1e-05 Score=56.51 Aligned_cols=63 Identities=29% Similarity=0.347 Sum_probs=52.4 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHH Q ss_conf 23312205899999999999999999870899789980122015989999999997417---9809998069678 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSV 354 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~ 354 (375) +...+|-||+|-+++|=.+| .++=++|||||.|.|||.-+..++..|..+ +.-|+|+|||-++ T Consensus 124 p~h~LS~GekkRvAIAGAvA---------M~Pd~l~LDEPTAGLDp~G~~q~~~~l~~L~~~G~tvv~STHDvdL 189 (190) T TIGR01166 124 PTHLLSGGEKKRVAIAGAVA---------MRPDVLLLDEPTAGLDPAGAEQLLAILRRLRAEGTTVVISTHDVDL 189 (190) T ss_pred CHHHCCCCCHHHHHHHHHHH---------HCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCC T ss_conf 24115586135777775886---------1663466427888978747999999988787239989997253201 No 253 >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Probab=98.02 E-value=4.9e-05 Score=52.09 Aligned_cols=80 Identities=18% Similarity=0.225 Sum_probs=58.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC-----CCCEEEEECCHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417-----98099980696785432 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI-----GSQIFMTGTDKSVFDSL 358 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~-----~~Qv~iTt~~~~~~~~~ 358 (375) ...+|+||||.+.++-- ....+.+|++|||++.||...+..++++|.+. .-|+++-||+.+-... T Consensus 169 ~~~LS~Ge~rrvLiaRA---------Lv~~P~LLiLDEP~~GLDl~~re~ll~~l~~~~~~~~~~~ll~VtHh~eEi~~- 238 (257) T COG1119 169 FGSLSQGEQRRVLIARA---------LVKDPELLILDEPAQGLDLIAREQLLNRLEELAASPGAPALLFVTHHAEEIPP- 238 (257) T ss_pred HHHCCHHHHHHHHHHHH---------HHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHCCC- T ss_conf 44418767899999999---------86299779854865557768899999999998357998659999746444464- Q ss_pred HCCEEEEEECCCEEEE Q ss_conf 1260079972896895 Q gi|254780766|r 359 NETAKFMRISNHQALC 374 (375) Q Consensus 359 ~~~~~~~~i~~g~~~~ 374 (375) .-+.+..+.+|++.. T Consensus 239 -~~th~lll~~g~v~~ 253 (257) T COG1119 239 -CFTHRLLLKEGEVVA 253 (257) T ss_pred -CCCEEEEEECCEEEE T ss_conf -104589961780452 No 254 >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Probab=98.00 E-value=4e-05 Score=52.68 Aligned_cols=77 Identities=19% Similarity=0.278 Sum_probs=61.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC--CCEEEEECCHHHHHHHHCCE Q ss_conf 3122058999999999999999998708997899801220159899999999974179--80999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG--SQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~--~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+-.+++|-.| ..+++|||+||+.|+||+.....+.+.|.+.. .=+|+-+|....+... - T Consensus 608 ~~LSGGQrQrlalARaL---------l~~P~ILlLDEaTSaLD~~sE~~I~~~L~~~~~~~T~I~IaHRl~ti~~a---d 675 (709) T COG2274 608 ANLSGGQRQRLALARAL---------LSKPKILLLDEATSALDPETEAIILQNLLQILQGRTVIIIAHRLSTIRSA---D 675 (709) T ss_pred CCCCHHHHHHHHHHHHH---------CCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHC---C T ss_conf 88888899999999985---------46999899707422369867999999999984588699997661686402---5 Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) +++-+++|++. T Consensus 676 rIiVl~~Gkiv 686 (709) T COG2274 676 RIIVLDQGKIV 686 (709) T ss_pred EEEECCCCCEE T ss_conf 79981699360 No 255 >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Probab=97.99 E-value=7.1e-05 Score=51.03 Aligned_cols=78 Identities=17% Similarity=0.223 Sum_probs=63.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||+.-+++|.-|+ ....+|++|||.+-||+..+..+++.|.++ +.=+++.|||......+.+. T Consensus 154 eLSGGq~QRv~IArAL~---------~~P~lLi~DEPTsaLD~~~q~~Il~ll~~l~~~~~~t~l~ITHDl~~v~~iaDr 224 (327) T PRK11308 154 MFSGGQRQRIAIARALM---------LDPDVVVADEPVSALDVSVQAQVLNLMMDLQQELGLSYVFISHDLSVVEHIADD 224 (327) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 47999999999999984---------289899984786546999999999999999970097699986989999986998 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+..|+|.- T Consensus 225 --i~VMy~G~IVE 235 (327) T PRK11308 225 --VMVMYLGRCVE 235 (327) T ss_pred --EEEEECCEEEE T ss_conf --99998988999 No 256 >PRK04863 mukB cell division protein MukB; Provisional Probab=97.97 E-value=6.5e-05 Score=51.28 Aligned_cols=51 Identities=24% Similarity=0.361 Sum_probs=47.3 Q ss_pred CCCCEEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHC Q ss_conf 988518999999223254553673279879998689986444899999972 Q gi|254780766|r 1 MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLS 51 (375) Q Consensus 1 ~~~~M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~ 51 (375) |..|=++.+|++.|+-.|---+++++.-+|-+.|.|||||||++-|-.+.+ T Consensus 1 m~~rgk~rSLtLVNwNGffARTfdLd~lVttLsGgNGAGKSTtMaAf~taL 51 (1486) T PRK04863 1 MIERGKFRSLTLVNWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTAL 51 (1486) T ss_pred CCCCCCCCEEEEEEECCEEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHH T ss_conf 975554232467634353101310244203300588865798999999996 No 257 >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Probab=97.95 E-value=0.00011 Score=49.76 Aligned_cols=77 Identities=26% Similarity=0.360 Sum_probs=56.2 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHCC Q ss_conf 1220589999999999999999987089978998012201598999999999741----798099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||+-.+++|--|. ..+||+++||+.|.||++.-+.+.+.+.+ .+.=+|+-+|.... +.+- T Consensus 449 ~LSGGQrQRiaIARAll---------~~p~ILILDEaTSaLD~~te~~i~~~l~~~~~~~grT~IvIaHRLst---i~~a 516 (547) T PRK10522 449 KLSKGQKKRLALLLALA---------EERDILLLDEWAADQDPHFRREFYQVLLPLLQEMGKTIFAISHDDHY---FIHA 516 (547) T ss_pred CCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHH---HHHC T ss_conf 62999999999999997---------49999999685557899999999999999987069899998248899---9819 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) -+++-+++|+|.- T Consensus 517 D~IiVl~~G~IvE 529 (547) T PRK10522 517 DRLLEMRNGQLSE 529 (547) T ss_pred CEEEEEECCEEEE T ss_conf 9899998999998 No 258 >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Probab=97.94 E-value=6.9e-05 Score=51.11 Aligned_cols=78 Identities=27% Similarity=0.279 Sum_probs=57.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||--+.++--|| ..+||+||||||+-|||..|..+-+.+.+ ++.-+++-|||-+---.+.+ T Consensus 134 ~eLSGGQQQRVGv~RALA---------adP~ilLMDEPFgALDpI~R~~lQ~e~~~lq~~l~kTivfVTHDidEA~kLad 204 (309) T COG1125 134 HELSGGQQQRVGVARALA---------ADPPILLMDEPFGALDPITRKQLQEEIKELQKELGKTIVFVTHDIDEALKLAD 204 (309) T ss_pred HHCCCCHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHC T ss_conf 221862135888999974---------19886863488554476549999999999999859879999357889886432 Q ss_pred CEEEEEECCCEEE Q ss_conf 6007997289689 Q gi|254780766|r 361 TAKFMRISNHQAL 373 (375) Q Consensus 361 ~~~~~~i~~g~~~ 373 (375) . +.-+.+|++. T Consensus 205 r--i~vm~~G~i~ 215 (309) T COG1125 205 R--IAVMDAGEIV 215 (309) T ss_pred E--EEEECCCEEE T ss_conf 4--8985187289 No 259 >KOG0933 consensus Probab=97.94 E-value=0.00065 Score=44.75 Aligned_cols=72 Identities=25% Similarity=0.440 Sum_probs=60.3 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHH Q ss_conf 23312205899999999999999999870899789980122015989999999997417--980999806967854321 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~ 359 (375) +.+=+|.||..+++|+|+||-+.| ...|+.++|||.|-||-.+-..+=.+|..- +.|+||-+...-.|++-+ T Consensus 1079 SL~ELSGGQRSLVALsLIlamL~f-----kPAPlYILDEVDAALDLSHTQNIG~mIkthF~~sQFIVVSLKeGMF~NAN 1152 (1174) T KOG0933 1079 SLSELSGGQRSLVALSLILAMLKF-----KPAPLYILDEVDAALDLSHTQNIGRMIKTHFTHSQFIVVSLKEGMFNNAN 1152 (1174) T ss_pred HHHHHCCCHHHHHHHHHHHHHHCC-----CCCCEEEHHHHHHHHCCHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCH T ss_conf 787705740779999999999817-----99751102346776333522127899983278872899973000000431 No 260 >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Probab=97.93 E-value=3.5e-05 Score=53.01 Aligned_cols=32 Identities=25% Similarity=0.413 Sum_probs=26.4 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHH Q ss_conf 4553673279-8799986899864448999999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~ 49 (375) +++.++...+ .+++|+|+|||||||+|-+|.= T Consensus 18 l~~ls~~i~~G~i~~iiGpNG~GKSTLLk~l~~ 50 (258) T COG1120 18 LDDLSFSIPKGEITGILGPNGSGKSTLLKCLAG 50 (258) T ss_pred EECCEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 722368865997999989988899999999865 No 261 >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. Probab=97.92 E-value=4.9e-05 Score=52.05 Aligned_cols=66 Identities=23% Similarity=0.346 Sum_probs=52.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||.-+++|-.|+ ..+.|+|.|||.+.||+.....+++.|.+. +.=+++.|||.... ...+ T Consensus 133 ~~LSGGe~QRVAIARAL~---------~~P~illaDEPT~~LD~~~~~~i~~ll~~l~~~g~tii~vTHd~~~a-~~~D 201 (206) T TIGR03608 133 YELSGGEQQRVALARAIL---------KPSELILADEPTGSLDPKNRDEVLDLLLELNDEGKTIIIVTHDPEVA-EQAD 201 (206) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHH-HHCC T ss_conf 444869999999999982---------49999996399877899999999999999986799999989878999-8699 No 262 >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits this transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L. lactis functionally complements an Escherichia coli proU mutant. The complementing locus is similar to a opuA locus in Bacillus subtlis. This clarifies the differences in nomenclature.; GO: 0005524 ATP binding, 0015171 amino acid transmembrane transporter activity, 0006865 amino acid transport, 0016020 membrane. Probab=97.91 E-value=2.3e-05 Score=54.22 Aligned_cols=78 Identities=23% Similarity=0.237 Sum_probs=60.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC-----CCCEEEEECCHHHHHHHHC Q ss_conf 12205899999999999999999870899789980122015989999999997417-----9809998069678543212 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI-----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~-----~~Qv~iTt~~~~~~~~~~~ 360 (375) .+|-|||--+.++=-|| ..+||+||||+||=|||--|..+=+.|.++ +.=|||| ||.+--=.+.| T Consensus 130 eLSGG~qQRvGl~RALa---------~~PdilLMDEaFsALDPliR~~lQdEl~kLq~~~~kTIvFit-HDlDEA~rigD 199 (372) T TIGR01186 130 ELSGGMQQRVGLARALA---------AEPDILLMDEAFSALDPLIRDSLQDELKKLQATLQKTIVFIT-HDLDEALRIGD 199 (372) T ss_pred CCCCCCCHHHHHHHHHH---------CCCCEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEE-CCHHHHHHHHH T ss_conf 01487305899999874---------387805404764335710016788999999986098089994-17678876751 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) . +.-+++|+|.-| T Consensus 200 R--Ivilk~GeiVQv 212 (372) T TIGR01186 200 R--IVILKAGEIVQV 212 (372) T ss_pred H--HHHEECCCEEEE T ss_conf 3--201106867884 No 263 >PRK13539 cytochrome c biogenesis protein CcmA; Provisional Probab=97.89 E-value=2.1e-05 Score=54.50 Aligned_cols=39 Identities=23% Similarity=0.365 Sum_probs=31.8 Q ss_pred EEEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 9992232545536732798-79998689986444899999 Q gi|254780766|r 10 LNISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 10 l~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ....+..-+++.++.+.+| +++|+|+|||||||+|.+|. T Consensus 10 ~~~g~~~il~~vsf~i~~Gei~~l~G~NGaGKTTLlk~i~ 49 (206) T PRK13539 10 CVRGGRVVFSGLSFTLAAGEALVLTGPNGSGKTTLLRLLA 49 (206) T ss_pred EEECCEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9999999981507898699499998999998999999995 No 264 >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=97.88 E-value=0.0001 Score=49.97 Aligned_cols=75 Identities=21% Similarity=0.355 Sum_probs=57.9 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) ..-+|-||+..+.+|--|| ..+.++|+|||++.+|+..+..+.+.|.+. +.=|++.+||........+ T Consensus 137 i~~LSGGQ~QRV~lARAL~---------~~p~lllLDEP~~gvD~~~~~~i~~lL~~l~~eg~tIl~vtHDL~~v~~~~D 207 (254) T COG1121 137 IGELSGGQKQRVLLARALA---------QNPDLLLLDEPFTGVDVAGQKEIYDLLKELRQEGKTVLMVTHDLGLVMAYFD 207 (254) T ss_pred CCCCCCHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHCC T ss_conf 5546727999999999853---------6999899668754579878999999999998789889999588177685388 Q ss_pred CEEEEEECC Q ss_conf 600799728 Q gi|254780766|r 361 TAKFMRISN 369 (375) Q Consensus 361 ~~~~~~i~~ 369 (375) . ++.++. T Consensus 208 ~--vi~Ln~ 214 (254) T COG1121 208 R--VICLNR 214 (254) T ss_pred E--EEEECC T ss_conf 7--999857 No 265 >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Probab=97.88 E-value=9.3e-05 Score=50.27 Aligned_cols=77 Identities=19% Similarity=0.339 Sum_probs=60.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-|||..+++|-.|+ +.++|+|-|||-+.||..+-+.+++.+.+. +.=+++.|||+.+.. ..+ T Consensus 141 ~~LSGGqqQRVAIARAL~---------~~P~iilADEPTgnLD~~t~~~V~~ll~~~~~~~g~tii~VTHD~~lA~-~~d 210 (226) T COG1136 141 SELSGGQQQRVAIARALI---------NNPKIILADEPTGNLDSKTAKEVLELLRELNKERGKTIIMVTHDPELAK-YAD 210 (226) T ss_pred HHCCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHH-HCC T ss_conf 226979999999999982---------4998699607666588678999999999998746989999908989997-489 Q ss_pred CEEEEEECCCEEE Q ss_conf 6007997289689 Q gi|254780766|r 361 TAKFMRISNHQAL 373 (375) Q Consensus 361 ~~~~~~i~~g~~~ 373 (375) . ++.+.+|++. T Consensus 211 r--~i~l~dG~~~ 221 (226) T COG1136 211 R--VIELKDGKIE 221 (226) T ss_pred E--EEEEECCEEE T ss_conf 8--9998489163 No 266 >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Probab=97.86 E-value=0.0001 Score=50.04 Aligned_cols=79 Identities=23% Similarity=0.214 Sum_probs=62.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHH---HHHHHHHHHHCCCCEEEEECCHHHHHHHHCC Q ss_conf 3122058999999999999999998708997899801220159899---9999999741798099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDK---RNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~---~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|-||.|-+=+|-.||. .+..+|+|||||..||.- ++.++..|.+.+.-|.||.|+-.-.=++.+. T Consensus 138 ~sLSGGERRR~EIARaLa~---------~P~fiLLDEPFAGVDPiaV~dIq~iI~~L~~rgiGvLITDHNVREtL~i~dR 208 (243) T COG1137 138 YSLSGGERRRVEIARALAA---------NPKFILLDEPFAGVDPIAVIDIQRIIKHLKDRGIGVLITDHNVRETLDICDR 208 (243) T ss_pred CCCCCCHHHHHHHHHHHHC---------CCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHE T ss_conf 5566514789999999863---------9978994687568994029999999999986796599716638888732004 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) .|-|.+|++++ T Consensus 209 --aYIi~~G~vla 219 (243) T COG1137 209 --AYIISDGKVLA 219 (243) T ss_pred --EEEEECCEEEE T ss_conf --89986575884 No 267 >KOG0055 consensus Probab=97.85 E-value=0.00033 Score=46.65 Aligned_cols=77 Identities=17% Similarity=0.280 Sum_probs=57.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .++|-||+.-+++|--|. ..++|||+||+-|-||+...+-+-+.|.+. +--+++-+|.. +.+.+-- T Consensus 488 ~qLSGGQKQRIAIARAli---------~~P~ILLLDEaTSALD~~se~iVQ~ALd~a~~GrTTivVaHRL---StIrnaD 555 (1228) T KOG0055 488 VQLSGGQKQRIAIARALV---------RNPKILLLDEATSALDAESERVVQEALDKASKGRTTIVVAHRL---STIRNAD 555 (1228) T ss_pred CCCCHHHHHHHHHHHHHH---------HCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEEEH---HHHHCCC T ss_conf 777728999999999997---------1898888607411068788999999999974498699996124---6664468 Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) +++-+++|+|. T Consensus 556 ~I~v~~~G~Iv 566 (1228) T KOG0055 556 KIAVMEEGKIV 566 (1228) T ss_pred EEEEEECCEEE T ss_conf 79999888788 No 268 >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Probab=97.81 E-value=0.00022 Score=47.83 Aligned_cols=77 Identities=19% Similarity=0.283 Sum_probs=61.4 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||+--+.+|-.|| ..+-+++.||+.|-||+.-+..+++.|.++ +.=.++-+||......+.+. T Consensus 429 elSGGQrQRvaIARALa---------~~P~lli~DEp~SaLDvsvqa~VlnLl~~lq~e~g~t~lfISHDl~vV~~i~dr 499 (539) T COG1123 429 ELSGGQRQRVAIARALA---------LEPKLLILDEPVSALDVSVQAQVLNLLKDLQEELGLTYLFISHDLAVVRYIADR 499 (539) T ss_pred CCCCCHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHCCE T ss_conf 03852567899999985---------499899964874322789999999999999997498899995878999863866 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +.-+..|+|. T Consensus 500 --v~vm~~G~iV 509 (539) T COG1123 500 --VAVMYDGRIV 509 (539) T ss_pred --EEEEECCEEE T ss_conf --8999788377 No 269 >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] Probab=97.80 E-value=0.00046 Score=45.74 Aligned_cols=67 Identities=16% Similarity=0.203 Sum_probs=53.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHH-HCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHH Q ss_conf 3122058999999999999999998-70899789980122015989999999997417---980999806967 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISN-TTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKS 353 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~-~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~ 353 (375) .-+|.|+.+.++++++||.++ +. ......++.+|||.+-+|..++......+... ..||||-||+.- T Consensus 528 n~LSEGekt~iaf~yflakLk--enpd~~k~kvvViDDPisSfDsn~lf~~~~~v~~~~t~~kQviVLtHntY 598 (758) T COG4694 528 NTLSEGEKTFIAFLYFLAKLK--ENPDISKNKVVVIDDPISSFDSNILFRVSVLVKEEKTNIKQVIVLTHNTY 598 (758) T ss_pred CCCCCCHHHHHHHHHHHHHHH--HCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEEECCCE T ss_conf 313565045789999999987--47654348069966874323124899999999999736517999953632 No 270 >TIGR00955 3a01204 Pigment precourser permease; InterPro: IPR005284 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family includes different parts of a membrane-spanning permease system necessary for the transport of pigment precursor into pigment cells responsible for eye color. White protein dimerises with brown protein for the transport of guanine and with scarlet protein for the transport of tryptophan.; GO: 0006810 transport. Probab=97.80 E-value=9.1e-05 Score=50.31 Aligned_cols=76 Identities=16% Similarity=0.233 Sum_probs=60.2 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCH---HHHHHHHC Q ss_conf 12205899999999999999999870899789980122015989999999997417--98099980696---78543212 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDK---SVFDSLNE 360 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~---~~~~~~~~ 360 (375) =+|-||+|-+++|. +....+|||+.|||-|.||.---..+++.|+++ +..++|.|+|. ++|.-+ T Consensus 175 GlSGGErKRLafA~---------E~ltdP~~LFcDEPTSGLDSfmA~~Vv~~L~~LA~~G~tiI~tIHQPSs~lF~lF-- 243 (671) T TIGR00955 175 GLSGGERKRLAFAS---------ELLTDPIILFCDEPTSGLDSFMAYSVVQVLKGLAQKGKTIICTIHQPSSELFELF-- 243 (671) T ss_pred EECCCHHHHHHHHH---------HHHHCCCEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHH-- T ss_conf 52011367899887---------8871894265038895345999999999999985089799998305618898511-- Q ss_pred CEEEEEECCCEEE Q ss_conf 6007997289689 Q gi|254780766|r 361 TAKFMRISNHQAL 373 (375) Q Consensus 361 ~~~~~~i~~g~~~ 373 (375) -++.-+..|++. T Consensus 244 -d~i~lla~Grvv 255 (671) T TIGR00955 244 -DKIILLAEGRVV 255 (671) T ss_pred -CCEEEEECCEEE T ss_conf -716775277279 No 271 >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=97.79 E-value=0.00022 Score=47.82 Aligned_cols=78 Identities=17% Similarity=0.241 Sum_probs=57.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) -+|-||..-++++-- .....+++|+|||.||||.+.-+.+++.|.+. ..=|++-||....... --+ T Consensus 456 ~LSgGQ~QRlaLARA---------ll~~~~l~llDEpTA~LD~etE~~i~~~l~~l~~~ktvl~itHrl~~~~~---~D~ 523 (559) T COG4988 456 GLSGGQAQRLALARA---------LLSPASLLLLDEPTAHLDAETEQIILQALQELAKQKTVLVITHRLEDAAD---ADR 523 (559) T ss_pred CCCHHHHHHHHHHHH---------HCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHC---CCE T ss_conf 778999999999998---------55888889854875679876799999999999727869999767377854---998 Q ss_pred EEEECCCEEEEC Q ss_conf 799728968959 Q gi|254780766|r 364 FMRISNHQALCI 375 (375) Q Consensus 364 ~~~i~~g~~~~~ 375 (375) ++.+++|++.|. T Consensus 524 I~vld~G~l~~~ 535 (559) T COG4988 524 IVVLDNGRLVEQ 535 (559) T ss_pred EEEECCCCEECC T ss_conf 999648833225 No 272 >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Probab=97.78 E-value=5.1e-05 Score=51.96 Aligned_cols=48 Identities=21% Similarity=0.416 Sum_probs=36.0 Q ss_pred CCCCEEEEEEEEE--CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 9885189999992--232545536732798-79998689986444899999 Q gi|254780766|r 1 MTNRIKIKFLNIS--EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 1 ~~~~M~i~~l~i~--nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) |++=..++.|+.. +..-+++.++++.+| +..|+|+|||||||++.+|. T Consensus 1 Ms~~l~v~nls~~yg~~~vL~~vs~~i~~Gei~~LiGpNGaGKSTLlk~I~ 51 (251) T PRK09544 1 MTSLVSLENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVL 51 (251) T ss_pred CCCEEEEEEEEEEECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 984599960899999999996307898799799999899988999999996 No 273 >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Probab=97.77 E-value=0.00025 Score=47.47 Aligned_cols=79 Identities=19% Similarity=0.268 Sum_probs=58.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHH-HHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417--98099980696785-432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVF-DSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~-~~~~~~ 361 (375) .++|-|||--+++|--|| -.+.++|.|||.|-|||+...-+++.+.++ ...+.+-.|+.--| ....+. T Consensus 135 ~qLSGGQqQRVAIARALa---------M~P~vmLFDEPTSALDPElv~EVL~vm~~LA~eGmTMivVTHEM~FAr~Vadr 205 (240) T COG1126 135 AQLSGGQQQRVAIARALA---------MDPKVMLFDEPTSALDPELVGEVLDVMKDLAEEGMTMIIVTHEMGFAREVADR 205 (240) T ss_pred CCCCCHHHHHHHHHHHHC---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHHE T ss_conf 104807889999999871---------79988863697543798899999999999997698699995036799986222 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|.++. T Consensus 206 --viFmd~G~iie 216 (240) T COG1126 206 --VIFMDQGKIIE 216 (240) T ss_pred --EEEEECCEEEE T ss_conf --89952888987 No 274 >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Probab=97.77 E-value=0.00021 Score=47.98 Aligned_cols=78 Identities=22% Similarity=0.400 Sum_probs=63.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) +.+|-|||--+.+|- ...+++++||-|||...|||.....+++.+.+. +.-|+|+|||..+.+... T Consensus 136 ~~LSGGEQQRvaIAR---------AiV~~P~vLlADEPTGNLDp~~s~~im~lfeeinr~GtTVl~ATHd~~lv~~~~-- 204 (223) T COG2884 136 SQLSGGEQQRVAIAR---------AIVNQPAVLLADEPTGNLDPDLSWEIMRLFEEINRLGTTVLMATHDLELVNRMR-- 204 (223) T ss_pred CCCCCHHHHHHHHHH---------HHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHCC-- T ss_conf 015823788999999---------981698768604887888858899999999998644857999716099997535-- Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) ..+..+++|++. T Consensus 205 ~rvl~l~~Grl~ 216 (223) T COG2884 205 HRVLALEDGRLV 216 (223) T ss_pred CCEEEEECCEEE T ss_conf 747997477797 No 275 >KOG0018 consensus Probab=97.77 E-value=6.5e-05 Score=51.27 Aligned_cols=70 Identities=21% Similarity=0.335 Sum_probs=60.8 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHH Q ss_conf 331220589999999999999999987089978998012201598999999999741798099980696785432 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~ 358 (375) ..++|.||+-+.+|||.+|- -.....|.+.+|||.|-||..+..++..|+...+.|+|+-+.....|+.- T Consensus 1049 M~~LSGGEKTvAaLALLFai-----Hsy~PaPFFvlDEiDAALDntNi~kvasyIr~~~~Q~IVISLK~~fy~ka 1118 (1141) T KOG0018 1049 MDNLSGGEKTVAALALLFAI-----HSYKPAPFFVLDEIDAALDNTNIGKVASYIRSSNFQFIVISLKEEFYQKA 1118 (1141) T ss_pred HHHCCCCHHHHHHHHHHHHH-----CCCCCCCCEEHHHHHHHHHHCCHHHHHHHHHCCCCEEEEEECCHHHHHHH T ss_conf 44237627999999999996-----05799873012157777500148999999855896499996408776300 No 276 >PRK13409 putative ATPase RIL; Provisional Probab=97.75 E-value=0.00022 Score=47.83 Aligned_cols=78 Identities=24% Similarity=0.250 Sum_probs=60.9 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHH Q ss_conf 331220589999999999999999987089978998012201598999999999741----7980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~ 359 (375) ..-+|-||+.-++||..|+ ....++|+|||.+|||-+-|-.+...|.. .+.-+|+-+||-...+.+. T Consensus 451 v~~LSGGEkQRvaLA~~L~---------~~anvLLLDEPTn~LDvE~R~~~~k~i~~~~~~~~~t~~vV~HD~~~~d~ls 521 (590) T PRK13409 451 VKDLSGGELQRVAIAACLS---------RDADLYLLDEPSAYLDVEQRLAVARAIRRIAEEKEKAALVVDHDIYMIDYIS 521 (590) T ss_pred HHHCCHHHHHHHHHHHHHC---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHC T ss_conf 2440989999999999866---------7999999948988778899999999999999866975999947099998761 Q ss_pred CCEEEEEECCC Q ss_conf 26007997289 Q gi|254780766|r 360 ETAKFMRISNH 370 (375) Q Consensus 360 ~~~~~~~i~~g 370 (375) +..-+|.=+-| T Consensus 522 drv~vf~G~p~ 532 (590) T PRK13409 522 DRLMVFEGEPG 532 (590) T ss_pred CEEEEECCCCC T ss_conf 66999817887 No 277 >PRK10261 glutathione transporter ATP-binding protein; Provisional Probab=97.75 E-value=0.00033 Score=46.67 Aligned_cols=78 Identities=15% Similarity=0.280 Sum_probs=61.2 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||+..+.+|..|| ....+|++|||.+.||+..+..+++.+... +.=+++.||+......+.+. T Consensus 168 ~LSGGqrQRV~IA~ALa---------~~P~lLIlDEPTs~LD~~~~~~il~ll~~L~~e~g~tvl~ItHdl~~v~~~aDr 238 (623) T PRK10261 168 QLSGGMRQRVMIAMALS---------CRPAVLIADEPTTALDVTIQAQILQLIKVLQKEMSMGVIFITHDMGVVAEIADR 238 (623) T ss_pred HCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCHHHHHCCCCE T ss_conf 13699999999999874---------188658855774343689999999999999887523520553778998524774 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) +.-+.+|+++. T Consensus 239 --v~Vm~~G~ive 249 (623) T PRK10261 239 --VLVMYQGEAVE 249 (623) T ss_pred --EEEEECCEEEE T ss_conf --79976887898 No 278 >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.72 E-value=0.00025 Score=47.44 Aligned_cols=78 Identities=23% Similarity=0.366 Sum_probs=64.5 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) +++|-||+-...+|--|| ..+-|||-||+-|.|||.--..+++.|.+. +.-+.+-||.-+....+.+ T Consensus 140 ~qLSGGQKQRVaIARALa---------~~P~iLL~DEaTSALDP~TT~sIL~LL~~In~~lglTIvlITHem~Vvk~ic~ 210 (339) T COG1135 140 AQLSGGQKQRVAIARALA---------NNPKILLCDEATSALDPETTQSILELLKDINRELGLTIVLITHEMEVVKRICD 210 (339) T ss_pred HHCCCCHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHHH T ss_conf 124851246999999972---------49988973584233786779999999999899729789999160899999841 Q ss_pred CEEEEEECCCEEE Q ss_conf 6007997289689 Q gi|254780766|r 361 TAKFMRISNHQAL 373 (375) Q Consensus 361 ~~~~~~i~~g~~~ 373 (375) . +.-+++|++. T Consensus 211 r--Vavm~~G~lv 221 (339) T COG1135 211 R--VAVLDQGRLV 221 (339) T ss_pred H--HEEEECCEEE T ss_conf 3--0474477799 No 279 >PRK13542 consensus Probab=97.69 E-value=9.2e-05 Score=50.30 Aligned_cols=45 Identities=24% Similarity=0.388 Sum_probs=32.9 Q ss_pred EEEEEEEEECCCC---HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 1899999922325---45536732798-7999868998644489999997 Q gi|254780766|r 5 IKIKFLNISEFRN---YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 5 M~i~~l~i~nFR~---~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) ..++.|+.. |.. +++.+++..+| +..|+|+|||||||++-.|.=+ T Consensus 19 Le~~~ls~~-~g~~~il~~isl~i~~Gei~~liGpNGaGKTTLlk~l~Gl 67 (224) T PRK13542 19 LEARELGFS-RGGRAVFRGIDISLAPGDLLQVMGPNGSGKTSLLRVLSGL 67 (224) T ss_pred EEEEEEEEE-ECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 999626999-9999988461678759979999999999999999999579 No 280 >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Probab=97.69 E-value=0.00064 Score=44.80 Aligned_cols=78 Identities=18% Similarity=0.317 Sum_probs=57.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|.||+-.+.+|-.+ ...+||+++||+.|.||+..-..+.+.+.+. +..+++-+|..+.... -- T Consensus 464 ~~LSgGQrQriaiARal---------l~~~~iLILDEaTS~lD~~tE~~I~~~l~~l~~~rT~iiIaHRlsti~~---aD 531 (567) T COG1132 464 VNLSGGQRQRLAIARAL---------LRNPPILILDEATSALDTETEALIQDALKKLLKGRTTLIIAHRLSTIKN---AD 531 (567) T ss_pred CCCCHHHHHHHHHHHHH---------HHCCCEEEECCHHHCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHH---CC T ss_conf 71889999999999997---------0369868872311026775699999999998269879998667225874---88 Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) +++-+++|++.- T Consensus 532 ~IiVl~~G~i~e 543 (567) T COG1132 532 RIIVLDNGRIVE 543 (567) T ss_pred EEEEEECCEEEE T ss_conf 899975875788 No 281 >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Probab=97.69 E-value=0.0003 Score=46.90 Aligned_cols=79 Identities=22% Similarity=0.207 Sum_probs=56.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----C-CCCEEEEECCHHHHHHHH Q ss_conf 31220589999999999999999987089978998012201598999999999741----7-980999806967854321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----I-GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~-~~Qv~iTt~~~~~~~~~~ 359 (375) ..+|-|.|--..||--|| ...+|+|+||+||-|||--+..+-+.|.+ . +.=||| |||.+-- +. T Consensus 163 ~eLSGGMqQRVGLARAla---------~~~~IlLMDEaFSALDPLIR~~mQdeLl~Lq~~l~KTIvFi-tHDLdEA--lr 230 (386) T COG4175 163 NELSGGMQQRVGLARALA---------NDPDILLMDEAFSALDPLIRTEMQDELLELQAKLKKTIVFI-THDLDEA--LR 230 (386) T ss_pred CCCCCHHHHHHHHHHHHC---------CCCCEEEECCCHHHCCHHHHHHHHHHHHHHHHHHCCEEEEE-ECCHHHH--HH T ss_conf 002625888889999870---------39987885370232076778899999999999858749999-4577888--73 Q ss_pred CCEEEEEECCCEEEEC Q ss_conf 2600799728968959 Q gi|254780766|r 360 ETAKFMRISNHQALCI 375 (375) Q Consensus 360 ~~~~~~~i~~g~~~~~ 375 (375) -...|--+++|+|+-+ T Consensus 231 iG~rIaimkdG~ivQ~ 246 (386) T COG4175 231 IGDRIAIMKDGEIVQV 246 (386) T ss_pred CCCEEEEECCCEEEEE T ss_conf 0465798108808982 No 282 >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Probab=97.68 E-value=4.7e-05 Score=52.17 Aligned_cols=48 Identities=25% Similarity=0.445 Sum_probs=33.8 Q ss_pred CCCCEE---EEEEEE--ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 988518---999999--2232545536732798-79998689986444899999 Q gi|254780766|r 1 MTNRIK---IKFLNI--SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 1 ~~~~M~---i~~l~i--~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) |+--|- .+.|+. .+..-+++.+++..+| ++.|+|+|||||||++.+|. T Consensus 1 Mt~~~~~L~~enLs~~yg~~~~l~~isl~I~~Ge~~~iiGpNGaGKSTLlk~i~ 54 (265) T PRK10253 1 MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLS 54 (265) T ss_pred CCCCCCEEEEEEEEEEECCEEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 998771589943999999999984028898599799999998839999999997 No 283 >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.68 E-value=0.00022 Score=47.84 Aligned_cols=79 Identities=20% Similarity=0.298 Sum_probs=61.7 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) .+.+|-|||.-..+|-.|+| ..-|+|-|||-|-|||..-+.+++.|.+. +.-|+++-|+-+.-.... T Consensus 145 a~~LSGGQQQRVaIARaL~Q---------~pkiILADEPvasLDp~~a~~Vm~~l~~in~~~g~Tvi~nLH~vdlA~~Y~ 215 (258) T COG3638 145 ASTLSGGQQQRVAIARALVQ---------QPKIILADEPVASLDPESAKKVMDILKDINQEDGITVIVNLHQVDLAKKYA 215 (258) T ss_pred HCCCCCCHHHHHHHHHHHHC---------CCCEEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHH T ss_conf 50378303479999999853---------887896179600058354899999999999974977999801278999987 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) +. ++-+.+|+|. T Consensus 216 ~R--iigl~~G~iv 227 (258) T COG3638 216 DR--IIGLKAGRIV 227 (258) T ss_pred HH--HEEECCCCEE T ss_conf 55--2375278289 No 284 >PRK03695 vitamin B12-transporter ATPase; Provisional Probab=97.68 E-value=5.3e-05 Score=51.83 Aligned_cols=41 Identities=27% Similarity=0.385 Sum_probs=30.4 Q ss_pred EEEEEEEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 89999992232545536732798-79998689986444899999 Q gi|254780766|r 6 KIKFLNISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 6 ~i~~l~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.|+.. ++ +++.+++..+| +..|+|+|||||||++.+|. T Consensus 3 ~v~nlsv~-~~-L~~isl~v~~Ge~v~iiGpNGaGKSTLlk~i~ 44 (245) T PRK03695 3 QLNDVAVS-TR-LGPLSGEVRAGEILHLVGPNGAGKSTLLARMA 44 (245) T ss_pred EEECCCCC-CC-CCCEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 99774227-80-50748999599899999789941999999984 No 285 >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Probab=97.68 E-value=0.0001 Score=49.99 Aligned_cols=85 Identities=25% Similarity=0.311 Sum_probs=65.7 Q ss_pred CCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHH----HHHHHHCCCCEEEEECCH Q ss_conf 2455102331220589999999999999999987089978998012201598999999----999741798099980696 Q gi|254780766|r 277 YCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNAL----FRIVTDIGSQIFMTGTDK 352 (375) Q Consensus 277 ~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~l----l~~l~~~~~Qv~iTt~~~ 352 (375) ++|++....-+|+||+|-+++.+-|.+ +.||+.+||=.+.=||..|+.+ +..+++.+.-+|.-|||. T Consensus 439 l~d~~fs~~kLStGQkKRlAll~AllE---------eR~Ilv~DEWAADQDPaFRR~FY~~lLp~LK~qGKTI~aIsHDd 509 (546) T COG4615 439 LNDGRFSNLKLSTGQKKRLALLLALLE---------ERDILVLDEWAADQDPAFRREFYQVLLPLLKEQGKTIFAISHDD 509 (546) T ss_pred ECCCCCCCCCCCCCHHHHHHHHHHHHH---------HCCEEEEEHHHCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCC T ss_conf 057863200045305878999999973---------09868860121246759999999998599997098599994473 Q ss_pred HHHHHHHCCEEEEEECCCEEE Q ss_conf 785432126007997289689 Q gi|254780766|r 353 SVFDSLNETAKFMRISNHQAL 373 (375) Q Consensus 353 ~~~~~~~~~~~~~~i~~g~~~ 373 (375) ..|..- |. .++.++|++. T Consensus 510 ~YF~~A-Dr--ll~~~~G~~~ 527 (546) T COG4615 510 HYFIHA-DR--LLEMRNGQLS 527 (546) T ss_pred HHHHHH-HH--HHHHHCCCEE T ss_conf 455558-89--9898558232 No 286 >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Probab=97.67 E-value=0.0002 Score=48.10 Aligned_cols=79 Identities=20% Similarity=0.324 Sum_probs=65.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCC----CCEEEEECCHHHHHHHHC Q ss_conf 3122058999999999999999998708997899801220159899999999974179----809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG----SQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~----~Qv~iTt~~~~~~~~~~~ 360 (375) .-+|-||||.+=+|.-|| ..+.+||+|||.|.+.+.-...+.+.+.+.. .-+.+--|+-+..-.+.+ T Consensus 148 ~~LsyG~qR~LEIArALa---------~~P~lLLLDEPaAGln~~e~~~l~~~i~~i~~~~g~tillIEHdM~~Vm~l~d 218 (250) T COG0411 148 GNLSYGQQRRLEIARALA---------TQPKLLLLDEPAAGLNPEETEELAELIRELRDRGGVTILLIEHDMKLVMGLAD 218 (250) T ss_pred HCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHCC T ss_conf 028856768999999986---------69987885676579898999999999999885489689999742078862266 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+..|++++ T Consensus 219 r--i~Vl~~G~~IA 230 (250) T COG0411 219 R--IVVLNYGEVIA 230 (250) T ss_pred E--EEECCCCCCCC T ss_conf 9--99501883844 No 287 >PRK13538 cytochrome c biogenesis protein CcmA; Provisional Probab=97.67 E-value=6.1e-05 Score=51.43 Aligned_cols=33 Identities=27% Similarity=0.473 Sum_probs=28.0 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2545536732798-79998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .-+++.++++.+| +..|+|+|||||||+|..|. T Consensus 15 ~vl~~vs~~i~~Ge~~~l~G~NGaGKSTLl~~l~ 48 (204) T PRK13538 15 ILFEGLSFTLNAGELVQIEGPNGAGKTSLLRILA 48 (204) T ss_pred EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9980517798799899999999985999999997 No 288 >KOG0062 consensus Probab=97.66 E-value=0.00027 Score=47.24 Aligned_cols=79 Identities=22% Similarity=0.292 Sum_probs=63.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCEEE Q ss_conf 31220589999999999999999987089978998012201598999999999741798099980696785432126007 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~~~~~~~~~~~~ 364 (375) .-+|-||+.-+++|-. - .+.+-++.+|||..|||..-...+...|...+.=|++-+||...++.+.+- + T Consensus 481 ~~LSGGQKsrvafA~~----~-----~~~PhlLVLDEPTNhLD~dsl~AL~~Al~~F~GGVv~VSHd~~fi~~~c~E--~ 549 (582) T KOG0062 481 ASLSGGQKSRVAFAAC----T-----WNNPHLLVLDEPTNHLDRDSLGALAKALKNFNGGVVLVSHDEEFISSLCKE--L 549 (582) T ss_pred CCCCCCCHHHHHHHHH----H-----CCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCE--E T ss_conf 2367862169999987----4-----379868984488763367778999999985589479997758998631730--5 Q ss_pred EEECCCEEEE Q ss_conf 9972896895 Q gi|254780766|r 365 MRISNHQALC 374 (375) Q Consensus 365 ~~i~~g~~~~ 374 (375) |.+++|.+.. T Consensus 550 Wvve~g~vt~ 559 (582) T KOG0062 550 WVVEDGKVTP 559 (582) T ss_pred EEECCCCEEE T ss_conf 9973892786 No 289 >CHL00131 ycf16 sulfate ABC transporter protein; Validated Probab=97.66 E-value=5.7e-05 Score=51.62 Aligned_cols=42 Identities=29% Similarity=0.415 Sum_probs=30.6 Q ss_pred EEEEEE--ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 999999--2232545536732798-79998689986444899999 Q gi|254780766|r 7 IKFLNI--SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 7 i~~l~i--~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ++.|+. .+..-+++.++++.+| +..|+|+|||||||++.+|. T Consensus 9 v~nl~~~y~~~~vL~~isl~i~~Gei~aiiG~nGsGKSTL~~~i~ 53 (252) T CHL00131 9 IKNLKATVNETEILKGINLSINAGEIHAIMGPNGSGKSTLSKVIA 53 (252) T ss_pred EEEEEEEECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 954799999999885617788799899999999999999999972 No 290 >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=97.64 E-value=0.00041 Score=46.04 Aligned_cols=76 Identities=20% Similarity=0.297 Sum_probs=57.1 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEE Q ss_conf 12205899999999999999999870899789980122015989999999997417--9809998069678543212600 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .+|-||++-++++-.|- ...|++|+|||-..||+..-+.++..+.+. +.-+++-||+...++. --+ T Consensus 474 ~LSGGE~rRLAlAR~LL---------~dapl~lLDEPTegLD~~TE~~vL~ll~~~~~~kTll~vTHrL~~le~---~dr 541 (573) T COG4987 474 RLSGGERRRLALARALL---------HDAPLWLLDEPTEGLDPITERQVLALLFEHAEGKTLLMVTHRLRGLER---MDR 541 (573) T ss_pred CCCCHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHH---CCE T ss_conf 47813899999999997---------079868844886667864399999999998459859999645421765---687 Q ss_pred EEEECCCEEE Q ss_conf 7997289689 Q gi|254780766|r 364 FMRISNHQAL 373 (375) Q Consensus 364 ~~~i~~g~~~ 373 (375) +..+++|+++ T Consensus 542 Iivl~~Gkii 551 (573) T COG4987 542 IIVLDNGKII 551 (573) T ss_pred EEEEECCEEE T ss_conf 7998777556 No 291 >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors. The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in Probab=97.63 E-value=4e-05 Score=52.68 Aligned_cols=33 Identities=33% Similarity=0.531 Sum_probs=28.1 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2545536732798-79998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +-+++.++++.+| ++.|+|+|||||||+|.+|. T Consensus 21 ~vL~~vs~~i~~Ge~~~ilGpnGsGKSTLl~~i~ 54 (226) T cd03234 21 RILNDVSLHVESGQVMAILGSSGSGKTTLLDAIS 54 (226) T ss_pred EEEECCEEEEECCCEEEEECCCCCHHHHHHHHHH T ss_conf 9988977899188099999899960999999996 No 292 >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Probab=97.62 E-value=8e-05 Score=50.68 Aligned_cols=35 Identities=26% Similarity=0.412 Sum_probs=28.3 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.++++.+| ++.|+|+|||||||++.+|. T Consensus 14 ~~~~L~~vsl~i~~Gei~~liGpNGaGKSTLlk~i~ 49 (257) T PRK13548 14 GKTVLDDVSLTLRPGEVVAILGPNGAGKSTLLRALS 49 (257) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999880337898699899999999987999999985 No 293 >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Probab=97.61 E-value=0.00014 Score=49.05 Aligned_cols=37 Identities=30% Similarity=0.487 Sum_probs=29.1 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 232545536732798-7999868998644489999997 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) +..-+++.++++.+| +..|+|+|||||||++.+|.-+ T Consensus 17 ~~~vl~~isl~i~~Gei~~iiG~sGsGKSTLl~~i~gl 54 (257) T PRK10619 17 EHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFL 54 (257) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 98887360668879979999989998199999999659 No 294 >PRK13409 putative ATPase RIL; Provisional Probab=97.61 E-value=0.00047 Score=45.64 Aligned_cols=69 Identities=26% Similarity=0.359 Sum_probs=47.6 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCC Q ss_conf 3312205899999999999999999870899789980122015989999999997417--98099980696785432126 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~ 361 (375) ...+|-||+..+++|-.|+ ...-++++|||.+|||..-+..+.+.|.++ +.=+++.+||...++.+.+. T Consensus 210 ~~~lSgG~~qrv~~a~~l~---------~~~~~~~lDEPtn~LDi~~r~~l~~~lr~L~~~~tvIVVeHDl~~Ld~laD~ 280 (590) T PRK13409 210 ISELSGGELQRVAIAAALL---------RDADFYFFDEPTSYLDIRQRLNVARLIRELAEGKYVLVVEHDLAVLDYLADY 280 (590) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHCCE T ss_conf 0028998999999999984---------3999899648755489999999999999985698689998639999865588 No 295 >PRK13544 consensus Probab=97.60 E-value=7.9e-05 Score=50.71 Aligned_cols=36 Identities=25% Similarity=0.492 Sum_probs=28.4 Q ss_pred ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2232545536732798-79998689986444899999 Q gi|254780766|r 13 SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 13 ~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+..-++++++.+.+| ++.++|+|||||||+|.+|. T Consensus 12 g~k~il~~vs~~i~~Gei~~l~G~NGsGKSTLl~~i~ 48 (208) T PRK13544 12 NNKVLFSNLSFTAKQNSLTLVIGNNGSGKTSLLRLLA 48 (208) T ss_pred CCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9999994415898299499999999998999999995 No 296 >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Probab=97.60 E-value=8.1e-05 Score=50.64 Aligned_cols=33 Identities=33% Similarity=0.523 Sum_probs=27.0 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2545536732798-79998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .-+++.++++.+| +..|+|+|||||||++.+|. T Consensus 25 ~vL~~vsl~i~~Ge~~~liG~NGaGKSTLl~~l~ 58 (265) T PRK10575 25 TLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLG 58 (265) T ss_pred EEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 9881508898799899999999980999999995 No 297 >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.60 E-value=8e-05 Score=50.68 Aligned_cols=35 Identities=31% Similarity=0.426 Sum_probs=27.9 Q ss_pred CCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 23254553673279-879998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.++++.+ .++.|+|+|||||||++.+|. T Consensus 13 ~~~vL~~vsl~i~~Gei~~liGpNGaGKSTLlk~l~ 48 (271) T PRK13638 13 DEPVLKGLNLDFSLSPVTGLVGANGCGKSTLFMNLS 48 (271) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 998896418798389799999999980999999996 No 298 >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein; InterPro: IPR005666 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). These proteins are involved in the transmembrane transport of sulphate and thiosulphate.; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016020 membrane. Probab=97.59 E-value=0.0003 Score=46.97 Aligned_cols=80 Identities=23% Similarity=0.237 Sum_probs=59.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEE----CCHHHHHHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741798099980----69678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG----TDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt----~~~~~~~~~~~ 360 (375) +++|-||+--++||--|| -++.|||+||||+-||..-|+.+-..|-++...|-+|| ||..---.+.+ T Consensus 133 ~QLSGGQrQRvALARALA---------v~P~vLLLDEPFgALDAkvRk~LR~WLR~LH~e~~~T~VfVTHD~~EA~evAd 203 (241) T TIGR00968 133 NQLSGGQRQRVALARALA---------VEPQVLLLDEPFGALDAKVRKELRAWLRKLHDEVHVTTVFVTHDQEEAMEVAD 203 (241) T ss_pred CCCCCCHHHHHHHHHHHH---------CCCCEEEEECCHHHHHHHHHHHHHHHHHHHCCEEEEEEEEEECCHHHHHHHHH T ss_conf 203573378999998863---------39815762087145428999999999987403056779998628589988874 Q ss_pred CEEEEEECCCEEEEC Q ss_conf 600799728968959 Q gi|254780766|r 361 TAKFMRISNHQALCI 375 (375) Q Consensus 361 ~~~~~~i~~g~~~~~ 375 (375) . +.-+++|+|.-| T Consensus 204 ~--ivv~~~G~i~Q~ 216 (241) T TIGR00968 204 R--IVVLSNGKIEQV 216 (241) T ss_pred H--HHHHCCCCEEEC T ss_conf 4--013217827871 No 299 >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters. This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates. Probab=97.58 E-value=9e-05 Score=50.36 Aligned_cols=38 Identities=24% Similarity=0.364 Sum_probs=29.9 Q ss_pred EEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 992232545536732798-79998689986444899999 Q gi|254780766|r 11 NISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 11 ~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ...+..-+++.+++..+| +..|+|+|||||||++-+|. T Consensus 8 ~yg~~~~L~~is~~i~~Ge~~~liGpNGaGKSTllk~i~ 46 (213) T cd03235 8 SYGGHPVLEDVSFEVKPGEFLAIVGPNGAGKSTLLKAIL 46 (213) T ss_pred EECCEEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999999885027898599899999999986999999997 No 300 >TIGR02857 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD; InterPro: IPR014216 The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain and a C-terminal ATP-binding domain. In Escherichia coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in the export of redox-active thiol compounds such as cysteine and glutathione , . The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this entry are all either found in the gammaproteobacterial context, or the CydABCD context. All members of this entry scoring above the trusted cut off at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature, based on this operon in Bacillus subtilis, assigns cydC to the third gene in the operon, where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologues in this family in accordance with the precedence of publication of the E. coli name, CydD.. Probab=97.58 E-value=0.00028 Score=47.14 Aligned_cols=67 Identities=22% Similarity=0.349 Sum_probs=51.1 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHH Q ss_conf 1220589999999999999999987089978998012201598999999999741---798099980696785432 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSL 358 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~ 358 (375) -+|-||..-++|+=-|. +.... .||||+|||-||||.+.-..+.+.+.+ .+.=|++-||+....... T Consensus 495 GLSGGq~QRlALARafl-----~~~~a-~~llLLDEPTAhLD~~tEa~v~~~~~~l~A~grtvl~v~Hr~~~~~~a 564 (570) T TIGR02857 495 GLSGGQAQRLALARAFL-----RDATA-APLLLLDEPTAHLDAETEAEVLEALRALAAQGRTVLLVTHRLALAALA 564 (570) T ss_pred CCCHHHHHHHHHHHHHH-----CHHHC-CCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHC T ss_conf 47799999999999960-----61111-760354077643218999999999999973798899997668999327 No 301 >PRK13543 cytochrome c biogenesis protein CcmA; Provisional Probab=97.58 E-value=9e-05 Score=50.34 Aligned_cols=43 Identities=33% Similarity=0.478 Sum_probs=30.7 Q ss_pred EEEEEEEE--CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 89999992--232545536732798-79998689986444899999 Q gi|254780766|r 6 KIKFLNIS--EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 6 ~i~~l~i~--nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.|+.. +-.-++++++++.+| +.+|+|+|||||||+|-.|. T Consensus 13 ~~~~ls~~~~~~~vl~~isf~v~~Ge~~~l~GpNGaGKTTLlr~l~ 58 (214) T PRK13543 13 AAHALAFSRNEEPVFGPLDFHVDAGEALLVQGDNGAGKTTLLRVLA 58 (214) T ss_pred EEEEEEEEECCEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9982799979999982638898189899999999987999999997 No 302 >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Probab=97.58 E-value=0.0006 Score=44.97 Aligned_cols=79 Identities=18% Similarity=0.257 Sum_probs=62.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) +-+|-|-+|-.+||--+| -.+.|+++|||.+.|||..-..+-+.+.++ +.-+++-|||.+..-.+.+ T Consensus 144 sELSGGM~KRvaLARAia---------ldPell~~DEPtsGLDPI~a~~~~~LI~~L~~~lg~T~i~VTHDl~s~~~i~D 214 (263) T COG1127 144 SELSGGMRKRVALARAIA---------LDPELLFLDEPTSGLDPISAGVIDELIRELNDALGLTVIMVTHDLDSLLTIAD 214 (263) T ss_pred HHHCCHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHC T ss_conf 320435889999999986---------49877985599778883027799999999998639879999777178873312 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++-+.+|+|+. T Consensus 215 r--v~~L~~gkv~~ 226 (263) T COG1127 215 R--VAVLADGKVIA 226 (263) T ss_pred E--EEEEECCEEEE T ss_conf 6--89976887898 No 303 >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=97.58 E-value=0.00016 Score=48.76 Aligned_cols=46 Identities=28% Similarity=0.510 Sum_probs=31.2 Q ss_pred CCCEEEEEEEEECCC---CHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 885189999992232---54553673279-879998689986444899999 Q gi|254780766|r 2 TNRIKIKFLNISEFR---NYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 2 ~~~M~i~~l~i~nFR---~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) .+-+.++.+... |. -+++.++.+.+ .++.|+|||||||||++-+|- T Consensus 2 ~~~i~v~nl~v~-y~~~~vl~~i~l~v~~G~~~~iiGPNGaGKSTLlK~iL 51 (254) T COG1121 2 MPMIEVENLTVS-YGNRPVLEDISLSVEKGEITALIGPNGAGKSTLLKAIL 51 (254) T ss_pred CCEEEEEEEEEE-ECCEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 867999414999-89975041538997489689999998888899999996 No 304 >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein; InterPro: IPR013505 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). FtsE is an ABC transporter ATP-binding protein. This protein and its permease partner FtsX, localize to the cell division site. In a number of species, the ftsEX gene pair is located next to ftsY, which encodes the signal recognition particle-docki ng protein.; GO: 0005524 ATP binding, 0051301 cell division. Probab=97.58 E-value=0.00022 Score=47.77 Aligned_cols=77 Identities=21% Similarity=0.385 Sum_probs=62.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|-|||=-+.+| ....+++++||=|||.+.||+..-+-+++.+++. +.=|+|.|||.++.+.-... T Consensus 137 ~~LSGGEQQRv~IA---------RA~V~~P~lLLADEPTGNLD~~~S~~il~Lf~~~n~~G~TVl~ATHD~~L~~~~~~R 207 (216) T TIGR00960 137 VQLSGGEQQRVAIA---------RAVVNKPALLLADEPTGNLDPELSRDILRLFEEFNRAGTTVLVATHDINLVESYRHR 207 (216) T ss_pred CCCCCCCHHHHHHH---------HHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHCCCC T ss_conf 20048503455664---------443067970131088988788889999999987503785477710248899737996 Q ss_pred EEEEEECCCEE Q ss_conf 00799728968 Q gi|254780766|r 362 AKFMRISNHQA 372 (375) Q Consensus 362 ~~~~~i~~g~~ 372 (375) +..++.|+. T Consensus 208 --~L~L~~G~L 216 (216) T TIGR00960 208 --VLTLSKGRL 216 (216) T ss_pred --EEEECCCCC T ss_conf --698407889 No 305 >pfam04310 MukB MukB N-terminal. This family represents the N-terminal region of MukB, one of a group of bacterial proteins essential for the movement of nucleoids from mid-cell towards the cell quarters (i.e. chromosome partitioning). The structure of the N-terminal domain consists of an antiparallel six-stranded beta sheet surrounded by one helix on one side and by five helices on the other side. It contains an exposed Walker A loop in an unexpected helix-loop-helix motif (in other proteins, Walker A motifs generally adopt a P loop conformation as part of a strand-loop-helix motif embedded in a conserved topology of alternating helices and (parallel) beta strands). Probab=97.58 E-value=9.8e-05 Score=50.10 Aligned_cols=51 Identities=24% Similarity=0.337 Sum_probs=46.7 Q ss_pred CCCCEEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHHC Q ss_conf 988518999999223254553673279879998689986444899999972 Q gi|254780766|r 1 MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLS 51 (375) Q Consensus 1 ~~~~M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~ 51 (375) |..|=+..+|++.|+-.|-.-+++++.-++.+.|.|||||||++-|..... T Consensus 1 m~~r~k~rSLtlVNwNGffARTfdLd~lvttLsG~NGAGKsT~m~Af~tal 51 (227) T pfam04310 1 MIERGKFQSLTLINWNGFFARTFDIDELVTTLSGGNGAGKSTTMAAFITAL 51 (227) T ss_pred CCCCCCCCEEEEEEECCEEEEEEECCEEEEEEECCCCCCHHHHHHHHHHHH T ss_conf 965555434789856367767740210268864478765487999999986 No 306 >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=97.57 E-value=0.0001 Score=49.95 Aligned_cols=36 Identities=31% Similarity=0.630 Sum_probs=28.9 Q ss_pred ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2232545536732798-79998689986444899999 Q gi|254780766|r 13 SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 13 ~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+++-..+.+++..+| +..|+|+|||||||++.+|. T Consensus 13 g~~~al~~vsl~v~~Gei~~liGpNGaGKSTLl~~i~ 49 (242) T TIGR03411 13 DGFKALNDLSLYVDPGELRVIIGPNGAGKTTMMDVIT 49 (242) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9989874507898899899999899975999999996 No 307 >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component. Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet. Probab=97.55 E-value=1e-04 Score=50.06 Aligned_cols=35 Identities=20% Similarity=0.319 Sum_probs=28.1 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.++++.+| +..|+|+|||||||++.+|. T Consensus 12 ~~~vL~~vsl~v~~Gei~~iiGpnGaGKSTLl~~i~ 47 (200) T cd03217 12 GKEILKGVNLTIKKGEVHALMGPNGSGKSTLAKTIM 47 (200) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 999885505688799899999689999999999970 No 308 >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Probab=97.54 E-value=0.0001 Score=49.97 Aligned_cols=31 Identities=29% Similarity=0.568 Sum_probs=25.6 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.+| ++.|+|+|||||||++.+|. T Consensus 17 L~~vsl~i~~Ge~~aliG~nGaGKSTLl~~i~ 48 (273) T PRK13547 17 LRDLSLRIEPGRVTALLGRNGAGKSTLLKVLA 48 (273) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 97608899899899999999976999999995 No 309 >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA; InterPro: IPR005895 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains the cytochrome c biogenesis protein encoded by ccmA in bacteria and one arabidopsis protein, possibly encoded by an organelle. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The post-translational pathway includes the transport of a heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which functions as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.; GO: 0005215 transporter activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space. Probab=97.54 E-value=0.0002 Score=48.09 Aligned_cols=65 Identities=23% Similarity=0.332 Sum_probs=51.8 Q ss_pred HHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHH Q ss_conf 02331220589999999999999999987089978998012201598999999999741---798099980696785 Q gi|254780766|r 282 ITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVF 355 (375) Q Consensus 282 ~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~ 355 (375) .+..++|-||||-++||=. ++ ...|+=|+|||+.-||+.-...+-..+.. .+.-|++|||.+-.. T Consensus 127 ~p~~~LSAGQqRRlaLARL----~l-----~~~PlWiLDEP~tALD~~Gv~~l~~~~~~H~~rGG~vlltTH~~L~~ 194 (204) T TIGR01189 127 LPAAQLSAGQQRRLALARL----WL-----SRAPLWILDEPTTALDKAGVALLAALLAAHLARGGIVLLTTHQDLGL 194 (204) T ss_pred HHHHHCCCHHHHHHHHHHH----HH-----CCCCEEEECCCHHHCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC T ss_conf 8987406146899999988----63-----37972220365143068999999999999986005136634751368 No 310 >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Probab=97.52 E-value=0.00022 Score=47.80 Aligned_cols=65 Identities=22% Similarity=0.302 Sum_probs=50.5 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHH Q ss_conf 2331220589999999999999999987089978998012201598999999999741---7980999806967854 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFD 356 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~ 356 (375) +..++|.||||.++++-... ...|+-|+|||++.||+.....+-..+.. .+.-|+.|||.+..+. T Consensus 127 p~~~LSAGQqRRvAlArL~l---------s~~pLWiLDEP~taLDk~g~a~l~~l~~~H~~~GGiVllttHq~l~~~ 194 (209) T COG4133 127 PVGQLSAGQQRRVALARLWL---------SPAPLWILDEPFTALDKEGVALLTALMAAHAAQGGIVLLTTHQPLPIA 194 (209) T ss_pred CHHHCCHHHHHHHHHHHHHC---------CCCCCEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC T ss_conf 02223646899999999972---------788716644853224987899999999998527988999647756777 No 311 >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein. Probab=97.52 E-value=0.0001 Score=49.93 Aligned_cols=35 Identities=29% Similarity=0.366 Sum_probs=29.0 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.++++.+| +..++|+|||||||++.+|. T Consensus 12 ~~~al~~vs~~v~~Gei~gllG~NGaGKSTLl~~i~ 47 (208) T cd03268 12 KKRVLDDISLHVKKGEIYGFLGPNGAGKTTTMKIIL 47 (208) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999871516688698199999999999999999995 No 312 >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Probab=97.52 E-value=8.1e-05 Score=50.65 Aligned_cols=34 Identities=21% Similarity=0.347 Sum_probs=29.4 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 32545536732798-79998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ..-+.+.++++.+| +..++|+|||||||++-+|. T Consensus 18 ~~~l~~vs~~i~~Gei~gllG~NGAGKTTllk~l~ 52 (293) T COG1131 18 KTALDGVSFEVEPGEIFGLLGPNGAGKTTLLKILA 52 (293) T ss_pred CEEEEEEEEEEECCEEEEEECCCCCCHHHHHHHHH T ss_conf 78886049998289599998999998999999996 No 313 >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=97.52 E-value=9e-05 Score=50.34 Aligned_cols=31 Identities=23% Similarity=0.463 Sum_probs=24.2 Q ss_pred HHHEEEECCCC------EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798------79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ------HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~------~n~i~G~NG~GKT~iLEAI~ 48 (375) +.+++++..+| ++.|+|+|||||||+|-.|. T Consensus 10 l~~~sL~i~~Gti~~GEiv~liGpNGaGKSTLlk~l~ 46 (246) T cd03237 10 LGEFTLEVEGGSISESEVIGILGPNGIGKTTFIKMLA 46 (246) T ss_pred CCEEEEEECCCCCCCCCEEEEECCCCCHHHHHHHHHH T ss_conf 1506898568846579899999799976999999997 No 314 >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.52 E-value=0.00039 Score=46.19 Aligned_cols=76 Identities=18% Similarity=0.216 Sum_probs=54.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCEEE Q ss_conf 2205899999999999999999870899789980122015989999999997417--98099980696785432126007 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETAKF 364 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~~~ 364 (375) +|-|||-.+-+|-.|| -++-|+|+|||.|-|||..-.++=+.+.++ +.-++|-||+-.--.-+.+.+-| T Consensus 150 LSGGQQQRLcIARalA---------v~PeVlLmDEPtSALDPIsT~kIEeLi~eLk~~yTIviVTHnmqQAaRvSD~taF 220 (253) T COG1117 150 LSGGQQQRLCIARALA---------VKPEVLLMDEPTSALDPISTLKIEELITELKKKYTIVIVTHNMQQAARVSDYTAF 220 (253) T ss_pred CCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHHHH T ss_conf 8734678999999872---------6986787448642248135889999999987464899993799998787775576 Q ss_pred EEECCCEEE Q ss_conf 997289689 Q gi|254780766|r 365 MRISNHQAL 373 (375) Q Consensus 365 ~~i~~g~~~ 373 (375) |. .|+++ T Consensus 221 f~--~G~Lv 227 (253) T COG1117 221 FY--LGELV 227 (253) T ss_pred HC--CCEEE T ss_conf 40--66788 No 315 >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Probab=97.51 E-value=0.00018 Score=48.39 Aligned_cols=48 Identities=21% Similarity=0.356 Sum_probs=32.4 Q ss_pred CCCEEEEEEEEE--CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 885189999992--232545536732798-799986899864448999999 Q gi|254780766|r 2 TNRIKIKFLNIS--EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 2 ~~~M~i~~l~i~--nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .+=..++.|+.. +..-+++.++++.+| ++.|+|+|||||||++-.|.= T Consensus 6 ~~~lev~nls~~yg~~~vL~~is~~i~~Gei~~iiGpnGsGKSTLlk~i~G 56 (269) T PRK11831 6 ANLVDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGG 56 (269) T ss_pred CCCEEEEEEEEEECCEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 142899437999899899947166887998999993999759999999967 No 316 >PTZ00243 ABC transporter; Provisional Probab=97.51 E-value=0.0011 Score=43.24 Aligned_cols=79 Identities=14% Similarity=0.214 Sum_probs=55.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC-CCCEEEEECCHHHHHHHHCCEE Q ss_conf 312205899999999999999999870899789980122015989999999997417-9809998069678543212600 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI-GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~-~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +.+|.||+-++.||=.| ++ ....|+||||.-|.+|+..=..+-+.+.+. +.-+++|-+| -++.+.+.-+ T Consensus 1444 ~NlS~GQRQLlcLARAL-----Lr---r~skILlLDEATAsvD~~TD~lIQ~tIr~~F~~~TVItIAH--RL~TI~d~Dr 1513 (1560) T PTZ00243 1444 SNYSVGQRQLMCMARAL-----LK---KGSGFILMDEATANIDPALDRQIQATVMSAFSAYTVITIAH--RLHTVAQYDK 1513 (1560) T ss_pred CCCCHHHHHHHHHHHHH-----HC---CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEHH--HHHHHHHCCE T ss_conf 01789999999999999-----75---79987998782105898999999999999828998998261--3746986898 Q ss_pred EEEECCCEEE Q ss_conf 7997289689 Q gi|254780766|r 364 FMRISNHQAL 373 (375) Q Consensus 364 ~~~i~~g~~~ 373 (375) ++-+++|+|. T Consensus 1514 IlVLd~G~Vv 1523 (1560) T PTZ00243 1514 IIVMDHGAVA 1523 (1560) T ss_pred EEEEECCEEE T ss_conf 9998486899 No 317 >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.51 E-value=7.7e-05 Score=50.80 Aligned_cols=31 Identities=23% Similarity=0.476 Sum_probs=26.4 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.+| ++.|+|+|||||||++..|. T Consensus 23 L~~is~~i~~Ge~~~llGpnGaGKSTLl~~l~ 54 (192) T cd03232 23 LNNISGYVKPGTLTALMGESGAGKTTLLDVLA 54 (192) T ss_pred EECCEEEEECCEEEEEECCCCCCHHHHHHHHH T ss_conf 98838899288399999999998899999983 No 318 >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=97.51 E-value=8.8e-05 Score=50.41 Aligned_cols=32 Identities=28% Similarity=0.393 Sum_probs=27.1 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -+++.++++.+| +..|+|+|||||||++.+|. T Consensus 15 vL~~vsl~i~~Gei~~iiG~nGaGKSTLl~~i~ 47 (205) T cd03226 15 ILDDLSLDLYAGEIIALTGKNGAGKTTLAKILA 47 (205) T ss_pred EEEEEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 864037888699899998899998999999995 No 319 >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA; InterPro: IPR005895 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains the cytochrome c biogenesis protein encoded by ccmA in bacteria and one arabidopsis protein, possibly encoded by an organelle. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The post-translational pathway includes the transport of a heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which functions as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.; GO: 0005215 transporter activity, 0017004 cytochrome complex assembly, 0030288 outer membrane-bounded periplasmic space. Probab=97.51 E-value=5.7e-05 Score=51.64 Aligned_cols=31 Identities=29% Similarity=0.577 Sum_probs=26.0 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) |+.+++++.+| .-+|.|+||+||||+|==+. T Consensus 16 f~~l~F~l~aGe~l~v~GpNG~GKTtLLR~LA 47 (204) T TIGR01189 16 FEGLSFTLNAGEALQVEGPNGIGKTTLLRILA 47 (204) T ss_pred ECCCEEEEECCCEEEEEECCCCCHHHHHHHHH T ss_conf 01123454078278986069873578999998 No 320 >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup. This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.50 E-value=0.00014 Score=49.09 Aligned_cols=36 Identities=28% Similarity=0.502 Sum_probs=29.3 Q ss_pred ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2232545536732798-79998689986444899999 Q gi|254780766|r 13 SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 13 ~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+..-+++.++++.+| +..|+|+|||||||++.+|. T Consensus 11 g~~~al~~vs~~i~~Gei~~iiGpnGaGKSTl~~~i~ 47 (213) T cd03259 11 GSVRALDDLSLTVEPGEFLALLGPSGCGKTTLLRLIA 47 (213) T ss_pred CCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 9999984617798899899999999973999999997 No 321 >TIGR02680 TIGR02680 conserved hypothetical protein TIGR02680; InterPro: IPR013496 Proteins in this entry are encoded within a conserved gene four-gene neighbourhood found sporadically in a phylogenetically broad range of bacteria including: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). These proteins average over 1400 amino acids in length.. Probab=97.49 E-value=0.00038 Score=46.29 Aligned_cols=63 Identities=29% Similarity=0.411 Sum_probs=34.1 Q ss_pred CCCHHHHHHHHHHHHH-HHHHHH---HHCCCCC-EEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEE Q ss_conf 2205899999999999-999999---8708997-8998012201598999999999741798099980 Q gi|254780766|r 287 GSTGEQKVVLVGIFLA-HARLIS---NTTGFAP-ILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La-~~~~~~---~~~~~~p-ilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt 349 (375) +|.||+.+.+-.-.+| ..-++. ......| ++||||+|+..|..++..++..|.+++.-++||+ T Consensus 1309 ~SgGE~a~a~~~PLFAAa~shY~sl~~~~~~APRlilLDEaFAGVD~~~ra~~~~Ll~~lDLD~v~TS 1376 (1416) T TIGR02680 1309 LSGGERALALYVPLFAAASSHYSSLQEAYPHAPRLILLDEAFAGVDDNARAKLFGLLRALDLDFVITS 1376 (1416) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEC T ss_conf 76899999852379999999986563254557851320220125780688999999999578826624 No 322 >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.; GO: 0005524 ATP binding, 0015416 phosphonate transmembrane-transporting ATPase activity, 0015716 phosphonate transport, 0016020 membrane. Probab=97.49 E-value=0.00019 Score=48.27 Aligned_cols=79 Identities=18% Similarity=0.249 Sum_probs=65.0 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) .+++|-|||=-+++|=-|+| ++.|+|-|||-|=|||..-+.++++|.+. +.=|+|+=|+-++-..+. T Consensus 153 aD~LSGGQQQRVaIARAL~Q---------~P~lILADEPiASLDP~~s~~VMd~lk~In~e~GIT~i~NLH~VdlA~~Y~ 223 (253) T TIGR02315 153 ADQLSGGQQQRVAIARALAQ---------QPKLILADEPIASLDPKTSKQVMDYLKRINKEDGITVIVNLHQVDLAKKYA 223 (253) T ss_pred HHHHCCCCHHHHHHHHHHCC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH T ss_conf 13215851168999986368---------995897048843367567899999999988776977999746178788763 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) +. ++-+++|+|. T Consensus 224 dR--ivGL~~G~iV 235 (253) T TIGR02315 224 DR--IVGLKAGEIV 235 (253) T ss_pred HH--HHHHHCCCEE T ss_conf 37--7666667214 No 323 >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=97.49 E-value=0.00011 Score=49.70 Aligned_cols=37 Identities=16% Similarity=0.351 Sum_probs=29.3 Q ss_pred ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 2232545536732798-799986899864448999999 Q gi|254780766|r 13 SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 13 ~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .|-+-+++.++++.+| +++|+|+|||||||++-++.. T Consensus 6 ~~~~aL~~isl~i~~Ge~~~iiG~nGsGKSTLl~~~~~ 43 (176) T cd03238 6 ANVHNLQNLDVSIPLNVLVVVTGVSGSGKSTLVNEGLY 43 (176) T ss_pred CCEECCCCEEEEECCCCEEEEECCCCCCHHHHHHHHHH T ss_conf 65354675487888998999999999989999998887 No 324 >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity. In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.49 E-value=0.00012 Score=49.55 Aligned_cols=35 Identities=20% Similarity=0.317 Sum_probs=28.1 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.+++..+| +..++|+|||||||++..|. T Consensus 12 ~~~al~~vs~~v~~Gei~gllG~NGaGKTTll~~i~ 47 (210) T cd03269 12 RVTALDDISFSVEKGEIFGLLGPNGAGKTTTIRMIL 47 (210) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999975426788799599999899984999999996 No 325 >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Probab=97.48 E-value=0.00015 Score=48.96 Aligned_cols=35 Identities=23% Similarity=0.404 Sum_probs=27.5 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 32545536732798-799986899864448999999 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) -.-+++.+++..+| +..|+|+|||||||+|.+|.= T Consensus 14 ~~~L~dvsl~i~~Ge~~~lvGpnGaGKSTLl~~i~G 49 (255) T PRK11248 14 KPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAG 49 (255) T ss_pred EEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 988813177986998999999998469999999975 No 326 >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Probab=97.47 E-value=5.1e-05 Score=51.97 Aligned_cols=81 Identities=19% Similarity=0.296 Sum_probs=63.4 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHC Q ss_conf 23312205899999999999999999870899789980122015989999999997417--9809998069678543212 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~ 360 (375) ....+|.||+--+=+.+.|+| .+.+||+|||-|..-+.-....-+.|... +.-+++--||-.....+.+ T Consensus 144 ~A~~LSHGqKQwLEIGMll~Q---------~P~lLLlDEPvAGMTd~Et~~taeLl~~la~~hsilVVEHDM~Fvr~~A~ 214 (249) T COG4674 144 LAALLSHGQKQWLEIGMLLAQ---------DPKLLLLDEPVAGMTDAETEKTAELLKSLAGKHSILVVEHDMGFVREIAD 214 (249) T ss_pred HHHHHCCCHHHHHHHHEEECC---------CCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH T ss_conf 666615324665300115505---------88678855865788578899999999987317449999453799998522 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . +.-+..|+++| T Consensus 215 ~--VTVlh~G~VL~ 226 (249) T COG4674 215 K--VTVLHEGSVLA 226 (249) T ss_pred E--EEEEECCCEEE T ss_conf 1--69985443663 No 327 >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=97.47 E-value=0.00016 Score=48.64 Aligned_cols=43 Identities=23% Similarity=0.405 Sum_probs=30.4 Q ss_pred EEEEEEE--ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 8999999--2232545536732798-79998689986444899999 Q gi|254780766|r 6 KIKFLNI--SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 6 ~i~~l~i--~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.|+. -++.-.++.+++..+| +..|+|+|||||||++.+|. T Consensus 7 ~v~~l~~~yg~~~al~~vs~~v~~Gei~~liGpnGaGKSTL~~~i~ 52 (255) T PRK11300 7 KVSGLMMRFGGLLAVNNVNLEVREQEVVSLIGPNGAGKTTVFNCLT 52 (255) T ss_pred EEEEEEEEECCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9984999989999880408898999799999899964999999996 No 328 >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Probab=97.47 E-value=0.00016 Score=48.65 Aligned_cols=34 Identities=24% Similarity=0.477 Sum_probs=27.0 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 32545536732798-79998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ..-+++.+++..+| +..|+|+|||||||++..|. T Consensus 18 ~~~L~~isl~i~~Gei~~liG~NGaGKSTLl~~i~ 52 (237) T PRK11614 18 IQALHEVSLHINQGEIVTLIGANGAGKTTLLGTLC 52 (237) T ss_pred EEEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 88881127898699799998799975999999996 No 329 >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems. Probab=97.47 E-value=0.0001 Score=49.96 Aligned_cols=31 Identities=26% Similarity=0.547 Sum_probs=26.6 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.+| +..|+|+|||||||++.+|. T Consensus 17 L~~vsl~i~~Gei~~iiG~nGaGKSTLlk~i~ 48 (211) T cd03225 17 LDDISLTIKKGEFVLIVGPNGSGKSTLLRLLN 48 (211) T ss_pred EEEEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 75317888499799998899998999999996 No 330 >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR); InterPro: IPR005291 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). These proteins are integral membrane proteins and they are involved in the transport of chloride ions. Many of these proteins are the cystis fibrosis transmembrane conductor regulators (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.; GO: 0005254 chloride channel activity, 0006811 ion transport, 0016020 membrane. Probab=97.47 E-value=0.00076 Score=44.29 Aligned_cols=87 Identities=23% Similarity=0.331 Sum_probs=61.0 Q ss_pred CCCEEEECCCCCCCHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCE Q ss_conf 32001100124551023312205899999999999999999870899789980122015989999999997417--9809 Q gi|254780766|r 268 PHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQI 345 (375) Q Consensus 268 phr~d~~~~~~~~~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv 345 (375) |.|-||.+ .+|+- .+|.|-+-++-||- ....+.-|||+|||.|||||...+-+-..|++. +|-| T Consensus 1381 PdKLdF~L-~DGGy----vLS~GHKQLMCLAR---------SiLSKAkILLLDEPsA~LDPvT~Qi~RkTLK~~Fs~CTV 1446 (1534) T TIGR01271 1381 PDKLDFVL-VDGGY----VLSNGHKQLMCLAR---------SILSKAKILLLDEPSAHLDPVTLQIIRKTLKQSFSNCTV 1446 (1534) T ss_pred CCCCCEEE-ECCCE----EEECCHHHHHHHHH---------HHHHHHHHHHCCCCCHHCCHHHHHHHHHHHHHHHCCCEE T ss_conf 88412488-62867----83164168999998---------888653322214871010316899999998532215748 Q ss_pred EEEECCHHHHHHHHCCEEEEEECCCE Q ss_conf 99806967854321260079972896 Q gi|254780766|r 346 FMTGTDKSVFDSLNETAKFMRISNHQ 371 (375) Q Consensus 346 ~iTt~~~~~~~~~~~~~~~~~i~~g~ 371 (375) |++-|. .+.+-+.-+|.-||... T Consensus 1447 ILsEHR---vEalLECQ~FL~IE~~~ 1469 (1534) T TIGR01271 1447 ILSEHR---VEALLECQQFLVIEGSS 1469 (1534) T ss_pred EEECCC---HHHHHHHCCEEEEECCC T ss_conf 751122---22466403101442564 No 331 >PRK11701 phnK phosphonates transport ATP-binding protein; Provisional Probab=97.47 E-value=0.00018 Score=48.37 Aligned_cols=34 Identities=26% Similarity=0.382 Sum_probs=27.9 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 32545536732798-79998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+-+++.+++..+| +..|+|+|||||||++-+|. T Consensus 19 ~~aL~~Vs~~v~~GEi~~iiG~nGaGKSTLl~~i~ 53 (258) T PRK11701 19 RKGCRDVSFDLYPGEVLGIVGESGSGKTTLLNALS 53 (258) T ss_pred EEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 78871227788799799998889988999999985 No 332 >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Probab=97.46 E-value=5.5e-05 Score=51.75 Aligned_cols=36 Identities=25% Similarity=0.279 Sum_probs=29.3 Q ss_pred ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2232545536732798-79998689986444899999 Q gi|254780766|r 13 SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 13 ~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ..|.-.++.+++..+| +..|+|+|||||||++..|. T Consensus 35 ~~f~AL~dVsf~i~~GEivgllG~NGaGKSTLlk~I~ 71 (264) T PRK13546 35 KTFFALDDISLKAYEGDVIGLVGINGSGKSTLSNIIG 71 (264) T ss_pred CEEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 8899952707888599899999899861999999996 No 333 >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea. Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters. Probab=97.46 E-value=0.00017 Score=48.50 Aligned_cols=35 Identities=26% Similarity=0.406 Sum_probs=28.4 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +-.-+++.++++.+| +..++|+|||||||++.+|. T Consensus 11 ~~~il~~is~~i~~Ge~~~liG~nGsGKTTLl~~i~ 46 (180) T cd03214 11 GRTVLDDLSLSIEAGEIVGILGPNGAGKSTLLKTLA 46 (180) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999880437788699799999899988999999995 No 334 >KOG0996 consensus Probab=97.45 E-value=0.00027 Score=47.20 Aligned_cols=81 Identities=20% Similarity=0.317 Sum_probs=65.4 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCC Q ss_conf 3312205899999999999999999870899789980122015989999999997417--98099980696785432126 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~ 361 (375) +..+|.||+-+..|||++|-+. +...|+..||||.|-||-.+.--+.+|+.+. +.|+||-+...+.|.--+.. T Consensus 1193 I~NLSGGEKTLSSLALVFALH~-----YkPTPlYVMDEIDAALDfkNVSIVanYIkErTkNAQFIIISLRnnMFELa~rL 1267 (1293) T KOG0996 1193 ISNLSGGEKTLSSLALVFALHH-----YKPTPLYVMDEIDAALDFKNVSIVANYIKERTKNAQFIIISLRNNMFELANRL 1267 (1293) T ss_pred CCCCCCCHHHHHHHHHHHHHHC-----CCCCCCEEHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEEEEHHHHHHHHHHH T ss_conf 1167763257899999999971-----69987321214777513455146899999853377089997230089987665 Q ss_pred EEEEEECC Q ss_conf 00799728 Q gi|254780766|r 362 AKFMRISN 369 (375) Q Consensus 362 ~~~~~i~~ 369 (375) .=||.+.| T Consensus 1268 vGIYKtdn 1275 (1293) T KOG0996 1268 VGIYKTDN 1275 (1293) T ss_pred EEEEEECC T ss_conf 21375368 No 335 >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Probab=97.45 E-value=0.00094 Score=43.70 Aligned_cols=77 Identities=17% Similarity=0.314 Sum_probs=61.0 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-||+--+++|--|+ -++.++++||+.|-||...|..++++|.+. +.=.++-+||......+.+. T Consensus 141 eLSGGQ~QRiaIARAL~---------~~PklLIlDEptSaLD~siQa~IlnlL~~l~~~~~lt~l~IsHdl~~v~~~cdR 211 (252) T COG1124 141 ELSGGQRQRIAIARALI---------PEPKLLILDEPTSALDVSVQAQILNLLLELKKERGLTYLFISHDLALVEHMCDR 211 (252) T ss_pred HCCHHHHHHHHHHHHHC---------CCCCEEEECCCHHHHCHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH T ss_conf 12816899999999863---------688879953823441588999999999999986194599996729999988535 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +.-+.+|++. T Consensus 212 --i~Vm~~G~iv 221 (252) T COG1124 212 --IAVMDNGQIV 221 (252) T ss_pred --EEEEECCEEE T ss_conf --2540078278 No 336 >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.45 E-value=0.00026 Score=47.38 Aligned_cols=48 Identities=17% Similarity=0.308 Sum_probs=33.8 Q ss_pred CCCCEEEEEEEEEC-----CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 98851899999922-----32545536732798-79998689986444899999 Q gi|254780766|r 1 MTNRIKIKFLNISE-----FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 1 ~~~~M~i~~l~i~n-----FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) |++=..++.|+..= +..+++.++++.+| +..|+|+|||||||++-+|. T Consensus 1 M~~iiev~nl~~~Y~~~~~v~aL~~is~~i~~Ge~~aiiG~sGsGKSTL~~~l~ 54 (277) T PRK13642 1 MNKILEVENLVFKYEKESDVNQLNGVSFSITKGEWVSIIGQNGSGKSTTARLID 54 (277) T ss_pred CCCEEEEECEEEECCCCCCCEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 985399956699929999886644307998899899999999968999999996 No 337 >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.45 E-value=0.001 Score=43.44 Aligned_cols=75 Identities=24% Similarity=0.223 Sum_probs=53.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHH----HCCCCEEEEECCHHHHHHHHC Q ss_conf 3122058999999999999999998708997899801220159899999999974----179809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT----DIGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~----~~~~Qv~iTt~~~~~~~~~~~ 360 (375) .++|-|++.-+++|--|| ..+.||||||||+.||...+..+-+.|. +.+.-|++-|||-+---.+.+ T Consensus 129 ~qLSGGMrQRVaiARAL~---------~~P~lLLlDEPFgALDalTR~~lq~~l~~lw~~~~~TvllVTHdi~EAv~Lsd 199 (248) T COG1116 129 HQLSGGMRQRVAIARALA---------TRPKLLLLDEPFGALDALTREELQDELLRLWEETRKTVLLVTHDVDEAVYLAD 199 (248) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHC T ss_conf 001847999999999971---------49997987697412019999999999999999649889999089899976508 Q ss_pred CEEEEEECCC Q ss_conf 6007997289 Q gi|254780766|r 361 TAKFMRISNH 370 (375) Q Consensus 361 ~~~~~~i~~g 370 (375) . ++-+.++ T Consensus 200 R--ivvl~~~ 207 (248) T COG1116 200 R--VVVLSNR 207 (248) T ss_pred E--EEEECCC T ss_conf 8--9996489 No 338 >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.44 E-value=0.00018 Score=48.45 Aligned_cols=85 Identities=19% Similarity=0.234 Sum_probs=67.8 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) ..+|-|||--+-++-.|||.+-... ..-+|++|||-|-||..+|...+...-++ +.-|.+-=||.+.-..+.|. T Consensus 134 ~~LSGGEqQRVqlARvLaQl~~~v~---~~r~L~LDEPtsaLDi~HQ~~tl~laR~la~~g~~V~~VLHDLNLAA~YaDr 210 (259) T COG4559 134 RTLSGGEQQRVQLARVLAQLWPPVP---SGRWLFLDEPTSALDIAHQHHTLRLARQLAREGGAVLAVLHDLNLAAQYADR 210 (259) T ss_pred HHCCCHHHHHHHHHHHHHHCCCCCC---CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHE T ss_conf 5307338889999999997168778---8716885487200466889999999999986688389997445177874020 Q ss_pred EEEEEECCCEEEE Q ss_conf 0079972896895 Q gi|254780766|r 362 AKFMRISNHQALC 374 (375) Q Consensus 362 ~~~~~i~~g~~~~ 374 (375) ++-+.+|+++| T Consensus 211 --ivll~~Grv~a 221 (259) T COG4559 211 --IVLLHQGRVIA 221 (259) T ss_pred --EEEEECCEEEE T ss_conf --66402885761 No 339 >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Probab=97.43 E-value=0.00018 Score=48.45 Aligned_cols=35 Identities=29% Similarity=0.372 Sum_probs=27.5 Q ss_pred CCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 23254553673279-879998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.++++.+ .+..|+|+|||||||+|.+|. T Consensus 14 ~~~~L~~Vsl~I~~GEi~gLIGPNGAGKSTLLk~I~ 49 (409) T PRK09536 14 GTTILDGVDLSVREGHLVGVVGPNGAGKTTLLRAMN 49 (409) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 999892508898899899999998727999999996 No 340 >PRK13541 cytochrome c biogenesis protein CcmA; Provisional Probab=97.43 E-value=0.00011 Score=49.71 Aligned_cols=29 Identities=34% Similarity=0.571 Sum_probs=23.6 Q ss_pred HEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 53673279-879998689986444899999 Q gi|254780766|r 20 SLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 20 ~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +.++.+.+ .+++|+|+|||||||+|..|. T Consensus 18 disl~i~~G~i~~i~G~NGsGKSTLlk~i~ 47 (195) T PRK13541 18 DLSITFLPSAITYIKGANGCGKSSLLRMIA 47 (195) T ss_pred EEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 777787799799999999981999999996 No 341 >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Probab=97.43 E-value=0.00013 Score=49.32 Aligned_cols=31 Identities=29% Similarity=0.367 Sum_probs=26.2 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.++++.+| +..|+|+|||||||++..|. T Consensus 18 L~~is~~i~~Gei~~llG~NGaGKSTLl~~i~ 49 (220) T cd03263 18 VDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLT 49 (220) T ss_pred EECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 84408898499599999899973999999996 No 342 >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane. Probab=97.42 E-value=0.00031 Score=46.84 Aligned_cols=33 Identities=24% Similarity=0.440 Sum_probs=27.6 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 45536732798-7999868998644489999997 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) +++.++++.+| +..|+|+|||||||++-+|.-+ T Consensus 20 l~~isl~i~~Ge~~~iiG~sGsGKTTll~~i~Gl 53 (218) T cd03255 20 LKGVSLSIEKGEFVAIVGPSGSGKSTLLNILGGL 53 (218) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 8562899869989999999998699999999669 No 343 >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Probab=97.42 E-value=0.00019 Score=48.23 Aligned_cols=35 Identities=20% Similarity=0.342 Sum_probs=26.5 Q ss_pred CCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 23254553673279-879998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +..-+++.++++.+ .+.+|+|+|||||||++.+|. T Consensus 13 ~~~vL~~isl~i~~Gei~~iiG~nGaGKSTLl~~i~ 48 (248) T PRK09580 13 DKAILRGLNLEVRPGEVHAIMGPNGSGKSTLSATLA 48 (248) T ss_pred CEEEEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999996518898499799999999999999999983 No 344 >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein. Probab=97.41 E-value=0.00013 Score=49.34 Aligned_cols=31 Identities=29% Similarity=0.520 Sum_probs=25.6 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.+++..+| +..++|+|||||||++.+|. T Consensus 37 l~~vsf~i~~Gei~gLlGpNGaGKSTllk~l~ 68 (236) T cd03267 37 LKGISFTIEKGEIVGFIGPNGAGKTTTLKILS 68 (236) T ss_pred ECCCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 66805788489599999999830999999996 No 345 >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein. Probab=97.40 E-value=0.00014 Score=49.09 Aligned_cols=32 Identities=25% Similarity=0.399 Sum_probs=27.4 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -.++.+++..+| +..++|+|||||||++..|. T Consensus 20 al~~vs~~i~~Gei~gllG~NGaGKSTllk~i~ 52 (218) T cd03266 20 AVDGVSFTVKPGEVTGLLGPNGAGKTTTLRMLA 52 (218) T ss_pred EEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 872627898598299999999984999999997 No 346 >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.40 E-value=0.00014 Score=49.06 Aligned_cols=31 Identities=19% Similarity=0.381 Sum_probs=25.6 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++...|| +++|+|+|||||||+|-+|. T Consensus 23 L~~is~~i~~Gei~~llG~nGsGKSTLl~~l~ 54 (202) T cd03233 23 LKDFSGVVKPGEMVLVLGRPGSGCSTLLKALA 54 (202) T ss_pred EECEEEEECCCEEEEEECCCCCCHHHHHHHHH T ss_conf 97708898098499999899998899999983 No 347 >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Probab=97.39 E-value=0.00037 Score=46.37 Aligned_cols=31 Identities=19% Similarity=0.519 Sum_probs=25.7 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.+| +++|+|+|||||||++..|. T Consensus 23 L~~is~~i~~Ge~~~i~G~sGsGKSTLlk~i~ 54 (225) T PRK10247 23 LNNINFSLRAGEFKLITGPSGCGKSTLLKIVA 54 (225) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 94517998599699999999999999999996 No 348 >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.39 E-value=0.00037 Score=46.34 Aligned_cols=48 Identities=27% Similarity=0.398 Sum_probs=33.0 Q ss_pred CCCCEEEEEEEEEC---CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 98851899999922---3254553673279-879998689986444899999 Q gi|254780766|r 1 MTNRIKIKFLNISE---FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 1 ~~~~M~i~~l~i~n---FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) |+.=..++.++..= -+.+++.++++.+ .++.|+|+|||||||++..|. T Consensus 1 M~~~iev~nls~~Y~~g~~aL~~vs~~i~~Ge~~aiiG~NGsGKSTLl~~l~ 52 (273) T PRK13647 1 MNLAIEIEDLTFFYPDGTKALDGVSLVIPEGSKTAILGPNGAGKSTLLLHLN 52 (273) T ss_pred CCEEEEEEEEEEEECCCCEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 9707999848999799888988117898899899999999975999999996 No 349 >PRK13540 cytochrome c biogenesis protein CcmA; Provisional Probab=97.39 E-value=0.00023 Score=47.65 Aligned_cols=35 Identities=26% Similarity=0.370 Sum_probs=26.9 Q ss_pred CCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 23254553673279-879998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +-.-+++..+++.+ .+..|+|+|||||||++-.|. T Consensus 13 ~~~vl~~is~~i~~G~i~~l~G~NGaGKSTLlkli~ 48 (200) T PRK13540 13 DQPLLQQISFHLPAGGLLHLKGSNGAGKTTLLKLIA 48 (200) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999881227898799799998899987999999997 No 350 >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility. Probab=97.39 E-value=0.00018 Score=48.31 Aligned_cols=35 Identities=20% Similarity=0.330 Sum_probs=28.4 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++-.++.+++..+| +..++|+|||||||++.+|. T Consensus 14 ~~~al~~vsf~v~~Gei~gllGpNGAGKTTl~~~l~ 49 (301) T TIGR03522 14 TQNALDEVSFEAQKGRIVGFLGPNGAGKSTTMKIIT 49 (301) T ss_pred CEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 999973606788598199999999981999999996 No 351 >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Probab=97.39 E-value=0.0021 Score=41.40 Aligned_cols=34 Identities=21% Similarity=0.261 Sum_probs=25.3 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 32545536732798-79998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) |-.+.+..++..+| .-.|+|+|||||||+|-.|. T Consensus 37 f~ALknVSFeV~kGE~vGIIG~NGAGKSTLLKiIa 71 (549) T PRK13545 37 HYALNNISFEVPEGEIVGIVGLNGSGKSTLSNLIA 71 (549) T ss_pred EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 77340725786489899998899998999999996 No 352 >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter. The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE. Probab=97.37 E-value=0.00016 Score=48.67 Aligned_cols=31 Identities=29% Similarity=0.567 Sum_probs=25.5 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++.+.+ .+.+|+|+|||||||++.+|. T Consensus 16 l~~vs~~i~~Ge~~~l~G~NGsGKSTLlk~i~ 47 (201) T cd03231 16 FSGLSFTLAAGEALQVTGPNGSGKTTLLRILA 47 (201) T ss_pred EECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 95307888799599999999999999999996 No 353 >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Probab=97.37 E-value=0.0011 Score=43.22 Aligned_cols=76 Identities=25% Similarity=0.382 Sum_probs=55.6 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---C-CCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417---9-8099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---G-SQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~-~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.|||-..+++-.| ..++.+||+|||.+-|||+--..+++.++++ + .||++| ++-+.-... - T Consensus 141 hlsggqqqrvaiaral---------mmkpqvllfdeptaaldpeitaqvv~iikel~~tgitqvivt-hev~va~k~--a 208 (242) T COG4161 141 HLSGGQQQRVAIARAL---------MMEPQVLLFDEPTAALDPEITAQIVSIIKELAETGITQVIVT-HEVEVARKT--A 208 (242) T ss_pred ECCCCHHHHHHHHHHH---------HCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEE-EEHHHHHHH--H T ss_conf 1266313459999998---------458867963586221587889999999999875685189998-431477764--3 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +++..+++|.|. T Consensus 209 s~vvyme~g~iv 220 (242) T COG4161 209 SRVVYMENGHIV 220 (242) T ss_pred HHEEEEECCEEE T ss_conf 416753267467 No 354 >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Probab=97.36 E-value=0.00039 Score=46.17 Aligned_cols=49 Identities=18% Similarity=0.277 Sum_probs=34.1 Q ss_pred CCCCEEEEEEEE--ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 988518999999--2232545536732798-799986899864448999999 Q gi|254780766|r 1 MTNRIKIKFLNI--SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 1 ~~~~M~i~~l~i--~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) |++=..++.|+- .+..-.++.+++..+| +..|+|+|||||||+|..|.= T Consensus 16 mtPliev~nlsk~y~~~~al~~vsl~I~~GE~~~llGpsGsGKSTllr~i~G 67 (377) T PRK11607 16 LTPLLEIRNLTKSFDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAG 67 (377) T ss_pred CCCEEEEEEEEEEECCEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 8877999858999999999905187999998999999998489999999976 No 355 >PRK11144 modC molybdate transporter ATP-binding protein; Provisional Probab=97.36 E-value=0.00028 Score=47.15 Aligned_cols=31 Identities=35% Similarity=0.520 Sum_probs=24.1 Q ss_pred HEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 53673279-87999868998644489999997 Q gi|254780766|r 20 SLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 20 ~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) +.+++..+ +++.|+|+|||||||+|.+|.=+ T Consensus 16 dv~l~i~~g~i~~l~GpsGaGKTTLl~~iaGl 47 (352) T PRK11144 16 TVNLTLPAQGITAIFGRSGAGKTSLINLISGL 47 (352) T ss_pred EEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99999889989999999996299999999768 No 356 >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein; InterPro: IPR011924 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents LolD, a member of the ABC transporter family. LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on the residue immediately following the modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. Excluded from this entry are homologs from the archaeal genus Methanosarcina .; GO: 0005524 ATP binding, 0006810 transport, 0016020 membrane. Probab=97.36 E-value=0.00094 Score=43.71 Aligned_cols=76 Identities=18% Similarity=0.389 Sum_probs=60.8 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) =+|-||.=-+++|=-|. +++-+||=|||-.+||..+-..|++.+.++ +.=.+|-|||..+...+. T Consensus 141 ELSGGERQRvAIARALv---------N~P~lvlADEPTGNLD~~~a~~iF~L~~eLN~~~~TsflvVTHD~~LA~k~~-- 209 (221) T TIGR02211 141 ELSGGERQRVAIARALV---------NQPSLVLADEPTGNLDNNNAKSIFELMLELNRELNTSFLVVTHDLELAKKLD-- 209 (221) T ss_pred CCCCCHHHHHHHHHHHH---------CCCCEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCC-- T ss_conf 34563379999999861---------8976586129885323777999999999988653916999834757873021-- Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +..+++||++. T Consensus 210 -r~L~m~~G~L~ 220 (221) T TIGR02211 210 -RVLEMKDGQLF 220 (221) T ss_pred -EEEEEECCCCC T ss_conf -02663088557 No 357 >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.36 E-value=0.00018 Score=48.38 Aligned_cols=32 Identities=19% Similarity=0.469 Sum_probs=26.0 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -+++.+++..+| ++.|+|+|||||||++..|. T Consensus 21 aL~~isl~I~~Ge~~aiiG~NGaGKSTLl~~i~ 53 (285) T PRK13636 21 ALKGININIKKGEVTAILGGNGAGKSTLFQNLN 53 (285) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 876137898799899999999980999999996 No 358 >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.34 E-value=0.00019 Score=48.21 Aligned_cols=32 Identities=22% Similarity=0.448 Sum_probs=27.3 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+++.++++.+| +..|+|+|||||||++..|. T Consensus 22 aL~~vsl~I~~Ge~~aiiG~nGsGKSTLl~~l~ 54 (286) T PRK13646 22 AIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNIN 54 (286) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 662417798699899999999981999999997 No 359 >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2. Probab=97.34 E-value=0.0002 Score=48.12 Aligned_cols=36 Identities=19% Similarity=0.385 Sum_probs=27.8 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 32545536732798-7999868998644489999997 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) |+-.++.+++..+| +..|+|+|||||||++..|.=+ T Consensus 35 ~~AL~~isf~i~~GeivgilG~NGaGKSTLl~~i~Gl 71 (224) T cd03220 35 FWALKDVSFEVPRGERIGLIGRNGAGKSTLLRLLAGI 71 (224) T ss_pred EEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 6987670789838989999979998199999999758 No 360 >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Probab=97.34 E-value=0.00028 Score=47.09 Aligned_cols=33 Identities=24% Similarity=0.459 Sum_probs=26.3 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 545536732798-799986899864448999999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) -+++.+++..+| +..|+|+|||||||++.+|.= T Consensus 16 ~L~dvs~~i~~Ge~~~liG~nGsGKSTll~~i~G 49 (240) T PRK09493 16 VLHNIDLNIDQGEVVVIIGPSGSGKSTLLRCINK 49 (240) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 8813078987998999999999809999999963 No 361 >PRK11124 artP arginine transporter ATP-binding subunit; Provisional Probab=97.33 E-value=0.00036 Score=46.39 Aligned_cols=34 Identities=18% Similarity=0.436 Sum_probs=26.5 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 2545536732798-799986899864448999999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .-+++.+++..+| +..|+|+|||||||++..|.- T Consensus 16 ~aL~dvsl~i~~Ge~~~iiG~nGaGKSTLl~~l~g 50 (242) T PRK11124 16 QALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNL 50 (242) T ss_pred EEEEEEEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 98942077887998999999999719999999965 No 362 >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR). DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus. Probab=97.32 E-value=0.00018 Score=48.43 Aligned_cols=31 Identities=23% Similarity=0.380 Sum_probs=26.0 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.+++..+| +..|+|+|||||||++.+|. T Consensus 25 L~~vs~~v~~Gei~~ilGpnGaGKSTLl~~l~ 56 (194) T cd03213 25 LKNVSGKAKPGELTAIMGPSGAGKSTLLNALA 56 (194) T ss_pred EECCEEEEECCEEEEEECCCCCHHHHHHHHHH T ss_conf 88838899088199999899951999999985 No 363 >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=97.32 E-value=0.00028 Score=47.17 Aligned_cols=32 Identities=16% Similarity=0.315 Sum_probs=24.9 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHH Q ss_conf 4553673279-8799986899864448999999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~ 49 (375) +++.++++.+ .+++|+|+|||||||++-++-+ T Consensus 11 L~~vsl~i~~G~~~aIiG~sGsGKSTLl~~~L~ 43 (261) T cd03271 11 LKNIDVDIPLGVLTCVTGVSGSGKSSLINDTLY 43 (261) T ss_pred CCCEEEEECCCCEEEEECCCCCCHHHHHHHHHH T ss_conf 778588988999999987999869999999988 No 364 >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.31 E-value=0.00021 Score=47.97 Aligned_cols=32 Identities=22% Similarity=0.397 Sum_probs=26.8 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+++.++++.+| +..|+|+|||||||++..|. T Consensus 17 aL~~vsl~i~~Ge~vaiiG~nGsGKSTL~~~l~ 49 (274) T PRK13644 17 ALENINLVIKKGEYIGIIGKNGSGKSTLALHLN 49 (274) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 663117798489999999999980999999997 No 365 >PTZ00265 multidrug resistance protein (mdr1); Provisional Probab=97.31 E-value=0.0028 Score=40.59 Aligned_cols=31 Identities=35% Similarity=0.714 Sum_probs=24.3 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) ++++.+.+.+ ..+.|||+-|||||||+--|. T Consensus 401 L~~~sl~i~~G~t~AlVG~SGsGKSTii~LL~ 432 (1467) T PTZ00265 401 YKDLNFTLKEGKTYAFVGESGCGKSTILKLIE 432 (1467) T ss_pred CCCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 06833886389779986688875667999996 No 366 >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.31 E-value=0.00021 Score=47.99 Aligned_cols=34 Identities=15% Similarity=0.263 Sum_probs=27.4 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 2545536732798-799986899864448999999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .-+++.+++..+| ++.|+|+|||||||++..|.= T Consensus 16 ~al~~vsl~I~~Ge~vaiiG~nGsGKSTLl~~l~G 50 (275) T PRK13639 16 VALKGINFKAEEGEMIAILGPNGAGKSTLFLHFNG 50 (275) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 99986488998998999999999649999999973 No 367 >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.30 E-value=0.00022 Score=47.86 Aligned_cols=34 Identities=21% Similarity=0.458 Sum_probs=27.5 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 545536732798-7999868998644489999997 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) -+++.++++.+| +..|+|+|||||||+|-+|.-+ T Consensus 16 ~L~~isl~i~~Ge~~~iiGpsGsGKSTLl~~i~gl 50 (241) T cd03256 16 ALKDVSLSINPGEFVALIGPSGAGKSTLLRCLNGL 50 (241) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99783889999989999999983399999999749 No 368 >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Probab=97.30 E-value=0.0016 Score=42.16 Aligned_cols=79 Identities=16% Similarity=0.203 Sum_probs=61.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) --+|-||..-+=|+.-| + ...-+|++|||.-.||-..+..+.++|++. ++-|..|||..+-+..+.+ T Consensus 155 r~LSlGqRmraeLaaaL-----L----h~p~VLfLDEpTvgLDV~aq~~ir~Flke~n~~~~aTVllTTH~~~di~~lc~ 225 (325) T COG4586 155 RKLSLGQRMRAELAAAL-----L----HPPKVLFLDEPTVGLDVNAQANIREFLKEYNEERQATVLLTTHIFDDIATLCD 225 (325) T ss_pred HHCCCHHHHHHHHHHHH-----C----CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHH T ss_conf 65360578899999985-----6----89838974487457514389999999999877537369998411213888634 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ++.|.+|+++- T Consensus 226 r--v~~I~~Gqlv~ 237 (325) T COG4586 226 R--VLLIDQGQLVF 237 (325) T ss_pred H--EEEEECCCEEE T ss_conf 3--69960782864 No 369 >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Probab=97.29 E-value=0.00036 Score=46.42 Aligned_cols=33 Identities=27% Similarity=0.498 Sum_probs=26.5 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 45536732798-7999868998644489999997 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) +++.+++..+| +..|+|+|||||||++-+|.-+ T Consensus 17 l~~vsl~i~~Ge~~aliG~sGsGKSTLl~~l~gl 50 (248) T PRK11264 17 LHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLL 50 (248) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 9431779879989999999998099999999758 No 370 >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Probab=97.28 E-value=0.00035 Score=46.46 Aligned_cols=32 Identities=28% Similarity=0.420 Sum_probs=26.0 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 45536732798-799986899864448999999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) +++.+++..+| +..|+|+|||||||++-.|.= T Consensus 28 L~dIs~~I~~GEiv~LiG~nGaGKSTLlr~i~G 60 (257) T PRK11247 28 LNQLDLHIPAGQFVAVVGRSGCGKSTLLRLLAG 60 (257) T ss_pred ECCEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 824075887998999998998889999999965 No 371 >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine. MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). Probab=97.27 E-value=0.00044 Score=45.88 Aligned_cols=36 Identities=22% Similarity=0.364 Sum_probs=28.3 Q ss_pred ECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2232545536732798-79998689986444899999 Q gi|254780766|r 13 SEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 13 ~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.-.++.+++..+| +..|+|+|||||||++.+|. T Consensus 11 g~~~aL~~vsl~i~~Gei~gliG~nGaGKSTL~~~i~ 47 (236) T cd03219 11 GGLVALDDVSFSVRPGEIHGLIGPNGAGKTTLFNLIS 47 (236) T ss_pred CCEEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 9999872338998899899999899973999999996 No 372 >PRK10744 phosphate transporter subunit; Provisional Probab=97.26 E-value=0.0004 Score=46.15 Aligned_cols=36 Identities=28% Similarity=0.549 Sum_probs=27.5 Q ss_pred CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 3254553673279-87999868998644489999997 Q gi|254780766|r 15 FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) +.-+++.+++..+ .+..|+|+|||||||++-+|.-+ T Consensus 23 ~~aL~~vsl~i~~Ge~~~liG~nGaGKSTLlk~i~gl 59 (257) T PRK10744 23 FHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKM 59 (257) T ss_pred EEEECCCEEEECCCCEEEEECCCCCCHHHHHHHHHHH T ss_conf 7678142899889989999999998199999999876 No 373 >PRK13651 cobalt transporter ATP-binding subunit; Provisional Probab=97.26 E-value=0.00027 Score=47.23 Aligned_cols=33 Identities=18% Similarity=0.427 Sum_probs=26.9 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2545536732798-79998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +-+++.+++..+| +..|+|+|||||||++-.|. T Consensus 21 ~AL~dvsl~I~~GE~v~IiG~nGsGKSTL~k~l~ 54 (304) T PRK13651 21 KALDGVSTEINQGEFIAIIGQTGSGKTTFIEHLN 54 (304) T ss_pred EEEECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 6863405798599899998799985999999996 No 374 >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome. The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt Probab=97.26 E-value=0.00026 Score=47.29 Aligned_cols=31 Identities=19% Similarity=0.485 Sum_probs=25.6 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+| ...|+|+|||||||++-+|. T Consensus 17 l~~isl~i~~Ge~v~i~G~sGsGKSTLl~~l~ 48 (166) T cd03223 17 LKDLSFEIKPGDRLLITGPSGTGKSSLFRALA 48 (166) T ss_pred EEEEEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 94458898899999999589998899999986 No 375 >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Probab=97.25 E-value=0.00042 Score=45.96 Aligned_cols=34 Identities=29% Similarity=0.427 Sum_probs=26.2 Q ss_pred CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 3254553673279-879998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +.-.++.+++..+ .+..|+|+|||||||++.+|. T Consensus 13 ~~~L~~vs~~v~~Gei~~liGpNGaGKSTL~~~i~ 47 (230) T TIGR03410 13 SHILRGVSLEVPKGEVTCVLGRNGVGKTTLLKTLM 47 (230) T ss_pred EEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 66888717799999799999999940999999997 No 376 >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate. Probab=97.25 E-value=0.00029 Score=47.08 Aligned_cols=31 Identities=26% Similarity=0.395 Sum_probs=25.2 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++.+.+| ++.|+|+|||||||++-+|. T Consensus 21 L~~isl~i~~Ge~~~IvG~sGsGKSTLl~~i~ 52 (204) T cd03250 21 LKDINLEVPKGELVAIVGPVGSGKSSLLSALL 52 (204) T ss_pred EEEEEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 52148997699899999999985899999981 No 377 >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin. In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.23 E-value=0.00033 Score=46.64 Aligned_cols=35 Identities=20% Similarity=0.376 Sum_probs=27.7 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 232545536732798-79998689986444899999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ++.-.++.+++..+| +..++|+|||||||++-.|. T Consensus 12 ~~~al~~is~~v~~Gei~gllGpNGAGKSTll~~i~ 47 (220) T cd03265 12 DFEAVRGVSFRVRRGEIFGLLGPNGAGKTTTIKMLT 47 (220) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 999985826798898399999999871999999997 No 378 >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.23 E-value=0.00027 Score=47.24 Aligned_cols=33 Identities=24% Similarity=0.441 Sum_probs=26.8 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 545536732798-799986899864448999999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) -+++.++++.+| +..|+|+|||||||+|.+|.= T Consensus 19 al~~vsl~i~~Ge~~~iiGpsGsGKSTLl~~i~G 52 (220) T cd03293 19 ALEDISLSVEEGEFVALVGPSGCGKSTLLRIIAG 52 (220) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 9967188987998999999999579999999975 No 379 >PRK13537 lipooligosaccharide transporter ATP-binding subunit; Provisional Probab=97.23 E-value=0.00036 Score=46.46 Aligned_cols=31 Identities=26% Similarity=0.353 Sum_probs=25.4 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.+++..+| +..|+|||||||||++..|. T Consensus 21 l~~vs~~V~~Gei~gllGpNGAGKTTli~~l~ 52 (304) T PRK13537 21 VDGLSFHVQPGECFGLLGPNGAGKTTTLKMLL 52 (304) T ss_pred ECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 83717788699599999998972999999997 No 380 >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.22 E-value=0.0023 Score=41.14 Aligned_cols=40 Identities=25% Similarity=0.383 Sum_probs=33.1 Q ss_pred EEEEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 99992232545536732798-79998689986444899999 Q gi|254780766|r 9 FLNISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 9 ~l~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) ++++.+=|-....++++.|| ++.|+|+||+||||+|-+++ T Consensus 8 s~~~~Gr~ll~~vsl~~~pGev~ailGPNGAGKSTlLk~Ls 48 (259) T COG4559 8 SYSLAGRRLLDGVSLDLRPGEVLAILGPNGAGKSTLLKALS 48 (259) T ss_pred EEEEECCEECCCCCEECCCCCEEEEECCCCCCHHHHHHHHH T ss_conf 89841101104731541687279998889865888999861 No 381 >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.22 E-value=0.00086 Score=43.95 Aligned_cols=47 Identities=17% Similarity=0.355 Sum_probs=30.4 Q ss_pred CCCEEEEEEEEECC-------CCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 88518999999223-------254553673279-879998689986444899999 Q gi|254780766|r 2 TNRIKIKFLNISEF-------RNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 2 ~~~M~i~~l~i~nF-------R~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) ++...++.++..=- +-+.+.++++.+ .+..|+|+|||||||++-.|. T Consensus 4 ~~~I~~~nvs~~Y~~~~~~~~~AL~~vsl~i~~Ge~~aIiG~nGsGKSTL~~~l~ 58 (289) T PRK13645 4 SKDIILDNVSYTYAKKTPFEFKALNNTSLTFKKNKVTCVIGTTGSGKSTMIQLTN 58 (289) T ss_pred CCCEEEEEEEEEECCCCCCCCEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 9968999889995926988365865328898899899999999957999999996 No 382 >PRK10418 nikD nickel transporter ATP-binding protein; Provisional Probab=97.22 E-value=0.0006 Score=44.97 Aligned_cols=48 Identities=19% Similarity=0.322 Sum_probs=34.3 Q ss_pred CCCCEEEEEEEEECCCC-HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 98851899999922325-4553673279-879998689986444899999 Q gi|254780766|r 1 MTNRIKIKFLNISEFRN-YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 1 ~~~~M~i~~l~i~nFR~-~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) |++-..|+.|+++.=+- +++.+++..+ .+..|+|+||||||+++-++- T Consensus 1 M~~~lEirnl~~~~~~~vL~~Isl~v~~Ge~~aiiG~SGsGKStl~k~ll 50 (254) T PRK10418 1 MPQQIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAAAL 50 (254) T ss_pred CCCCEEECCEEEECCCEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 99858982608989970886607289899999999999878999999995 No 383 >TIGR01166 cbiO cobalt ABC transporter, ATP-binding protein; InterPro: IPR005876 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. This superfamily includes two groups, one which catalyses the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drives both the process of uptake and efflux.; GO: 0006824 cobalt ion transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=97.22 E-value=0.00024 Score=47.51 Aligned_cols=30 Identities=23% Similarity=0.506 Sum_probs=21.8 Q ss_pred HHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 553673279-879998689986444899999 Q gi|254780766|r 19 ASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 19 ~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +.+.+.+.. ..++++|+|||||||++-.+. T Consensus 9 ~gln~~~~~G~~~aLlG~NGaGKsTLl~~Ln 39 (190) T TIGR01166 9 KGLNFAVERGEVLALLGANGAGKSTLLLHLN 39 (190) T ss_pred CCCCEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 5423022057168987289985789988743 No 384 >PRK10908 cell division protein FtsE; Provisional Probab=97.21 E-value=0.00029 Score=47.02 Aligned_cols=33 Identities=18% Similarity=0.370 Sum_probs=26.5 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 545536732798-799986899864448999999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .+++.++++.+| +..|+|+|||||||++-+|.= T Consensus 17 ~L~~vsl~i~~Ge~~~liG~nGsGKSTLl~~i~G 50 (222) T PRK10908 17 ALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICG 50 (222) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 9864387996998999999998079999999965 No 385 >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.20 E-value=0.00074 Score=44.36 Aligned_cols=31 Identities=26% Similarity=0.393 Sum_probs=25.5 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.++++.+| +..|+|+|||||||++-.|. T Consensus 25 L~~is~~i~~Ge~vaiiG~sGsGKSTLl~ll~ 56 (269) T PRK13648 25 LKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMI 56 (269) T ss_pred EEEEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 66458998599899999999997999999996 No 386 >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.20 E-value=0.00071 Score=44.50 Aligned_cols=31 Identities=19% Similarity=0.441 Sum_probs=25.8 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.+| +..|+|+|||||||++-.|. T Consensus 26 L~~isl~i~~Ge~vaivG~nGsGKSTLlk~l~ 57 (273) T PRK13632 26 LKNVSFTINEGEYVAILGHNGSGKSTISKILT 57 (273) T ss_pred EEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 66428898499899999999986999999997 No 387 >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.20 E-value=0.00033 Score=46.63 Aligned_cols=32 Identities=25% Similarity=0.442 Sum_probs=26.1 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -+++.++++.+| ++.|+|+|||||||++-.|. T Consensus 22 aL~~Vsl~i~~Ge~~aiiG~nGsGKSTLl~~l~ 54 (280) T PRK13649 22 ALFDVNLDILDGSYTAFIGHTGSGKSTIMQLLN 54 (280) T ss_pred EEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 541026898799899999599986999999996 No 388 >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701 Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se .. Probab=97.20 E-value=0.00023 Score=47.72 Aligned_cols=51 Identities=31% Similarity=0.416 Sum_probs=41.7 Q ss_pred HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCC Q ss_conf 2331220589999999999999999987089978998012201598999999999741798 Q gi|254780766|r 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS 343 (375) Q Consensus 283 ~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~ 343 (375) +.+| |-|||=-+=+|--|. ...||||+|||-|=||..++.-+++.+.+.+. T Consensus 147 PaTF-SGGEqQRVNIARg~i---------~d~PiLLLdEPTASLd~~nr~vVvELi~e~K~ 197 (224) T TIGR02324 147 PATF-SGGEQQRVNIARGFI---------ADYPILLLDEPTASLDATNRKVVVELIAEAKA 197 (224) T ss_pred CCCC-CCCHHHHHHHHHHHH---------CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH T ss_conf 8865-660589999987652---------57740011355402411424889999999976 No 389 >PRK13536 nodulation factor exporter subunit NodI; Provisional Probab=97.20 E-value=0.00044 Score=45.87 Aligned_cols=34 Identities=24% Similarity=0.245 Sum_probs=26.4 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 2545536732798-799986899864448999999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .-.++++++..+| +..|+|+|||||||++..|.= T Consensus 21 ~al~~vs~~v~~Gei~gllGpNGAGKSTli~~l~G 55 (306) T PRK13536 21 PVVNGLSFTVASGECFGLLGPNGAGKSTIARMILG 55 (306) T ss_pred EEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 98716177885996999999989809999999967 No 390 >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.19 E-value=0.0003 Score=46.98 Aligned_cols=31 Identities=13% Similarity=0.476 Sum_probs=25.1 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.+++..+| +..|+|+|||||||++-.|. T Consensus 23 L~~vsl~I~~Ge~~~iiG~nGsGKSTLl~~l~ 54 (286) T PRK13641 23 LDNISFELEDGSFVALIGHTGSGKSTLMQHFN 54 (286) T ss_pred EEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 43106798699999999999839999999996 No 391 >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Probab=97.19 E-value=0.00042 Score=46.00 Aligned_cols=28 Identities=25% Similarity=0.561 Sum_probs=22.8 Q ss_pred EEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 36732798-79998689986444899999 Q gi|254780766|r 21 LRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 21 ~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+++..+| +..|+|+|||||||++-+|. T Consensus 18 isl~i~~GE~v~iiG~nGaGKSTLl~~i~ 46 (233) T PRK10771 18 FTLTVERGEQVAILGPSGAGKSTLLNLIA 46 (233) T ss_pred EEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 78898899899999999981999999996 No 392 >pfam12128 DUF3584 Protein of unknown function (DUF3584). This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. There are two conserved sequence motifs: GKT and YLP. Probab=97.17 E-value=0.0033 Score=40.10 Aligned_cols=33 Identities=30% Similarity=0.448 Sum_probs=26.9 Q ss_pred HHE-EEECCCCEEEEECCCCCCHHHHHHHHHHHCC Q ss_conf 553-6732798799986899864448999999728 Q gi|254780766|r 19 ASL-RLVFDAQHTIFVGDNGVGKTNILEAISFLSP 52 (375) Q Consensus 19 ~~~-~i~f~~~~n~i~G~NG~GKT~iLEAI~~l~~ 52 (375) ..+ +|.++ |.|-|+|-||+||||+|-||-|+-+ T Consensus 9 G~vaEl~ld-Gnt~~~GTnG~GKTTlLRlIp~FYg 42 (1192) T pfam12128 9 GVVNELDLD-GHTNICGTNAAGKTTLQRLIPLFYG 42 (1192) T ss_pred CCEEEEECC-CCEEEECCCCCCHHHHHHHHHHHCC T ss_conf 612577337-8725744888869999989997528 No 393 >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.16 E-value=0.00035 Score=46.46 Aligned_cols=31 Identities=19% Similarity=0.381 Sum_probs=25.4 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.+++..+| +..|+|+|||||||++-+|. T Consensus 23 L~~isl~i~~GE~vaivG~nGsGKSTL~k~l~ 54 (279) T PRK13635 23 LKDVSFSVYEGEWVAIVGHNGSGKSTLAKLLN 54 (279) T ss_pred EEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 76307688799899999999965999999997 No 394 >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP. Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.15 E-value=0.00047 Score=45.64 Aligned_cols=29 Identities=34% Similarity=0.526 Sum_probs=22.8 Q ss_pred EEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 36732798-799986899864448999999 Q gi|254780766|r 21 LRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 21 ~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .++++.+| +.+|+|+|||||||+|-.|.= T Consensus 17 i~l~i~~Ge~~~ilGpSGsGKSTLl~li~G 46 (211) T cd03298 17 FDLTFAQGEITAIVGPSGSGKSTLLNLIAG 46 (211) T ss_pred EEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 788988998999999999559999999976 No 395 >TIGR00958 3a01208 antigen peptide transporter 2; InterPro: IPR005293 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Proteins of this family are involved in the transport of antigens from the cytoplasm to a membrane-bound compartment for association with MHC class I molecules.; GO: 0005215 transporter activity, 0006810 transport. Probab=97.15 E-value=0.00027 Score=47.22 Aligned_cols=78 Identities=15% Similarity=0.261 Sum_probs=49.2 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH-----CCC-CEEEEECCHHHHHH Q ss_conf 331220589999999999999999987089978998012201598999999999741-----798-09998069678543 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD-----IGS-QIFMTGTDKSVFDS 357 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~-----~~~-Qv~iTt~~~~~~~~ 357 (375) .+++|-||+=-+++|=-|- .++.||++||.-|=||...+..+=..+.+ .+. =|++=+|..... T Consensus 668 G~qlSgGQKQRiAiARALv---------R~P~vLILDEATSALDa~~~~~~e~~lq~A~~~~~~~rTv~~IahrLstv-- 736 (770) T TIGR00958 668 GSQLSGGQKQRIAIARALV---------RKPRVLILDEATSALDAESQLEVEQLLQEALSRSRKSRTVLLIAHRLSTV-- 736 (770) T ss_pred CCCCCCHHHHHHHHHHHHH---------HCCEEEEECCHHHHHCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHH-- T ss_conf 8752303899999998875---------18905740001102136654789999999863530698089982651576-- Q ss_pred HHCCEEEEEECCCEEE Q ss_conf 2126007997289689 Q gi|254780766|r 358 LNETAKFMRISNHQAL 373 (375) Q Consensus 358 ~~~~~~~~~i~~g~~~ 373 (375) .+--+++-|+.|++- T Consensus 737 -~~a~~i~vl~~G~v~ 751 (770) T TIGR00958 737 -ERADKILVLKKGSVV 751 (770) T ss_pred -HHCCCEEEECCCEEE T ss_conf -525504873376444 No 396 >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion. Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases. Probab=97.14 E-value=0.00047 Score=45.67 Aligned_cols=27 Identities=15% Similarity=0.341 Sum_probs=22.3 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHH Q ss_conf 45536732798-7999868998644489 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNIL 44 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iL 44 (375) +++.++++.+| +++|+|+|||||||++ T Consensus 11 L~~Vsl~i~~Ge~~aIvG~nGsGKSTL~ 38 (226) T cd03270 11 LKNVDVDIPRNKLVVITGVSGSGKSSLA 38 (226) T ss_pred CCCEEEEECCCCEEEEECCCCCHHHHHH T ss_conf 5674899859989999878996098983 No 397 >TIGR01187 potA polyamine ABC transporter, ATP-binding protein; InterPro: IPR005893 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family comprises the spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belongs to the larger ATP-Binding Cassette (ABC) transporter superfamily. Polyamines like spermidine and putrescine play a vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).; GO: 0015417 polyamine-transporting ATPase activity, 0015846 polyamine transport, 0016020 membrane. Probab=97.14 E-value=0.0035 Score=39.97 Aligned_cols=77 Identities=21% Similarity=0.232 Sum_probs=56.7 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECC-HHHHHHHH Q ss_conf 31220589999999999999999987089978998012201598999999999741----79809998069-67854321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTD-KSVFDSLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~-~~~~~~~~ 359 (375) .++|-|||=-++||=-++ +++-||||||+.+=||...|+..=..|.. ++.=+++-||| ...+.- . T Consensus 99 ~qLSGGQ~QRvAlARa~v---------~kPk~LLlDEpLsALD~kLR~~MQ~ELk~~~~~LGiT~v~VTHDQ~EA~TM-s 168 (331) T TIGR01187 99 HQLSGGQQQRVALARALV---------FKPKILLLDEPLSALDKKLRDQMQLELKTLQEQLGITFVFVTHDQEEALTM-S 168 (331) T ss_pred CCCCCCHHHHHHHHHHHH---------CCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHH-H T ss_conf 104685289999999986---------089567711772264389899889999999872682899970184898754-0 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) +. |.-+++|+|. T Consensus 169 DR--I~~l~~Gki~ 180 (331) T TIGR01187 169 DR--IAILRKGKIA 180 (331) T ss_pred CE--EEEECCCEEE T ss_conf 20--2421387588 No 398 >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents the ATP-binding subunit DevA, found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The ABC transporter encoded by the devBCA operon is induced by nitrogen deficiency and is necessary for the formation of the laminated layer which envelops heterocysts , . It is thought to be involved in the export of either the heterocyst-specific glycolipids found in the laminated layer, or an enzyme essential for their formation.. Probab=97.12 E-value=0.00074 Score=44.39 Aligned_cols=76 Identities=18% Similarity=0.363 Sum_probs=63.4 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHC Q ss_conf 312205899999999999999999870899789980122015989999999997417----9809998069678543212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~ 360 (375) ..+|-||+=-+++|=-|. ..+.++|=|||-|=||..-=+.+++.+++. ++=|.+-|||+.+++- .| T Consensus 140 ~~LSGGQKQRVAIARALv---------~~P~LvLADEPTAALD~~SGr~VV~Lm~~lA~eqGc~iL~VTHD~RIlDv-AD 209 (220) T TIGR02982 140 ENLSGGQKQRVAIARALV---------ARPKLVLADEPTAALDSKSGRDVVELMQKLAREQGCTILLVTHDNRILDV-AD 209 (220) T ss_pred CCCCCCCHHHHHHHHHHH---------CCCCEEECCCCCHHHHHCCCHHHHHHHHHHHHHHCCEEEEEECCCCHHHH-HH T ss_conf 436786168999999973---------38976762577233221133899999999887719889998367312006-54 Q ss_pred CEEEEEECCCEE Q ss_conf 600799728968 Q gi|254780766|r 361 TAKFMRISNHQA 372 (375) Q Consensus 361 ~~~~~~i~~g~~ 372 (375) . ++++|+|++ T Consensus 210 R--I~~MEdG~L 219 (220) T TIGR02982 210 R--IVQMEDGKL 219 (220) T ss_pred H--HHHCCCCCC T ss_conf 4--421168635 No 399 >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Probab=97.12 E-value=0.005 Score=38.97 Aligned_cols=77 Identities=17% Similarity=0.305 Sum_probs=61.9 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|-|+.--+++|+-|| ....+++-|||..-||...|..+++.|.++ +.=+++-|||..+...+.+. T Consensus 153 elSGGMrQRV~IAmal~---------~~P~LlIADEPTTALDvtvQaqIl~ll~~l~~e~~~siilITHDl~vva~~aDr 223 (316) T COG0444 153 ELSGGMRQRVMIAMALA---------LNPKLLIADEPTTALDVTVQAQILDLLKELQREKGTALILITHDLGVVAEIADR 223 (316) T ss_pred CCCCCHHHHHHHHHHHH---------CCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCE T ss_conf 55871899999999985---------899889967986045199999999999999985497899994888999974566 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +.-+-+|+|. T Consensus 224 --v~VMYaG~iV 233 (316) T COG0444 224 --VAVMYAGRIV 233 (316) T ss_pred --EEEEECCEEE T ss_conf --8998775899 No 400 >PRK13633 cobalt transporter ATP-binding subunit; Provisional Probab=97.11 E-value=0.0013 Score=42.85 Aligned_cols=31 Identities=23% Similarity=0.462 Sum_probs=25.9 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.+++..+| +..|+|+|||||||++-.|. T Consensus 27 l~~Isl~i~~GE~v~iiG~nGsGKSTL~r~l~ 58 (281) T PRK13633 27 LDDVNLEVKKGEFLVILGHNGSGKSTIAKHMN 58 (281) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 73407688799899999999984999999997 No 401 >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.11 E-value=0.0004 Score=46.10 Aligned_cols=33 Identities=18% Similarity=0.303 Sum_probs=26.2 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 545536732798-799986899864448999999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .+++.+++..+| +..|+|+|||||||++-.|.= T Consensus 19 aL~~vsl~i~~GE~vaivG~nGsGKSTL~~~l~G 52 (276) T PRK13650 19 TLDDVSFHVKQGEWLSIIGHNGSGKSTTVRLIDG 52 (276) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 8787587998998999999999879999999973 No 402 >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.11 E-value=0.0004 Score=46.13 Aligned_cols=33 Identities=18% Similarity=0.383 Sum_probs=26.0 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 45536732798-7999868998644489999997 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) .++.++++.+| +..|+|+|||||||++-+|.=+ T Consensus 10 L~~Vsl~i~~Ge~vaiiG~sGsGKSTLl~~l~GL 43 (276) T PRK13634 10 LYDVNVSIPSGSYVAIIGHTGSGKSTLLQHLNGL 43 (276) T ss_pred EECCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 5144779989989999999996999999999749 No 403 >KOG0057 consensus Probab=97.11 E-value=0.004 Score=39.58 Aligned_cols=77 Identities=25% Similarity=0.383 Sum_probs=58.6 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) ..+|-||+-.++++- ...+..||+++||+.|+||..--+.+++.+.+. +.-+++-.|+.+.+..+. T Consensus 486 ~~LSGGekQrvslaR---------a~lKda~Il~~DEaTS~LD~~TE~~i~~~i~~~~~~rTvI~IvH~l~ll~~~D--- 553 (591) T KOG0057 486 LMLSGGEKQRVSLAR---------AFLKDAPILLLDEATSALDSETEREILDMIMDVMSGRTVIMIVHRLDLLKDFD--- 553 (591) T ss_pred CCCCCCHHHHHHHHH---------HHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHCCC--- T ss_conf 425640678999999---------98458986886376532365669999999987517976999996303475088--- Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) +++-+++|++- T Consensus 554 kI~~l~nG~v~ 564 (591) T KOG0057 554 KIIVLDNGTVK 564 (591) T ss_pred EEEEEECCEEE T ss_conf 89999788167 No 404 >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=97.11 E-value=0.00076 Score=44.31 Aligned_cols=36 Identities=22% Similarity=0.473 Sum_probs=26.1 Q ss_pred CCCHH-HEEEECCCCEEEEECCCCCCHHHHHHHHHHH Q ss_conf 32545-5367327987999868998644489999997 Q gi|254780766|r 15 FRNYA-SLRLVFDAQHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~-~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l 50 (375) |.+|. +.+++....+..|+|++||||||+|-.|.-+ T Consensus 10 ~g~f~l~i~f~i~ge~~~iiGpSGsGKSTll~~i~GL 46 (214) T cd03297 10 LPDFTLKIDFDLNEEVTGIFGASGAGKSTLLRCIAGL 46 (214) T ss_pred ECCEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 8999999998629979999999973599999999849 No 405 >KOG0061 consensus Probab=97.09 E-value=0.0005 Score=45.50 Aligned_cols=57 Identities=23% Similarity=0.279 Sum_probs=42.9 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCH Q ss_conf 2205899999999999999999870899789980122015989999999997417--98099980696 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDK 352 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~ 352 (375) .|.||.|.+.+++-|. ..+|||++|||.++||......+++.|.+. +.-++|+|+|. T Consensus 171 iSGGErkRvsia~Ell---------~~P~iLflDEPTSGLDS~sA~~vv~~Lk~lA~~grtVi~tIHQ 229 (613) T KOG0061 171 LSGGERKRVSIALELL---------TDPSILFLDEPTSGLDSFSALQVVQLLKRLARSGRTVICTIHQ 229 (613) T ss_pred CCCHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEC T ss_conf 4601255666788884---------3981799708988855576899999999998679989999768 No 406 >COG4717 Uncharacterized conserved protein [Function unknown] Probab=97.09 E-value=0.0037 Score=39.84 Aligned_cols=91 Identities=18% Similarity=0.303 Sum_probs=62.6 Q ss_pred EECCCCCC--EEEECCCCCC-CHHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCC-EEEEECCHHCCCHHHHHHHHHHH Q ss_conf 00257320--0110012455-10233122058999999999999999998708997-89980122015989999999997 Q gi|254780766|r 263 RTLIGPHR--SDLIVDYCDK-AITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAP-ILLLDEISAHLDEDKRNALFRIV 338 (375) Q Consensus 263 ~t~~Gphr--~d~~~~~~~~-~~~~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~p-ilLiDdi~s~LD~~~~~~ll~~l 338 (375) ||.+--+- |.|.+...++ ..-..=+|+|-.--+++|+++|-...+ . ...| =+++||++-|+|+.|-.+++++| T Consensus 875 Yt~Iy~~e~~d~I~V~~~~G~~~~~~ELSqgT~EQLYlAlRfali~~~-~--~~~~LP~i~DD~fVhFD~~R~~r~~e~l 951 (984) T COG4717 875 YTGIYTQEDKDSIIVEHRAGGSKLAEELSQGTKEQLYLALRFALIHEV-R--TREPLPFIADDIFVHFDDERAKRMLELL 951 (984) T ss_pred EEEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH-C--CCCCCCEEECCCHHCCCHHHHHHHHHHH T ss_conf 236653567760588723655235898836579999999999888631-3--5788875632300005888999999999 Q ss_pred HHC--CCCEEEEECCHHHHH Q ss_conf 417--980999806967854 Q gi|254780766|r 339 TDI--GSQIFMTGTDKSVFD 356 (375) Q Consensus 339 ~~~--~~Qv~iTt~~~~~~~ 356 (375) .++ +.|||+=|.+++.-+ T Consensus 952 ~dls~~~QviYFTCHe~~~d 971 (984) T COG4717 952 ADLSEGNQVIYFTCHEHTCD 971 (984) T ss_pred HHHCCCCEEEEEEECHHHHC T ss_conf 97355780799970366541 No 407 >KOG0962 consensus Probab=97.07 E-value=0.0023 Score=41.11 Aligned_cols=82 Identities=22% Similarity=0.325 Sum_probs=65.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH--------CCCCEEEEECCHHHHH Q ss_conf 31220589999999999999999987089978998012201598999999999741--------7980999806967854 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD--------IGSQIFMTGTDKSVFD 356 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~--------~~~Qv~iTt~~~~~~~ 356 (375) -.||-||+=++.+.++||-++-+... ..||-+|||.-.||..++..+...|.. .+.|.+|-|||..... T Consensus 1182 GRcSAGQKvLAsliIRLALAEtf~sn---CgvLALDEPTTNLD~~niesLa~~L~~II~~rr~q~nfqLiVITHDE~fv~ 1258 (1294) T KOG0962 1182 GRCSAGQKVLASLIIRLALAETFGSN---CGVLALDEPTTNLDRENIESLAKALSRIIEERRRQRNFQLIVITHDEDFVQ 1258 (1294) T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHC---CCCHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHH T ss_conf 67511379999999999999987622---442101687654576678999999999999986155731355421889999 Q ss_pred HHHCC---EEEEEECC Q ss_conf 32126---00799728 Q gi|254780766|r 357 SLNET---AKFMRISN 369 (375) Q Consensus 357 ~~~~~---~~~~~i~~ 369 (375) .+.-. ..||+|.- T Consensus 1259 ~i~~~~~~e~~yr~~k 1274 (1294) T KOG0962 1259 LLGRSAYPEYFYRVKK 1274 (1294) T ss_pred HHHHCCCCHHEEEECC T ss_conf 8612225031232014 No 408 >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter; InterPro: IPR005898 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. This model describes a family of cyclic peptide transporters in bacteria. Syringomycin is an amphipathic, cyclic lipodepsipeptide when inserted into host causes formation of channels, permeable to a variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.; GO: 0005524 ATP binding, 0015197 peptide transporter activity, 0015833 peptide transport, 0016021 integral to membrane. Probab=97.07 E-value=0.00044 Score=45.87 Aligned_cols=84 Identities=21% Similarity=0.337 Sum_probs=60.5 Q ss_pred CCCCHH-HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHH-H---CCCCEEEEECCH Q ss_conf 455102-33122058999999999999999998708997899801220159899999999974-1---798099980696 Q gi|254780766|r 278 CDKAIT-IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-D---IGSQIFMTGTDK 352 (375) Q Consensus 278 ~~~~~~-~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~-~---~~~Qv~iTt~~~ 352 (375) .|.+-+ .+-+|.||||-++| .-|.+ -+.||+++||=.|-=||..++-+-+.|. + .+.-++|-|||. T Consensus 461 ~~~~yStTT~LS~GQ~KRLAL--~~AyL-------E~RP~~~lDEWAADQDP~F~R~FY~ELLPDLKR~GKTI~~I~HDD 531 (555) T TIGR01194 461 EDLNYSTTTDLSYGQRKRLAL--VNAYL-------EDRPVLLLDEWAADQDPAFKRVFYEELLPDLKRRGKTILVISHDD 531 (555) T ss_pred ECCCCCHHHHCCCCHHHHHHH--HHHHH-------HCCCEEEEECCCCCCCCCCCCCCHHHCCHHHHHCCCEEEEEECCC T ss_conf 047633021011213688999--98776-------348724653210268786332105323711300787799980272 Q ss_pred HHHHHHHCCEEEEEECCCEEE Q ss_conf 785432126007997289689 Q gi|254780766|r 353 SVFDSLNETAKFMRISNHQAL 373 (375) Q Consensus 353 ~~~~~~~~~~~~~~i~~g~~~ 373 (375) ..|+-- |. ++++.+|.|. T Consensus 532 ~YF~lA-D~--~I~L~~G~~V 549 (555) T TIGR01194 532 RYFELA-DR--LIKLADGKVV 549 (555) T ss_pred HHHHHH-HH--HHHHHCCCEE T ss_conf 478999-99--9987379663 No 409 >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Probab=97.07 E-value=0.0011 Score=43.14 Aligned_cols=50 Identities=24% Similarity=0.359 Sum_probs=35.0 Q ss_pred CCCCEEEEEEEEEC------CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 98851899999922------32545536732798-7999868998644489999997 Q gi|254780766|r 1 MTNRIKIKFLNISE------FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 1 ~~~~M~i~~l~i~n------FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) |++=..++.++-.= +.-+++.++++.+| +..|+|+|||||||++-.|.-+ T Consensus 1 m~~~iel~~v~k~y~~g~~~~~~L~~vsl~i~~Ge~v~i~G~nGsGKSTll~~l~gl 57 (648) T PRK10535 1 MTALLELKDIRRSYPSGEEQVEVLKDISLTIYAGEMVAIVGASGSGKSTLMNILGCL 57 (648) T ss_pred CCCEEEEECEEEEECCCCEEEEEEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 972499987199977978359985266999989989999999996299999999569 No 410 >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Probab=97.07 E-value=0.00057 Score=45.10 Aligned_cols=36 Identities=28% Similarity=0.436 Sum_probs=29.0 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 32545536732798-7999868998644489999997 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) ...|.++.+.|.+| ..+|.|+||+||||+|-.|.=+ T Consensus 15 ~~lf~~L~f~l~~Ge~~~i~G~NG~GKTtLLRilaGL 51 (209) T COG4133 15 RTLFSDLSFTLNAGEALQITGPNGAGKTTLLRILAGL 51 (209) T ss_pred CEEECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 3021230478748877999899987588999999712 No 411 >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.06 E-value=0.00049 Score=45.58 Aligned_cols=32 Identities=13% Similarity=0.470 Sum_probs=25.7 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -.++.+++..+| +..|+|+|||||||++-+|. T Consensus 22 aL~~isl~i~~GE~v~iiG~nGsGKSTLl~~l~ 54 (287) T PRK13637 22 ALDNVNIEIEDGEFVALIGHTGSGKSTLIQHLN 54 (287) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 753207698799899999999939999999997 No 412 >cd03290 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=97.06 E-value=0.00057 Score=45.12 Aligned_cols=31 Identities=32% Similarity=0.532 Sum_probs=24.6 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+ .+.+|+|+|||||||+|-+|. T Consensus 17 L~~inl~i~~Ge~~~IvG~sGsGKSTLl~~l~ 48 (218) T cd03290 17 LSNINIRIPTGQLTMIVGQVGCGKSSLLLAIL 48 (218) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 64769998699999999999980999999985 No 413 >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes. Probab=97.05 E-value=0.00055 Score=45.22 Aligned_cols=31 Identities=19% Similarity=0.448 Sum_probs=26.3 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+| ..+|+|+|||||||++-.|. T Consensus 30 L~~is~~i~~Ge~vaIvG~sGsGKSTL~~ll~ 61 (226) T cd03248 30 LQDVSFTLHPGEVTALVGPSGSGKSTVVALLE 61 (226) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 74538998299999999999984999999996 No 414 >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.04 E-value=0.00053 Score=45.31 Aligned_cols=32 Identities=16% Similarity=0.495 Sum_probs=24.7 Q ss_pred CHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 54553673279-879998689986444899999 Q gi|254780766|r 17 NYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) -.++.++++.+ .+..|+|+|||||||++.+|. T Consensus 41 AL~~Is~~i~~Ge~vaIIG~nGsGKSTL~~~l~ 73 (320) T PRK13631 41 ALNNISYTFEKNKIYFIIGNSGSGKSTLVTHFN 73 (320) T ss_pred EEECCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 861645588599899999499984999999997 No 415 >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=97.04 E-value=0.00054 Score=45.27 Aligned_cols=32 Identities=19% Similarity=0.481 Sum_probs=24.8 Q ss_pred CHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 54553673279-879998689986444899999 Q gi|254780766|r 17 NYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) -.++.+++..+ .+..|+|+|||||||++..|. T Consensus 19 aL~~is~~i~~Ge~~aliG~NGaGKSTLl~~i~ 51 (277) T PRK13652 19 ALNNINFIAGRKQRIAVIGPNGAGKSTLFKHFN 51 (277) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 986728799899899999999947999999996 No 416 >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Probab=97.03 E-value=0.0046 Score=39.23 Aligned_cols=77 Identities=22% Similarity=0.268 Sum_probs=57.0 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCHHHHHHHHCCE Q ss_conf 220589999999999999999987089978998012201598999999999741----7980999806967854321260 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~~~~~~~~~~~ 362 (375) +|-||+--.++.--| ...+-+||||||.|-||..+..-++.||+. .+.-+.+-+|+.+-.--+.+. T Consensus 129 LSGGEkQRVAIGRAL---------Lt~P~LLLmDEPLaSLD~~RK~EilpylERL~~e~~IPIlYVSHS~~Ev~RLAd~- 198 (352) T COG4148 129 LSGGEKQRVAIGRAL---------LTAPELLLMDEPLASLDLPRKREILPYLERLRDEINIPILYVSHSLDEVLRLADR- 198 (352) T ss_pred CCCCHHHHHHHHHHH---------HCCCCEEEECCCHHHCCCCHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHE- T ss_conf 676155677788887---------5497734306840323651046778999998762188789993689999965423- Q ss_pred EEEEECCCEEEE Q ss_conf 079972896895 Q gi|254780766|r 363 KFMRISNHQALC 374 (375) Q Consensus 363 ~~~~i~~g~~~~ 374 (375) ++-+++|++-+ T Consensus 199 -vV~le~GkV~A 209 (352) T COG4148 199 -VVVLENGKVKA 209 (352) T ss_pred -EEEECCCEEEE T ss_conf -89820884885 No 417 >TIGR02868 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC; InterPro: IPR014223 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents CydC, a member of a heterodimeric ATP-binding cassette-type transporter (ABC transporter). It is involved in the export of glutathione from the cytoplasm to the periplasm and is required for the assembly of both cytochrome c and cytochrome bd , , .; GO: 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane. Probab=97.02 E-value=0.0026 Score=40.79 Aligned_cols=48 Identities=35% Similarity=0.433 Sum_probs=41.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHH-HC Q ss_conf 3122058999999999999999998708997899801220159899999999974-17 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DI 341 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~-~~ 341 (375) ..+|-||.+-+.|+=.|- ...||+|+|||-.|||+.--..+++.|- +. T Consensus 500 ~~lSGGeRqRLALARaLl---------~~ap~llLDEPTehLDa~t~~~ll~dL~t~a 548 (566) T TIGR02868 500 ARLSGGERQRLALARALL---------ADAPILLLDEPTEHLDAETADELLEDLLTAA 548 (566) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHCCC T ss_conf 301048999999999973---------7998898608866678767999999985055 No 418 >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Probab=97.02 E-value=0.0075 Score=37.81 Aligned_cols=80 Identities=16% Similarity=0.163 Sum_probs=59.2 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) +...|.|-+--+++++-.+ -.+-||||||+.|--|+..+++..+.+.+. +.-+++-+|+...+..+.+ T Consensus 145 vktYSSGM~aRLaFsia~~---------~~pdILllDEvlavGD~~F~~K~~~rl~e~~~~~~tiv~VSHd~~~I~~~Cd 215 (249) T COG1134 145 VKTYSSGMYARLAFSVATH---------VEPDILLLDEVLAVGDAAFQEKCLERLNELVEKNKTIVLVSHDLGAIKQYCD 215 (249) T ss_pred HHHCCHHHHHHHHHHHHHH---------CCCCEEEEEHHHHCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 4112588999988875331---------3787899861344077999999999999999759879999788799998567 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ..++++|++.. T Consensus 216 ~--~i~l~~G~i~~ 227 (249) T COG1134 216 R--AIWLEHGQIRM 227 (249) T ss_pred E--EEEEECCEEEE T ss_conf 0--59985877997 No 419 >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Probab=97.02 E-value=0.0011 Score=43.34 Aligned_cols=37 Identities=22% Similarity=0.410 Sum_probs=27.3 Q ss_pred CCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 23254553673279-87999868998644489999997 Q gi|254780766|r 14 EFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 14 nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) +..-+++.++++.+ .++.|+|+|||||||++-.|.-+ T Consensus 12 ~~~~L~~isl~i~~Ge~~~iiG~SGsGKSTll~~i~gL 49 (227) T cd03260 12 DKHALKDISLDIPKGEITALIGPSGCGKSTLLRLLNRL 49 (227) T ss_pred CEEEEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHH T ss_conf 99888340678879989999999998199999999744 No 420 >TIGR00606 rad50 rad50; InterPro: IPR004584 Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining. It is a component of an exonuclease complex with MRE11 homologs. The Saccharomyces cerevisiae Rad50/MRE11 complex possesses single-stranded endonuclease activity and ATP-dependent double-strand-specific exonuclease activity. Rad50 provides an ATP-dependent control of MRE11 by unwinding and repositioning DNA ends into the MRE11 active site. This family is distantly related to the SbcC family of bacterial proteins. When the N- and C-terminal globular regions of Rad50 from Pyrococcus furiosus P58301 from SWISSPROT are co-expressed in Escherichia coli, they spontaneously associate to form a stable complex that possesses ATP-binding and weak ATP-hydrolysing activities. The structure formed is known as the Rad50 catalytic domain (Rad50cd1). In the presence of ATP, two Rad50cd1 molecules interact via their ATP-binding and highly conserved 'signature' motifs to form a dimer. As ATP is buried deep within this dimer interface, the two Rad50cd1 molecules may have to completely disengage after ATP hydrolysis to allow the release of ADP before binding of a new ATP molecule. ATP binding is also accompanied by a 30° rotation of two distinct domains within each Rad50cd1 part of the dimer. This rotation and dimerisation creates a positively charged surface which, potentially, could provide a DNA-binding site capable of accommodating two DNA molecules. The Mre11-docking site within Rad50 has been mapped to two 40-residue heptad-repeat sequences that lie adjacent to the N- and C-terminal ATPase segments. A distinct region within this domain forms a conserved hydrophobic patch that is believed to be the actual Mre11-binding site and lies immediately adjacent to the putative DNA-binding site of Rad50. As Rad50 dimerises in the presence of ATP and forms a stoichiometric complex with Mre11 (one Mre11 subunit binding to one Rad50 subunit), it is possible that the MR complex forms a closely coordinated DNA-binding unit that has the potential to act on two DNA molecules simultaneously. Within this unit, ATP-dependent control of nuclease action might be achieved via Rad50 unwinding or repositioning DNA ends into the active-site of Mre11 . ; GO: 0005524 ATP binding, 0006281 DNA repair, 0030870 Mre11 complex. Probab=97.01 E-value=0.0029 Score=40.51 Aligned_cols=83 Identities=25% Similarity=0.356 Sum_probs=66.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----------------CCCEEEE Q ss_conf 312205899999999999999999870899789980122015989999999997417----------------9809998 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----------------GSQIFMT 348 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----------------~~Qv~iT 348 (375) .-||-||+-+..|.++||-|+.+. +...|+-||||...||..+.+.+...|.+. +.|.+|- T Consensus 1207 GRCSAGQK~LASL~IRlALAE~F~---~~C~~iALDEPTTNLD~~~~E~lA~~L~~II~~R~GfdenGkl~~R~~Ql~VI 1283 (1328) T TIGR00606 1207 GRCSAGQKVLASLLIRLALAEVFC---LNCGIIALDEPTTNLDREKVESLAIVLVEIIKERSGFDENGKLRQRDFQLLVI 1283 (1328) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHC---CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEE T ss_conf 665545799999999999987640---24442440588765664468899999999985305755366512562158887 Q ss_pred ECCHHHHHHHH--C-CEEEEEECCC Q ss_conf 06967854321--2-6007997289 Q gi|254780766|r 349 GTDKSVFDSLN--E-TAKFMRISNH 370 (375) Q Consensus 349 t~~~~~~~~~~--~-~~~~~~i~~g 370 (375) |||.++..-+. . --+||.|... T Consensus 1284 THDE~~V~~l~~S~~~E~~Y~~~K~ 1308 (1328) T TIGR00606 1284 THDEDLVELLGRSEYVEKIYRLKKD 1308 (1328) T ss_pred ECCHHHHHHHHHCCCCCEEEEECCC T ss_conf 3557899862100242201454157 No 421 >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Probab=97.00 E-value=0.003 Score=40.45 Aligned_cols=76 Identities=20% Similarity=0.292 Sum_probs=52.1 Q ss_pred HHCCCH-HHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHC Q ss_conf 312205-89999999999999999987089978998012201598999999999741---79809998069678543212 Q gi|254780766|r 285 AHGSTG-EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 285 ~~~S~G-qqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~ 360 (375) .-+|-| |||+=.++-.+ + .+-++++|||||.|||.+.+.+=+.+.+ -+.-|++++|.-...+.+.+ T Consensus 129 k~LSKGnqQKIQfisavi------H----ePeLlILDEPFSGLDPVN~elLk~~I~~lk~~GatIifSsH~Me~vEeLCD 198 (300) T COG4152 129 KELSKGNQQKIQFISAVI------H----EPELLILDEPFSGLDPVNVELLKDAIFELKEEGATIIFSSHRMEHVEELCD 198 (300) T ss_pred HHHHHHHHHHHHHHHHHH------C----CCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH T ss_conf 775301167899999985------2----887799668866887232999999999987358779985333788999866 Q ss_pred CEEEEEECCCEE Q ss_conf 600799728968 Q gi|254780766|r 361 TAKFMRISNHQA 372 (375) Q Consensus 361 ~~~~~~i~~g~~ 372 (375) + +.-+..|+. T Consensus 199 ~--llmL~kG~~ 208 (300) T COG4152 199 R--LLMLKKGQT 208 (300) T ss_pred H--HHEECCCCE T ss_conf 6--423008945 No 422 >PTZ00243 ABC transporter; Provisional Probab=96.98 E-value=0.013 Score=36.29 Aligned_cols=30 Identities=20% Similarity=0.499 Sum_probs=24.1 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHH Q ss_conf 4553673279-87999868998644489999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAI 47 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI 47 (375) +++.++.+.+ .+++|+|+-|||||++|.|| T Consensus 676 L~dinl~v~~G~L~~IvG~vGSGKSSLL~ai 706 (1560) T PTZ00243 676 LRDVSVSVPRGKLTVVLGATGSGKSTLLQSL 706 (1560) T ss_pred CCCEEEEECCCCEEEEECCCCCCHHHHHHHH T ss_conf 0130588659978999899998799999999 No 423 >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Probab=96.98 E-value=0.00076 Score=44.30 Aligned_cols=32 Identities=19% Similarity=0.382 Sum_probs=24.8 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHH Q ss_conf 4553673279-8799986899864448999999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~ 49 (375) +++.++++.+ .+..|+|+|||||||++.+|.= T Consensus 25 l~~vs~~i~~GE~v~iiG~sGsGKSTLl~~i~G 57 (233) T PRK11629 25 LHNVSFSIGEGEMMAIVGSSGSGKSTLLHLLGG 57 (233) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHHC T ss_conf 846289988998999999999409999999966 No 424 >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=96.96 E-value=0.00078 Score=44.22 Aligned_cols=31 Identities=26% Similarity=0.407 Sum_probs=25.1 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+.+.+| ...|+|+|||||||++..|. T Consensus 53 Lk~Isf~I~~Ge~vaIVG~sGSGKSTLl~lL~ 84 (282) T cd03291 53 LKNINLKIEKGEMLAITGSTGSGKTSLLMLIL 84 (282) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 41648998499999999999981999999995 No 425 >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK. ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed. Probab=96.96 E-value=0.00094 Score=43.69 Aligned_cols=34 Identities=26% Similarity=0.398 Sum_probs=26.6 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 2545536732798-799986899864448999999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) .-+++.+++..+| +.+|+|++||||||+|-+|.= T Consensus 14 ~~l~~isl~v~~Ge~~~i~GpSG~GKSTlLr~iaG 48 (213) T cd03301 14 TALDDLNLDIADGEFVVLLGPSGCGKTTTLRMIAG 48 (213) T ss_pred EEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 99876177986998999999998809999999976 No 426 >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Probab=96.96 E-value=0.0088 Score=37.37 Aligned_cols=77 Identities=19% Similarity=0.333 Sum_probs=66.5 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) .+|.||+--+++|+-|| ..+.+|+.|||..-||.+-|..+++.|.+. +.=++++|||..+...+.+. T Consensus 154 eLSGG~rQRv~iAmALa---------~~P~LLIaDEPTTaLDvt~q~qIL~llk~l~~e~g~a~l~ITHDl~Vva~~aDr 224 (539) T COG1123 154 QLSGGMRQRVMIAMALA---------LKPKLLIADEPTTALDVTTQAQILDLLKDLQRELGMAVLFITHDLGVVAELADR 224 (539) T ss_pred CCCCHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHCCE T ss_conf 26704999999999983---------799989977985410899999999999999997094899986899999975376 Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) +..+.+|++. T Consensus 225 --v~Vm~~G~iV 234 (539) T COG1123 225 --VVVMYKGEIV 234 (539) T ss_pred --EEEEECCEEE T ss_conf --9999887888 No 427 >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Probab=96.93 E-value=0.00091 Score=43.81 Aligned_cols=78 Identities=18% Similarity=0.245 Sum_probs=55.3 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCC---EEEEECCHHHHH--HHH Q ss_conf 312205899999999999999999870899789980122015989999999997417980---999806967854--321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQ---IFMTGTDKSVFD--SLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Q---v~iTt~~~~~~~--~~~ 359 (375) ..+|-|||-+++++--|- ..+-+||+|||...|-|.-...+++.+.+++.+ .++= ++.+.-. .+. T Consensus 135 G~LSGGEQQMLAiaRALm---------~~PklLLLDEPs~GLaP~iv~~I~~~i~~l~~~~g~tIlL-VEQn~~~Al~ia 204 (237) T COG0410 135 GTLSGGEQQMLAIARALM---------SRPKLLLLDEPSEGLAPKIVEEIFEAIKELRKEGGMTILL-VEQNARFALEIA 204 (237) T ss_pred CCCCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE-EECCHHHHHHHH T ss_conf 677819999999999996---------1998899658866768899999999999999748948999-942588998740 Q ss_pred CCEEEEEECCCEEEE Q ss_conf 260079972896895 Q gi|254780766|r 360 ETAKFMRISNHQALC 374 (375) Q Consensus 360 ~~~~~~~i~~g~~~~ 374 (375) +. .|-+++|+|.. T Consensus 205 Dr--~yvle~Griv~ 217 (237) T COG0410 205 DR--GYVLENGRIVL 217 (237) T ss_pred CE--EEEEECCEEEE T ss_conf 87--99986798987 No 428 >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Probab=96.93 E-value=0.0021 Score=41.40 Aligned_cols=48 Identities=23% Similarity=0.401 Sum_probs=31.4 Q ss_pred CCCCEEEEEEEEE--CCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 9885189999992--23254553673279-879998689986444899999 Q gi|254780766|r 1 MTNRIKIKFLNIS--EFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 1 ~~~~M~i~~l~i~--nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) |+|=..++.|+-. +..-+++.+++..+ .+..|+|+|||||||+|-.|. T Consensus 14 ~tP~i~l~~lsk~yg~~~aL~~vsl~I~~GE~~~llGpSGsGKSTLlr~ia 64 (378) T PRK09452 14 LSPLIELRGISKSFDGKEVISNLDLTINNGEFLTLLGPSGCGKTTVLRLIA 64 (378) T ss_pred CCCEEEEEEEEEEECCEEEEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 898799995999999999993627799999899999899976999999997 No 429 >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Probab=96.92 E-value=0.0092 Score=37.24 Aligned_cols=77 Identities=19% Similarity=0.287 Sum_probs=60.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCEE Q ss_conf 2205899999999999999999870899789980122015989999999997417---9809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) +|+|++.-+.+|--|- ..+.|+++|||.+.||-..++.+.+++... +--|++++|.-.-.+.+.+. T Consensus 134 ~S~G~kqkV~iARAlv---------h~P~i~vlDEP~sGLDi~~~r~~~dfi~q~k~egr~viFSSH~m~EvealCDr-- 202 (245) T COG4555 134 FSTGMKQKVAIARALV---------HDPSILVLDEPTSGLDIRTRRKFHDFIKQLKNEGRAVIFSSHIMQEVEALCDR-- 202 (245) T ss_pred HCHHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHE-- T ss_conf 1400578899999984---------39876997689877427879999999998525794899961317999986135-- Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) ++-+.+|++.. T Consensus 203 vivlh~Gevv~ 213 (245) T COG4555 203 VIVLHKGEVVL 213 (245) T ss_pred EEEEECCCEEE T ss_conf 89974680897 No 430 >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor. The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=96.91 E-value=0.00067 Score=44.67 Aligned_cols=21 Identities=38% Similarity=0.619 Sum_probs=19.2 Q ss_pred CEEEEECCCCCCHHHHHHHHH Q ss_conf 879998689986444899999 Q gi|254780766|r 28 QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 28 ~~n~i~G~NG~GKT~iLEAI~ 48 (375) .+..|+|+|||||||++-.|. T Consensus 27 Ei~gLiGpNGaGKSTLlk~i~ 47 (255) T cd03236 27 QVLGLVGPNGIGKSTALKILA 47 (255) T ss_pred EEEEEECCCCCCHHHHHHHHH T ss_conf 099998999970999999996 No 431 >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=96.90 E-value=0.00087 Score=43.93 Aligned_cols=32 Identities=25% Similarity=0.440 Sum_probs=25.1 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .+++.++++.+| +..|+|+|||||||++-.+. T Consensus 23 aL~~vsl~I~~Ge~vaiiG~nGsGKSTL~~~l~ 55 (283) T PRK13640 23 ALKDVSFSIPRGSWTALIGHNGSGKSTISKLIN 55 (283) T ss_pred EEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 787718699899999999999987999999996 No 432 >COG5293 Predicted ATPase [General function prediction only] Probab=96.89 E-value=0.00099 Score=43.54 Aligned_cols=44 Identities=23% Similarity=0.424 Sum_probs=34.2 Q ss_pred EEECCCCH-HH--EEEECCCCEEEEECC-----------CCCCHHHHHHHHHHHCCCC Q ss_conf 99223254-55--367327987999868-----------9986444899999972886 Q gi|254780766|r 11 NISEFRNY-AS--LRLVFDAQHTIFVGD-----------NGVGKTNILEAISFLSPGR 54 (375) Q Consensus 11 ~i~nFR~~-~~--~~i~f~~~~n~i~G~-----------NG~GKT~iLEAI~~l~~gk 54 (375) +..-|+|= .+ ..+.|.||+|++.|+ ||.||||++|.|+||..++ T Consensus 6 ~~~~~~cN~q~vfk~vkFnpGlNIVlae~red~~~~~~tnglGKSTlie~i~Fclg~t 63 (591) T COG5293 6 KLSKLYCNHQQVFKPVKFNPGLNIVLAEIREDENRKKDTNGLGKSTLIELIDFCLGST 63 (591) T ss_pred EEHHEEECCCCCCCEEEECCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCC T ss_conf 3102142560003504207983488521137655432246854666999999984450 No 433 >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane. Probab=96.88 E-value=0.001 Score=43.53 Aligned_cols=31 Identities=23% Similarity=0.507 Sum_probs=25.6 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+ ...+|+|+|||||||++-+|. T Consensus 20 L~~isl~i~~G~~v~ivG~sGsGKSTLl~ll~ 51 (220) T cd03245 20 LDNVSLTIRAGEKVAIIGRVGSGKSTLLKLLA 51 (220) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 53459998799999999999985999999996 No 434 >TIGR01188 drrA daunorubicin resistance ABC transporter, ATP-binding protein; InterPro: IPR005894 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family contains the daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. In other words it functions as an ATP dependent antiporter. . Probab=96.88 E-value=0.00056 Score=45.18 Aligned_cols=38 Identities=24% Similarity=0.418 Sum_probs=27.7 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHHC Q ss_conf 232545536732798-79998689986444899999972 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFLS 51 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l~ 51 (375) +|+-.+++++.-..| +=.|.|||||||||.+.=+.-+. T Consensus 7 ~f~AVdgv~f~V~~G~vfGfLGPNGAGKTTti~mLtTll 45 (343) T TIGR01188 7 DFKAVDGVNFKVREGEVFGFLGPNGAGKTTTIRMLTTLL 45 (343) T ss_pred CEEEECCCCCEECCCEEEEEECCCCCCHHHHHHHHCCCC T ss_conf 635612542053062489976879985133563410255 No 435 >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos). The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter. Probab=96.86 E-value=0.00088 Score=43.87 Aligned_cols=31 Identities=23% Similarity=0.217 Sum_probs=24.5 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) .++.+++..+| +..|+|+|||||||++.+|. T Consensus 16 L~~vsl~v~~GEi~~liG~nGaGKSTll~~l~ 47 (182) T cd03215 16 VRDVSFEVRAGEIVGIAGLVGNGQTELAEALF 47 (182) T ss_pred EECEEEEECCCCEEEEECCCCCCCCHHHHHHC T ss_conf 62317898599699998889999263778766 No 436 >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Probab=96.85 E-value=0.00099 Score=43.55 Aligned_cols=33 Identities=24% Similarity=0.491 Sum_probs=25.1 Q ss_pred CCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 254553673279-879998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +.+.+.+++..+ .+..|+|+|||||||++-.|. T Consensus 20 ~aL~dIsl~I~~Ge~vaiiG~nGsGKSTLl~~l~ 53 (288) T PRK13643 20 RALFDIDLEVKKGSYTALIGHTGSGKSTLLQHLN 53 (288) T ss_pred EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 3366336798599899999999947999999997 No 437 >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF. Probab=96.85 E-value=0.0011 Score=43.31 Aligned_cols=33 Identities=21% Similarity=0.338 Sum_probs=25.2 Q ss_pred CHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHH Q ss_conf 54553673279-8799986899864448999999 Q gi|254780766|r 17 NYASLRLVFDA-QHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 17 ~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~ 49 (375) -+++.+++..+ .+..|+|+|||||||++-+|.= T Consensus 20 ~L~dIsl~i~~Ge~~~iiG~sGsGKSTLl~~i~G 53 (228) T cd03257 20 ALDDVSFSIKKGETLGLVGESGSGKSTLARAILG 53 (228) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 9856078986998999999999869999999972 No 438 >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2. Probab=96.83 E-value=0.001 Score=43.46 Aligned_cols=31 Identities=19% Similarity=0.407 Sum_probs=25.1 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++.+.+| ...|+|+|||||||++-+|. T Consensus 20 L~~isf~I~~Ge~vaIvG~sGsGKSTLl~lL~ 51 (275) T cd03289 20 LENISFSISPGQRVGLLGRTGSGKSTLLSAFL 51 (275) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 42507998799999999999997999999996 No 439 >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.82 E-value=0.0011 Score=43.31 Aligned_cols=31 Identities=26% Similarity=0.442 Sum_probs=24.3 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+.+.+| ..+|+|+|||||||++..|. T Consensus 17 L~~isl~i~~Ge~v~ivG~sGsGKSTLl~ll~ 48 (236) T cd03253 17 LKDVSFTIPAGKKVAIVGPSGSGKSTILRLLF 48 (236) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHC T ss_conf 30568998699999999999998999999974 No 440 >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.80 E-value=0.0013 Score=42.89 Aligned_cols=31 Identities=19% Similarity=0.470 Sum_probs=24.4 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+ ...+|+|+|||||||++..|. T Consensus 19 L~~inl~i~~Ge~vaivG~sGsGKSTLl~ll~ 50 (229) T cd03254 19 LKDINFSIKPGETVAIVGPTGAGKTTLINLLM 50 (229) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 74629998799999999999980999999996 No 441 >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Probab=96.79 E-value=0.0026 Score=40.78 Aligned_cols=32 Identities=25% Similarity=0.462 Sum_probs=25.7 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 545536732798-79998689986444899999 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) -+++.+++..+| +.+|+|++||||||+|-+|. T Consensus 21 al~~vsl~i~~Ge~~~llGpSG~GKTTlLr~ia 53 (351) T PRK11432 21 VIDNLDLTIKQGTMVTLLGPSGCGKTTVLRLVA 53 (351) T ss_pred EECCCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 984457498899899999999649999999997 No 442 >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Probab=96.79 E-value=0.0012 Score=43.05 Aligned_cols=32 Identities=22% Similarity=0.473 Sum_probs=24.8 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 45536732798-799986899864448999999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) +++.++++.+| +..|+|+|||||||++-.|.= T Consensus 26 L~~isl~i~~GE~v~ivG~sGsGKSTLl~~i~G 58 (228) T PRK10584 26 LTGVELVVKRGETIALIGESGSGKSTLLAILAG 58 (228) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 847388999998999999998589999999966 No 443 >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Probab=96.78 E-value=0.0013 Score=42.81 Aligned_cols=32 Identities=28% Similarity=0.527 Sum_probs=24.9 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHH Q ss_conf 4553673279-8799986899864448999999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~ 49 (375) .++.+++..+ .+.+|+|+|||||||+|-.|.= T Consensus 19 l~~vsl~i~~Ge~~~llGpsG~GKSTllr~i~G 51 (369) T PRK11000 19 SKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG 51 (369) T ss_pred ECCCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 864388987998999999997369999999977 No 444 >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.76 E-value=0.0014 Score=42.61 Aligned_cols=31 Identities=26% Similarity=0.458 Sum_probs=24.4 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+.+.+| ..+|+|++||||||++..|. T Consensus 18 L~ninl~i~~Ge~i~IvG~sGsGKSTLl~ll~ 49 (234) T cd03251 18 LRDISLDIPAGETVALVGPSGSGKSTLVNLIP 49 (234) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 53608998799999999899982999999996 No 445 >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transport system, ATP-binding protein component. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely. Probab=96.74 E-value=0.002 Score=41.60 Aligned_cols=36 Identities=25% Similarity=0.432 Sum_probs=27.9 Q ss_pred CCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHH Q ss_conf 232545536732798-799986899864448999999 Q gi|254780766|r 14 EFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 14 nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~ 49 (375) ++.-.++.+++..+| +.+|+|+.||||||+|.+|.= T Consensus 16 ~~~al~~v~l~v~~Ge~~~llGpSG~GKtTlLr~iaG 52 (353) T TIGR03265 16 AFTALKDISLSVKKGEFVCLLGPSGCGKTTLLRIIAG 52 (353) T ss_pred CEEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 9988866486998999999999995359999999976 No 446 >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1. In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another. Probab=96.73 E-value=0.0017 Score=42.03 Aligned_cols=31 Identities=23% Similarity=0.485 Sum_probs=24.7 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+| ...|+|++||||||++..|. T Consensus 19 L~~isl~i~~G~~iaIvG~sGsGKSTLl~ll~ 50 (238) T cd03249 19 LKGLSLTIPPGKTVALVGSSGCGKSTVVSLLE 50 (238) T ss_pred ECCEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 22558997699999999999998999999982 No 447 >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Probab=96.72 E-value=0.0015 Score=42.43 Aligned_cols=33 Identities=24% Similarity=0.472 Sum_probs=25.9 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 4553673279-87999868998644489999997 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) .++.+++..+ .+.+|+|+|||||||+|-+|.=+ T Consensus 20 l~~vsl~i~~Ge~~~llGpsG~GKTTllr~iaGl 53 (358) T PRK11650 20 IKGIDLDVADGEFIVLVGPSGCGKSTLLRMVAGL 53 (358) T ss_pred EECCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 8252779889989999999863699999999769 No 448 >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Probab=96.72 E-value=0.0066 Score=38.16 Aligned_cols=71 Identities=25% Similarity=0.356 Sum_probs=55.6 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHH Q ss_conf 3312205899999999999999999870899789980122015989999999997417----980999806967854321 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLN 359 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~ 359 (375) .+-+|.||+.-+-||=.+| +..-++++||..||||+.....+..-++++ +.-.++.|+.++....+. T Consensus 505 f~ELStGQKeR~KLAklla---------erpn~~~iDEF~AhLD~~TA~rVArkiselARe~giTlivvThrpEv~~AL~ 575 (593) T COG2401 505 FSELSTGQKERAKLAKLLA---------ERPNVLLIDEFAAHLDELTAVRVARKISELAREAGITLIVVTHRPEVGNALR 575 (593) T ss_pred HHHCCCCHHHHHHHHHHHH---------CCCCCEEHHHHHHHCCHHHHHHHHHHHHHHHHHHCCEEEEEECCHHHHHCCC T ss_conf 7553854577789999973---------4898177356664317799999999999999970973999964877774448 Q ss_pred CCEE Q ss_conf 2600 Q gi|254780766|r 360 ETAK 363 (375) Q Consensus 360 ~~~~ 363 (375) -+.. T Consensus 576 PD~l 579 (593) T COG2401 576 PDTL 579 (593) T ss_pred CCEE T ss_conf 7506 No 449 >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. Probab=96.72 E-value=0.0017 Score=42.06 Aligned_cols=33 Identities=30% Similarity=0.612 Sum_probs=26.1 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 4553673279-87999868998644489999997 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) +++.++++.+ .+..|+|++||||||+|-.|.-+ T Consensus 14 L~~vsl~i~~Ge~~~i~GpSGsGKSTLL~~i~gl 47 (206) T TIGR03608 14 LDDLNLTIEKGKMVAIVGESGSGKSTLLNIIGLL 47 (206) T ss_pred ECCEEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 7580779869989999879997099999999759 No 450 >cd03299 ABC_ModC_like Archeal protein closely related to ModC. ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.71 E-value=0.0015 Score=42.29 Aligned_cols=33 Identities=24% Similarity=0.433 Sum_probs=25.0 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 4553673279-87999868998644489999997 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) .++.+++..+ .+.+|+|+|||||||+|-+|.=+ T Consensus 15 L~~vs~~v~~Ge~~~iiGpSGsGKSTLlr~i~Gl 48 (235) T cd03299 15 LKNVSLEVERGDYFVILGPTGSGKSVLLETIAGF 48 (235) T ss_pred ECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 9014879889989999999963599999999749 No 451 >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D. PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.70 E-value=0.0017 Score=42.06 Aligned_cols=36 Identities=25% Similarity=0.424 Sum_probs=26.9 Q ss_pred CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 3254553673279-87999868998644489999997 Q gi|254780766|r 15 FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) ..-+++.+++..+ .+.+|+|+|||||||+|-.|.-+ T Consensus 13 ~~vl~~vsl~v~~Ge~~~iiGpSGsGKSTllr~i~Gl 49 (232) T cd03300 13 FVALDGVSLDIKEGEFFTLLGPSGCGKTTLLRLIAGF 49 (232) T ss_pred EEEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 8898761748879989999999998399999999779 No 452 >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.68 E-value=0.0025 Score=40.92 Aligned_cols=36 Identities=22% Similarity=0.277 Sum_probs=26.4 Q ss_pred CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 3254553673279-87999868998644489999997 Q gi|254780766|r 15 FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) ..-+++.+++..+ .+..|+|+|||||||++-+|.-+ T Consensus 13 ~~~L~~isl~i~~Ge~~~iiG~SGsGKSTll~~i~gL 49 (235) T cd03261 13 RTVLKGVDLDVRRGEILAIIGPSGSGKSTLLRLIVGL 49 (235) T ss_pred EEEECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 9888260648879989999999997299999999759 No 453 >cd03288 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity. Probab=96.67 E-value=0.0019 Score=41.66 Aligned_cols=31 Identities=19% Similarity=0.284 Sum_probs=24.8 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+.+.+ ...+|+|+|||||||++-++. T Consensus 37 L~~inl~I~~Ge~vaIvG~sGsGKSTL~~ll~ 68 (257) T cd03288 37 LKHVKAYIKPGQKVGICGRTGSGKSSLSLAFF 68 (257) T ss_pred EECEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 10538998799999999999981999999996 No 454 >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology. Probab=96.62 E-value=0.0016 Score=42.24 Aligned_cols=21 Identities=33% Similarity=0.531 Sum_probs=19.0 Q ss_pred CEEEEECCCCCCHHHHHHHHH Q ss_conf 879998689986444899999 Q gi|254780766|r 28 QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 28 ~~n~i~G~NG~GKT~iLEAI~ 48 (375) .+..|+|+|||||||++-.|. T Consensus 26 Eiv~ilGpNGaGKSTllk~i~ 46 (177) T cd03222 26 EVIGIVGPNGTGKTTAVKILA 46 (177) T ss_pred CEEEEECCCCCCHHHHHHHHH T ss_conf 899998999999999999996 No 455 >TIGR02142 modC_ABC molybdate ABC transporter, ATP-binding protein; InterPro: IPR011868 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulphate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulphate transporter rather than by a specific molybdate transporter.; GO: 0005524 ATP binding, 0015098 molybdate ion transmembrane transporter activity, 0015689 molybdate ion transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=96.61 E-value=0.0061 Score=38.40 Aligned_cols=79 Identities=20% Similarity=0.284 Sum_probs=61.0 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCCEEEEECCHHHHHHHHCC Q ss_conf 12205899999999999999999870899789980122015989999999997417----98099980696785432126 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Qv~iTt~~~~~~~~~~~~ 361 (375) -+|-||+=-+++.=-| ...+=+||||||.|=||..+++-|+-||+.. +.=|++-+|+.+=..-+.|. T Consensus 131 ~LSGGEkQRVAIGRAL---------Ls~P~LLLMDEPLaaLD~~rk~EilPYLerL~~e~~iP~lyVSHsl~Ev~rLADr 201 (361) T TIGR02142 131 RLSGGEKQRVAIGRAL---------LSSPRLLLMDEPLAALDEPRKKEILPYLERLHAELKIPILYVSHSLDEVARLADR 201 (361) T ss_pred CCCCCCHHHHHHHHHH---------HCCCCHHHCCCCHHHCCHHHHHHHCCHHHHHHHHHCCCEEEEECCHHHHHHHHCE T ss_conf 7578404778899887---------4187411104662340644466416167678987279889990497999876074 Q ss_pred EEEEEECCCEEEEC Q ss_conf 00799728968959 Q gi|254780766|r 362 AKFMRISNHQALCI 375 (375) Q Consensus 362 ~~~~~i~~g~~~~~ 375 (375) +.-+++|++.+. T Consensus 202 --vvvl~~GrV~a~ 213 (361) T TIGR02142 202 --VVVLEDGRVEAA 213 (361) T ss_pred --EEEEECCEECCC T ss_conf --787435701036 No 456 >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Probab=96.60 E-value=0.027 Score=34.15 Aligned_cols=78 Identities=18% Similarity=0.155 Sum_probs=57.1 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHH---CCCCEEEEECCHHHHHHHHCCEE Q ss_conf 220589999999999999999987089978998012201598999999999741---79809998069678543212600 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD---IGSQIFMTGTDKSVFDSLNETAK 363 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~---~~~Qv~iTt~~~~~~~~~~~~~~ 363 (375) .|-||+|-.=++=.++ -.+-+.++||+.|.||-...+-+-+-+.. .+.-+++-||...+++.+.-+ . T Consensus 145 FSGGEkKR~EilQ~~~---------lePkl~ILDE~DSGLDIdalk~V~~~i~~lr~~~~~~liITHy~rll~~i~pD-~ 214 (251) T COG0396 145 FSGGEKKRNEILQLLL---------LEPKLAILDEPDSGLDIDALKIVAEGINALREEGRGVLIITHYQRLLDYIKPD-K 214 (251) T ss_pred CCCCHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHCCCC-E T ss_conf 4731577999999984---------59988995588767558999999999999865897299995579998426888-7 Q ss_pred EEEECCCEEEE Q ss_conf 79972896895 Q gi|254780766|r 364 FMRISNHQALC 374 (375) Q Consensus 364 ~~~i~~g~~~~ 374 (375) +.-+-+|+|.| T Consensus 215 vhvl~~GrIv~ 225 (251) T COG0396 215 VHVLYDGRIVK 225 (251) T ss_pred EEEEECCEEEE T ss_conf 99998888983 No 457 >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Probab=96.60 E-value=0.00082 Score=44.09 Aligned_cols=34 Identities=24% Similarity=0.430 Sum_probs=24.9 Q ss_pred CCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 3254553673279-879998689986444899999 Q gi|254780766|r 15 FRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 15 FR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) ++-..+.+++..+ .++.++|||||||||++--|. T Consensus 17 l~Al~~Vsl~v~~Gei~~LIGPNGAGKTTlfNlit 51 (250) T COG0411 17 LTAVNDVSLEVRPGEIVGLIGPNGAGKTTLFNLIT 51 (250) T ss_pred EEEEECEEEEECCCEEEEEECCCCCCCEEEEEEEC T ss_conf 89970414787387289998899888245665323 No 458 >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Probab=96.59 E-value=0.008 Score=37.62 Aligned_cols=29 Identities=31% Similarity=0.571 Sum_probs=22.3 Q ss_pred HEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 53673279-879998689986444899999 Q gi|254780766|r 20 SLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 20 ~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) ..+++-.+ .+++++|+||+||||+|-||. T Consensus 21 gvsl~v~~Geiv~llG~NGaGKTTlLkti~ 50 (237) T COG0410 21 GVSLEVERGEIVALLGRNGAGKTTLLKTIM 50 (237) T ss_pred EEEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 110587689889998999888899999985 No 459 >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter; InterPro: IPR005898 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. This model describes a family of cyclic peptide transporters in bacteria. Syringomycin is an amphipathic, cyclic lipodepsipeptide when inserted into host causes formation of channels, permeable to a variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.; GO: 0005524 ATP binding, 0015197 peptide transporter activity, 0015833 peptide transport, 0016021 integral to membrane. Probab=96.57 E-value=0.0017 Score=41.96 Aligned_cols=20 Identities=30% Similarity=0.710 Sum_probs=17.6 Q ss_pred CEEEEECCCCCCHHHHHHHH Q ss_conf 87999868998644489999 Q gi|254780766|r 28 QHTIFVGDNGVGKTNILEAI 47 (375) Q Consensus 28 ~~n~i~G~NG~GKT~iLEAI 47 (375) .+..|||+|||||||+..-+ T Consensus 369 ~~VyIVG~NGCGK~TL~K~l 388 (555) T TIGR01194 369 DLVYIVGENGCGKSTLIKLL 388 (555) T ss_pred CEEEEECCCCCCHHHHHHHH T ss_conf 28999648897389999999 No 460 >KOG0054 consensus Probab=96.57 E-value=0.028 Score=34.04 Aligned_cols=31 Identities=29% Similarity=0.467 Sum_probs=22.5 Q ss_pred CHHHEEEECCC-CEEEEECCCCCCHHHHHHHH Q ss_conf 54553673279-87999868998644489999 Q gi|254780766|r 17 NYASLRLVFDA-QHTIFVGDNGVGKTNILEAI 47 (375) Q Consensus 17 ~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI 47 (375) .+++..+++.+ .++.++|+-|||||++|.|| T Consensus 536 tL~dIn~~i~~G~lvaVvG~vGsGKSSLL~Ai 567 (1381) T KOG0054 536 TLKDINFEIKKGQLVAVVGPVGSGKSSLLSAI 567 (1381) T ss_pred CCCCEEEEECCCCEEEEECCCCCCHHHHHHHH T ss_conf 30141589628988999899988889999999 No 461 >TIGR00954 3a01203 Peroxysomal long chain fatty acyl transporter; InterPro: IPR005283 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). The members of this family are integral membrane proteins and they are involved in the import of activated long-chain fatty acids from the cytosol to the peroxisomal matrix. ; GO: 0005524 ATP binding, 0006810 transport, 0016021 integral to membrane. Probab=96.55 E-value=0.0014 Score=42.48 Aligned_cols=59 Identities=15% Similarity=0.319 Sum_probs=42.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCCCEEEEECCHH Q ss_conf 312205899999999999999999870899789980122015989999999997417980999806967 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~Qv~iTt~~~~ 353 (375) +.+|-|||=-++.|=. ++++ +--.+|||--|=.-.+-=..+.+.+.+.+. .++|-++.. T Consensus 708 DvLSGGEKQR~aMARl-----fYHK----P~fA~LDECTSAVSvDvE~~~y~~~~~~~I-~L~svsHR~ 766 (788) T TIGR00954 708 DVLSGGEKQRIAMARL-----FYHK----PKFAVLDECTSAVSVDVEGYMYRLAREAGI-TLISVSHRK 766 (788) T ss_pred HHHCCHHHHHHHHHHH-----HHCC----CCCEEHHHCCCCCCHHHHHHHHHHHHHCCC-EEEEEECCC T ss_conf 5633325887899888-----5248----851421010166676489999999986597-078850574 No 462 >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment. ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.54 E-value=0.0023 Score=41.20 Aligned_cols=34 Identities=24% Similarity=0.459 Sum_probs=26.4 Q ss_pred CCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHH Q ss_conf 254553673279-8799986899864448999999 Q gi|254780766|r 16 RNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 16 R~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~ 49 (375) .-.++.+++..+ .+.+|+|+|||||||+|-.|.= T Consensus 15 ~al~~vsl~i~~Ge~~~ilGpSG~GKSTllr~i~g 49 (242) T cd03295 15 KAVNNLNLEIAKGEFLVLIGPSGSGKTTTMKMINR 49 (242) T ss_pred EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHC T ss_conf 89830276886998999999999569999999975 No 463 >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy. Probab=96.53 E-value=0.0024 Score=41.05 Aligned_cols=31 Identities=23% Similarity=0.398 Sum_probs=24.7 Q ss_pred HHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 4553673279-879998689986444899999 Q gi|254780766|r 18 YASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.+ ....|+|++||||||++..|. T Consensus 18 L~~is~~i~~G~~vaivG~sGsGKSTll~ll~ 49 (237) T cd03252 18 LDNISLRIKPGEVVGIVGRSGSGKSTLTKLIQ 49 (237) T ss_pred EECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 51508998799999999999985999999996 No 464 >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane. The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring. Probab=96.53 E-value=0.0022 Score=41.35 Aligned_cols=36 Identities=22% Similarity=0.364 Sum_probs=26.5 Q ss_pred CCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 32545536732798-7999868998644489999997 Q gi|254780766|r 15 FRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 15 FR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) +.-+++.++++.+| +.+|+|+|||||||+|-.|.-+ T Consensus 14 ~~aL~~vsl~i~~Ge~v~i~GpSGsGKSTLl~~i~gl 50 (214) T cd03292 14 TAALDGINISISAGEFVFLVGPSGAGKSTLLKLIYKE 50 (214) T ss_pred CEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 8998221779859989999979995399999999629 No 465 >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively. Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM Probab=96.53 E-value=0.0026 Score=40.83 Aligned_cols=34 Identities=24% Similarity=0.506 Sum_probs=27.1 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 545536732798-7999868998644489999997 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) -+++.+++..+| +.+|+|+.||||||+|-.|.-+ T Consensus 15 vL~~vsl~i~~Ge~~~ivGpSGsGKSTLL~~i~gL 49 (213) T cd03262 15 VLKGIDLTVKKGEVVVIIGPSGSGKSTLLRCINLL 49 (213) T ss_pred EECCEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 88670759889989999999984499999999819 No 466 >KOG0054 consensus Probab=96.50 E-value=0.057 Score=32.06 Aligned_cols=55 Identities=15% Similarity=0.302 Sum_probs=21.2 Q ss_pred EEEEECCHHCCCHHHHHHHHHHHHHC-CCCEEEEECCHHHHHHHHCCEEEEEECCCEE Q ss_conf 89980122015989999999997417-9809998069678543212600799728968 Q gi|254780766|r 316 ILLLDEISAHLDEDKRNALFRIVTDI-GSQIFMTGTDKSVFDSLNETAKFMRISNHQA 372 (375) Q Consensus 316 ilLiDdi~s~LD~~~~~~ll~~l~~~-~~Qv~iTt~~~~~~~~~~~~~~~~~i~~g~~ 372 (375) ||+|||..|..|+.-=..+-+.+.+. +.=+++|-.| -++.+-|.-++.-+++|++ T Consensus 1296 ILvLDEATAsVD~~TD~lIQ~tIR~~F~dcTVLtIAH--Rl~TVmd~DrVlVld~G~v 1351 (1381) T KOG0054 1296 ILVLDEATASVDPETDALIQKTIREEFKDCTVLTIAH--RLNTVMDSDRVLVLDAGRV 1351 (1381) T ss_pred EEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEE--CCCCHHCCCEEEEEECCEE T ss_conf 8999644234786789999999999837896999720--1660431675899668847 No 467 >KOG0058 consensus Probab=96.50 E-value=0.041 Score=32.97 Aligned_cols=77 Identities=14% Similarity=0.310 Sum_probs=53.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .++|-||+--+++|--| ...+.||++||.-|-||.+--..+-+.|... +--|++=+|. ++.+..-- T Consensus 603 ~qLSGGQKQRIAIARAL---------lr~P~VLILDEATSALDaeSE~lVq~aL~~~~~~rTVlvIAHR---LSTV~~Ad 670 (716) T KOG0058 603 SQLSGGQKQRIAIARAL---------LRNPRVLILDEATSALDAESEYLVQEALDRLMQGRTVLVIAHR---LSTVRHAD 670 (716) T ss_pred CCCCCHHHHHHHHHHHH---------HHCCCEEEEECHHHHCCHHHHHHHHHHHHHHHCCCEEEEEEEH---HHHHHHCC T ss_conf 60663188999999998---------5099889882411211212199999999885358769998512---45664166 Q ss_pred EEEEECCCEEE Q ss_conf 07997289689 Q gi|254780766|r 363 KFMRISNHQAL 373 (375) Q Consensus 363 ~~~~i~~g~~~ 373 (375) +++-|++|++- T Consensus 671 ~Ivvi~~G~V~ 681 (716) T KOG0058 671 QIVVIDKGRVV 681 (716) T ss_pred EEEEECCCEEE T ss_conf 89997187178 No 468 >TIGR01842 type_I_sec_PrtD type I secretion system ATPase; InterPro: IPR010128 Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N terminus, but rather carry signals located toward the extreme C terminus to direct type I secretion.; GO: 0005524 ATP binding, 0015031 protein transport, 0016021 integral to membrane. Probab=96.49 E-value=0.0039 Score=39.64 Aligned_cols=75 Identities=17% Similarity=0.323 Sum_probs=57.3 Q ss_pred HCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCCE Q ss_conf 12205899999999999999999870899789980122015989999999997417---980999806967854321260 Q gi|254780766|r 286 HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 286 ~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~~ 362 (375) -+|-||+=-+.|| ...+|.+.++++|||.|.||.+-=..|++.|.+. ++=|++=||.+..++... + T Consensus 466 ~LSGGQRQRIaLA---------RAlyG~P~lvvLDEPNsNLD~~GE~AL~~Ai~~lK~rg~tvv~itHRp~lL~~vD-k- 534 (556) T TIGR01842 466 TLSGGQRQRIALA---------RALYGDPKLVVLDEPNSNLDEEGEQALANAIKALKARGITVVVITHRPSLLGLVD-K- 534 (556) T ss_pred CCCCHHHHHHHHH---------HHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHH-H- T ss_conf 7861468999999---------9871798378732889876617899999999999867972899841068999999-9- Q ss_pred EEEEECCCEE Q ss_conf 0799728968 Q gi|254780766|r 363 KFMRISNHQA 372 (375) Q Consensus 363 ~~~~i~~g~~ 372 (375) +.-+++|++ T Consensus 535 -Il~l~dG~~ 543 (556) T TIGR01842 535 -ILVLQDGRL 543 (556) T ss_pred -HHHHHCCHH T ss_conf -999840716 No 469 >KOG0062 consensus Probab=96.48 E-value=0.0043 Score=39.38 Aligned_cols=29 Identities=38% Similarity=0.539 Sum_probs=22.0 Q ss_pred HEEEECCCCEEEEECCCCCCHHHHHHHHHH Q ss_conf 536732798799986899864448999999 Q gi|254780766|r 20 SLRLVFDAQHTIFVGDNGVGKTNILEAISF 49 (375) Q Consensus 20 ~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~ 49 (375) ++.+.++. .=-++|.||+||||+|-||.- T Consensus 100 ~L~L~~Gr-RYGLvGrNG~GKsTLLRaia~ 128 (582) T KOG0062 100 NLTLSRGR-RYGLVGRNGIGKSTLLRAIAN 128 (582) T ss_pred CEEEECCC-CCCEECCCCCCHHHHHHHHHH T ss_conf 55563152-432147898758999999984 No 470 >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] Probab=96.46 E-value=0.0059 Score=38.50 Aligned_cols=47 Identities=13% Similarity=0.458 Sum_probs=41.3 Q ss_pred CEEEEEEEEECCCCHHHEEEECCCCEEEEECCCCCCHHHHHHHHHHH Q ss_conf 51899999922325455367327987999868998644489999997 Q gi|254780766|r 4 RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 4 ~M~i~~l~i~nFR~~~~~~i~f~~~~n~i~G~NG~GKT~iLEAI~~l 50 (375) .+++.+|.+.|+-.|....++..-+-.+++|.-|+|||++++||--+ T Consensus 14 ~FRL~~iqliNWGTF~T~~~~~T~~G~LvTG~~GSGKSTLIDAITav 60 (1104) T COG4913 14 QFRLSRIQLINWGTFHTVDIPVTREGILVTGGSGSGKSTLIDAITAV 60 (1104) T ss_pred CEEEEEEEEEECCCCCEEEEEEECCCEEEECCCCCCCHHHHHHHHHH T ss_conf 61466778850244312466675164577468888701099989998 No 471 >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=96.46 E-value=0.0028 Score=40.56 Aligned_cols=55 Identities=20% Similarity=0.279 Sum_probs=28.8 Q ss_pred CCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEC-CHHCCCHHHHHHHHHHHHHCCCCEEEEE Q ss_conf 22058999999999999999998708997899801-2201598999999999741798099980 Q gi|254780766|r 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDE-ISAHLDEDKRNALFRIVTDIGSQIFMTG 349 (375) Q Consensus 287 ~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDd-i~s~LD~~~~~~ll~~l~~~~~Qv~iTt 349 (375) +..|-=|+-++.+.+. +. . . + .-+++|+ .-.++|+...+.-+.++.+ +...|=.| T Consensus 383 G~SGsGKSTl~~LL~g---~~-p-~-~-G~I~i~g~di~~i~~~~lr~~i~~V~Q-~~~LF~~T 438 (588) T PRK11174 383 GPSGAGKTSLLNALLG---FL-P-Y-Q-GSLKINGIELRELDPESWRKHLSWVGQ-NPQLFHGT 438 (588) T ss_pred CCCCCCHHHHHHHHHH---HC-C-C-C-CEEEECCEECCCCCHHHHHHHEEEECC-CCCCCCCC T ss_conf 9998649999999987---28-9-8-8-389999986030899999966035166-67777662 No 472 >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Probab=96.44 E-value=0.0033 Score=40.17 Aligned_cols=27 Identities=22% Similarity=0.482 Sum_probs=12.7 Q ss_pred EEEECCCC-EEEEECCCCCCHHHHHHHH Q ss_conf 36732798-7999868998644489999 Q gi|254780766|r 21 LRLVFDAQ-HTIFVGDNGVGKTNILEAI 47 (375) Q Consensus 21 ~~i~f~~~-~n~i~G~NG~GKT~iLEAI 47 (375) .+++..|| .+.|||++||||||++.-| T Consensus 342 isl~i~~Ge~vaiVG~SGsGKSTL~~LL 369 (547) T PRK10522 342 INLTIKRGELLFLIGGNGSGKSTLAMLL 369 (547) T ss_pred EEEEECCCCEEEEECCCCCCHHHHHHHH T ss_conf 0479859988999899999779999998 No 473 >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Probab=96.42 E-value=0.02 Score=35.00 Aligned_cols=78 Identities=21% Similarity=0.312 Sum_probs=54.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .++|.|||-..+++-.|| -++-++|+|||.|-|||+...-++..+.++ ..-+++-.|+...|.- .-.+ T Consensus 151 ~~LSGGQQQR~aIARaLa---------meP~vmLFDEPTSALDPElVgEVLkv~~~LAeEgrTMv~VTHEM~FAR-~Vss 220 (256) T COG4598 151 AHLSGGQQQRVAIARALA---------MEPEVMLFDEPTSALDPELVGEVLKVMQDLAEEGRTMVVVTHEMGFAR-DVSS 220 (256) T ss_pred CCCCCHHHHHHHHHHHHH---------CCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEEEHHHHH-HHHH T ss_conf 114741788899999873---------597668645984327989999999999999971874899962046777-5300 Q ss_pred EEEEECCCEE Q ss_conf 0799728968 Q gi|254780766|r 363 KFMRISNHQA 372 (375) Q Consensus 363 ~~~~i~~g~~ 372 (375) .++-+.+|.| T Consensus 221 ~v~fLh~G~i 230 (256) T COG4598 221 HVIFLHQGKI 230 (256) T ss_pred HEEEEECCEE T ss_conf 1687554440 No 474 >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=96.40 E-value=0.0035 Score=40.01 Aligned_cols=35 Identities=26% Similarity=0.435 Sum_probs=26.6 Q ss_pred CCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 254553673279-87999868998644489999997 Q gi|254780766|r 16 RNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 16 R~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) .-+++.+++..+ .+.+|+|++||||||+|-.|.-+ T Consensus 14 ~~l~~vs~~i~~Ge~~~ivGpSG~GKSTllr~i~Gl 49 (178) T cd03229 14 TVLNDVSLNIEAGEIVALLGPSGSGKSTLLRCIAGL 49 (178) T ss_pred EEECCCEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 998370769889989999999998399999999859 No 475 >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Probab=96.40 E-value=0.0017 Score=42.08 Aligned_cols=30 Identities=30% Similarity=0.509 Sum_probs=20.8 Q ss_pred HHHEEEECCCCEE-EEECCCCCCHHHHHHHH Q ss_conf 4553673279879-99868998644489999 Q gi|254780766|r 18 YASLRLVFDAQHT-IFVGDNGVGKTNILEAI 47 (375) Q Consensus 18 ~~~~~i~f~~~~n-~i~G~NG~GKT~iLEAI 47 (375) .++.+..-.+|-+ +|+|+|||||||+|-=+ T Consensus 47 L~~isW~V~~ge~W~I~G~NGsGKTTLL~ll 77 (257) T COG1119 47 LGDLSWQVNPGEHWAIVGPNGAGKTTLLSLL 77 (257) T ss_pred CCCCCEEECCCCCEEEECCCCCCHHHHHHHH T ss_conf 1354305369984799888987789999999 No 476 >TIGR01257 rim_protein rim ABC transporter; InterPro: IPR005951 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Rim protein (ABCR), is an ATP binding cassette (ABC)1 transporter found in vertebrate retinal photoreceptor cells. It is localized along the rim region of photoreceptor rod outer segment disc membranes and more recently has been found in human foveal and peripheral cone outer segments. Several studies have implicated ABCR in the retinoid cycle, possibly functioning as a retinal extruder or retinal-phosphatidylethanolamine flippase to facilitate the removal of all-trans-retinal from disc membranes following the photobleaching of rhodopsin . ABCR contains eight glycosylation sites. Four sites reside in a 600-amino acid exocytoplasmic domain of the N-terminal half between the first transmembrane segment H1 and the first multi-spanning membrane domain, and four sites are in a 275-amino acid domain of the C half between transmembrane segment H7 and the second multi-spanning membrane domain. This leads to a model in which each half has a transmembrane segment followed by a large exocytoplasmic domain, a multi-spanning membrane domain, and a nucleotide binding domain. ; GO: 0005524 ATP binding, 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0005887 integral to plasma membrane. Probab=96.39 E-value=0.0022 Score=41.27 Aligned_cols=80 Identities=25% Similarity=0.362 Sum_probs=64.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC--CCCEEEEECCHHHHHHHHCCE Q ss_conf 312205899999999999999999870899789980122015989999999997417--980999806967854321260 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI--GSQIFMTGTDKSVFDSLNETA 362 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~--~~Qv~iTt~~~~~~~~~~~~~ 362 (375) .-+|.|-||-+.+++.+ .|+.-++++|||.|..||.-++.+.+.|.+. +--++++||+-+--+-+.+. T Consensus 1060 ~dlsGG~qrklsvaiaf---------vGd~kvv~ldePtsGvdPysrrsiWdlllkyrsGrtiimsthhmdead~lGdr- 1129 (2272) T TIGR01257 1060 QDLSGGMQRKLSVAIAF---------VGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTHHMDEADLLGDR- 1129 (2272) T ss_pred HHHHCCHHHEEEEEEEE---------ECCEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHCCCE- T ss_conf 43202111100234556---------52604899607878878521467999887622786689740332223440130- Q ss_pred EEEEECCCEEEEC Q ss_conf 0799728968959 Q gi|254780766|r 363 KFMRISNHQALCI 375 (375) Q Consensus 363 ~~~~i~~g~~~~~ 375 (375) +--|.+|++.|- T Consensus 1130 -iaii~qGrlyCs 1141 (2272) T TIGR01257 1130 -IAIISQGRLYCS 1141 (2272) T ss_pred -EEEEECCEEEEC T ss_conf -223245603324 No 477 >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Probab=96.39 E-value=0.01 Score=36.93 Aligned_cols=40 Identities=25% Similarity=0.569 Sum_probs=32.7 Q ss_pred EEEEECCCCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 99992232545536732798-79998689986444899999 Q gi|254780766|r 9 FLNISEFRNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 9 ~l~i~nFR~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +.+.-+||...++++...|| +-+++|+|||||||++++|. T Consensus 12 sVsF~GF~Aln~ls~~v~~Gelr~lIGpNGAGKTT~mD~It 52 (249) T COG4674 12 SVSFGGFKALNDLSFSVDPGELRVLIGPNGAGKTTLMDVIT 52 (249) T ss_pred EEEECCEEEEEEEEEEECCCEEEEEECCCCCCCEEEEEEEC T ss_conf 89876653420037886697289998789888505431001 No 478 >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Probab=96.38 E-value=0.0028 Score=40.59 Aligned_cols=46 Identities=22% Similarity=0.343 Sum_probs=31.6 Q ss_pred EEEEEEEEECCCCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 18999999223254553673279-87999868998644489999997 Q gi|254780766|r 5 IKIKFLNISEFRNYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 5 M~i~~l~i~nFR~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) ....+-....|+-+.+.+++... .+..+.|+|||||||+|-.|.=+ T Consensus 5 i~~~~~~~~~~~a~~di~l~i~~Ge~vaLlGpSGaGKsTlLRiIAGL 51 (345) T COG1118 5 INNVKKRFGAFGALDDISLDIKSGELVALLGPSGAGKSTLLRIIAGL 51 (345) T ss_pred EHHHHHHCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHHCC T ss_conf 00113321554211463155068868999778987678899998575 No 479 >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Probab=96.34 E-value=0.0035 Score=39.95 Aligned_cols=80 Identities=18% Similarity=0.151 Sum_probs=62.0 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHC Q ss_conf 3312205899999999999999999870899789980122015989999999997417---9809998069678543212 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNE 360 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~ 360 (375) +...|.|.+--+.+|+.++ ..+-||||||+.|=-|...+++.++.+.+. +.-+++.+|+......+.+ T Consensus 141 VKtYSSGMkaRLgFAIA~~---------~dPDILIIDEaLSVGD~~F~~Kc~~rm~ef~e~gkTIvfVSHsl~~Vk~~C~ 211 (549) T PRK13545 141 VKTYSSGMKSRLGFAISVH---------INPDILVIDEALSVGDQTFTKKCLDKMNEFKEQGKTIFFISHSLSQVKSFCT 211 (549) T ss_pred HHHHCHHHHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCC T ss_conf 6340886899999999982---------4999999946200578999999999999999789889999588899998573 Q ss_pred CEEEEEECCCEEEE Q ss_conf 60079972896895 Q gi|254780766|r 361 TAKFMRISNHQALC 374 (375) Q Consensus 361 ~~~~~~i~~g~~~~ 374 (375) . ..|+++|++-. T Consensus 212 R--~iWLe~G~vr~ 223 (549) T PRK13545 212 K--ALWLHYGQVKE 223 (549) T ss_pred E--EEEEECCEEEE T ss_conf 1--06343866787 No 480 >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Probab=96.32 E-value=0.0028 Score=40.56 Aligned_cols=33 Identities=24% Similarity=0.317 Sum_probs=25.8 Q ss_pred CCHHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 2545536732798-79998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +-.++.++++.+| +..|+|+||||||+++.+|. T Consensus 30 ~av~~Vsf~i~~GEilgivGeSGsGKSTl~~~i~ 63 (330) T PRK09473 30 TAVNDLNFSLRAGETLGIVGESGSGKSQTAFALM 63 (330) T ss_pred EEEECCEEEECCCCEEEEECCCCCHHHHHHHHHH T ss_conf 9866747688899899998689877999999997 No 481 >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Probab=96.31 E-value=0.0041 Score=39.50 Aligned_cols=33 Identities=33% Similarity=0.540 Sum_probs=26.3 Q ss_pred CCHHHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 254553673279-879998689986444899999 Q gi|254780766|r 16 RNYASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 16 R~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +...++++++.+ ..++|+|++||||||++.+|. T Consensus 335 ~~l~~l~~t~~~g~~talvG~SGaGKSTLl~lL~ 368 (559) T COG4988 335 PALSDLNLTIKAGQLTALVGASGAGKSTLLNLLL 368 (559) T ss_pred CCCCCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 5566710675489679998899997899999984 No 482 >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein; InterPro: IPR014343 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Members of this entry represent the ATP-binding protein of a conserved four-gene ABC transporter operon found next to ectoine utilisation operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This entry shows strong sequence similarity to a number of amino acid ABC transporter ATP-binding proteins.. Probab=96.28 E-value=0.016 Score=35.75 Aligned_cols=77 Identities=19% Similarity=0.310 Sum_probs=55.1 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHCCC---CEEEEECCHHHH-HHHHC Q ss_conf 31220589999999999999999987089978998012201598999999999741798---099980696785-43212 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS---QIFMTGTDKSVF-DSLNE 360 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~~~---Qv~iTt~~~~~~-~~~~~ 360 (375) .++|-|||--+++|--|| -.+-|+|.||+.|-|||+...-+++-+-++.. =+.+=.||.--| ..+.| T Consensus 149 ~QLSGGQ~QRVAIARaLA---------l~Pkv~LFDEvTSALDP~Lv~EVL~V~r~L~~E~dlTMLlVTH~MgFA~~~aD 219 (256) T TIGR03005 149 AQLSGGQKQRVAIARALA---------LRPKVMLFDEVTSALDPELVGEVLNVIRRLASEHDLTMLLVTHEMGFAREFAD 219 (256) T ss_pred CCCCCCCHHHHHHHHHHH---------CCCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEHHCCHHHHHHHC T ss_conf 402586147899999886---------08825663076212485789999999997403333200000101113344211 Q ss_pred CEEEEEECCCEE Q ss_conf 600799728968 Q gi|254780766|r 361 TAKFMRISNHQA 372 (375) Q Consensus 361 ~~~~~~i~~g~~ 372 (375) ..-||. .|+| T Consensus 220 RV~FFd--~G~I 229 (256) T TIGR03005 220 RVLFFD--KGRI 229 (256) T ss_pred EEEEEE--CCEE T ss_conf 114542--7766 No 483 >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Probab=96.27 E-value=0.0035 Score=39.99 Aligned_cols=34 Identities=24% Similarity=0.444 Sum_probs=26.1 Q ss_pred CHHHEEEECCC-CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 54553673279-87999868998644489999997 Q gi|254780766|r 17 NYASLRLVFDA-QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 17 ~~~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l 50 (375) -.++.+++..+ .+..|+|+|||||||++.+|..+ T Consensus 20 AL~~Vsl~I~~Gei~giIG~SGaGKSTLlr~i~gL 54 (343) T PRK11153 20 ALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLL 54 (343) T ss_pred EEECEEEEECCCCEEEEECCCCCHHHHHHHHHHCC T ss_conf 99661889989989999999998699999999659 No 484 >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru Probab=96.26 E-value=0.006 Score=38.46 Aligned_cols=34 Identities=18% Similarity=0.304 Sum_probs=26.1 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHH Q ss_conf 545536732798-7999868998644489999997 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l 50 (375) .+-..++.++++ +.+|+|+|++|||+.|.+|.+. T Consensus 18 ~~VpNdi~l~~~~~~iiTGpN~sGKSt~lkti~l~ 52 (202) T cd03243 18 TFVPNDINLGSGRLLLITGPNMGGKSTYLRSIGLA 52 (202) T ss_pred CEECCEEEECCCCEEEEECCCCCCHHHHHHHHHHH T ss_conf 77878288679828999899887539999999999 No 485 >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Probab=96.22 E-value=0.033 Score=33.66 Aligned_cols=61 Identities=30% Similarity=0.308 Sum_probs=48.2 Q ss_pred HHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHH----HHHHHHHCCCCEEEEECCHH Q ss_conf 33122058999999999999999998708997899801220159899999----99997417980999806967 Q gi|254780766|r 284 IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNA----LFRIVTDIGSQIFMTGTDKS 353 (375) Q Consensus 284 ~~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~----ll~~l~~~~~Qv~iTt~~~~ 353 (375) ..++|-|++--+.++--||. .+..||+|||++-||.-.++. +++....++.|+++-||+-+ T Consensus 130 i~qLSGGmrQRvGiARALa~---------eP~~LlLDEPfgAlDa~tRe~mQelLldlw~~tgk~~lliTH~ie 194 (259) T COG4525 130 IWQLSGGMRQRVGIARALAV---------EPQLLLLDEPFGALDALTREQMQELLLDLWQETGKQVLLITHDIE 194 (259) T ss_pred EEEECCHHHHHHHHHHHHHC---------CCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCHH T ss_conf 57506508887778887604---------866476348505677888999999999999972981899965378 No 486 >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Probab=96.17 E-value=0.0055 Score=38.71 Aligned_cols=31 Identities=16% Similarity=0.374 Sum_probs=23.8 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++.++++.|| ...|+|++||||||++..+. T Consensus 351 L~~isl~i~~Ge~vaiVG~SGsGKSTL~~LL~ 382 (585) T PRK13657 351 VEDVSFEAKPGQTVAIVGPTGAGKSTLINLLH 382 (585) T ss_pred CCCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 36703897599889998898986999999986 No 487 >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a Probab=96.16 E-value=0.0062 Score=38.37 Aligned_cols=33 Identities=24% Similarity=0.407 Sum_probs=24.6 Q ss_pred HHHEEEECCC--CEEEEECCCCCCHHHHHHHHHHH Q ss_conf 4553673279--87999868998644489999997 Q gi|254780766|r 18 YASLRLVFDA--QHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 18 ~~~~~i~f~~--~~n~i~G~NG~GKT~iLEAI~~l 50 (375) +-..++.+++ ++.+|+|+|.+|||++|.+|.+. T Consensus 17 ~V~Ndi~l~~~~~~~iiTGpN~sGKSt~lk~i~l~ 51 (200) T cd03280 17 VVPLDIQLGENKRVLVITGPNAGGKTVTLKTLGLL 51 (200) T ss_pred EECCEEEECCCCEEEEEECCCCCCCHHHHHHHHHH T ss_conf 47625897799339999889877509999999999 No 488 >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701 Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se .. Probab=96.10 E-value=0.0059 Score=38.49 Aligned_cols=29 Identities=24% Similarity=0.542 Sum_probs=22.2 Q ss_pred HEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 53673279-879998689986444899999 Q gi|254780766|r 20 SLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 20 ~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) +.++.-.+ -..++.|+-||||||||-||| T Consensus 26 ~v~l~V~aGEcv~L~G~SGaGKSTlLk~lY 55 (224) T TIGR02324 26 NVSLTVNAGECVALSGPSGAGKSTLLKSLY 55 (224) T ss_pred CCEEEEECCCEEEEECCCCCCHHHHHHHHH T ss_conf 743787367358853688876789999766 No 489 >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=96.08 E-value=0.006 Score=38.45 Aligned_cols=30 Identities=23% Similarity=0.425 Sum_probs=19.8 Q ss_pred HHEEEECCC-CEEEEECCCCCCHHHHHHHHH Q ss_conf 553673279-879998689986444899999 Q gi|254780766|r 19 ASLRLVFDA-QHTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 19 ~~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~ 48 (375) ++..+.+.| ....|+|++||||||++-.|. T Consensus 332 ~~isl~I~~Ge~vaIVG~SGsGKSTLl~LL~ 362 (569) T PRK10789 332 ENVNFTLKPGQMLGICGPTGSGKSTLLSLIQ 362 (569) T ss_pred CCCCCEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 0765688899789987999998799999999 No 490 >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Probab=96.08 E-value=0.0052 Score=38.83 Aligned_cols=31 Identities=16% Similarity=0.445 Sum_probs=24.5 Q ss_pred HHHEEEECCCCEE-EEECCCCCCHHHHHHHHH Q ss_conf 4553673279879-998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQHT-IFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~~n-~i~G~NG~GKT~iLEAI~ 48 (375) +++.++.+.||-. .|+|++||||||++..+. T Consensus 345 l~~is~~i~~Ge~vaiVG~sGsGKSTl~~LL~ 376 (567) T COG1132 345 LKDISFSIEPGEKVAIVGPSGSGKSTLIKLLL 376 (567) T ss_pred CCCCEEEECCCCEEEEECCCCCCHHHHHHHHH T ss_conf 10522775489878885588885789999998 No 491 >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Probab=96.07 E-value=0.014 Score=36.02 Aligned_cols=35 Identities=26% Similarity=0.437 Sum_probs=28.2 Q ss_pred CHHHEEEECCCC-EEEEECCCCCCHHHHHHHHHHHC Q ss_conf 545536732798-79998689986444899999972 Q gi|254780766|r 17 NYASLRLVFDAQ-HTIFVGDNGVGKTNILEAISFLS 51 (375) Q Consensus 17 ~~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~~l~ 51 (375) -+...++++.+| +..|+|+-||||||+|--|..+. T Consensus 20 ~L~~v~l~i~~Ge~vaI~GpSGSGKSTLLniig~ld 55 (226) T COG1136 20 ALKDVNLEIEAGEFVAIVGPSGSGKSTLLNLLGGLD 55 (226) T ss_pred ECCCCEEEECCCCEEEEECCCCCCHHHHHHHHHCCC T ss_conf 524625887499899998999998999999996466 No 492 >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Probab=96.06 E-value=0.038 Score=33.21 Aligned_cols=77 Identities=19% Similarity=0.305 Sum_probs=58.9 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC---CCCEEEEECCHHHHHHHHCC Q ss_conf 312205899999999999999999870899789980122015989999999997417---98099980696785432126 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI---GSQIFMTGTDKSVFDSLNET 361 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~---~~Qv~iTt~~~~~~~~~~~~ 361 (375) .-+|-||+-.+.|+ ...+|.+-++.+|||.|+||..--..+.+.+... ++=+++-||.+..+... | T Consensus 471 ~~LSgGQRQRIaLA---------RAlYG~P~lvVLDEPNsNLD~~GE~AL~~Ai~~~k~rG~~vvviaHRPs~L~~~-D- 539 (580) T COG4618 471 ATLSGGQRQRIALA---------RALYGDPFLVVLDEPNSNLDSEGEAALAAAILAAKARGGTVVVIAHRPSALASV-D- 539 (580) T ss_pred CCCCCHHHHHHHHH---------HHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHC-C- T ss_conf 87772378999999---------997089708995589877652679999999999997698799992677788515-5- Q ss_pred EEEEEECCCEEE Q ss_conf 007997289689 Q gi|254780766|r 362 AKFMRISNHQAL 373 (375) Q Consensus 362 ~~~~~i~~g~~~ 373 (375) ++.-+++|++- T Consensus 540 -kilvl~~G~~~ 550 (580) T COG4618 540 -KILVLQDGRIA 550 (580) T ss_pred -EEEEECCCHHH T ss_conf -34422388477 No 493 >PRK11176 lipid transporter ATP-binding/permease protein; Provisional Probab=96.05 E-value=0.0039 Score=39.69 Aligned_cols=31 Identities=23% Similarity=0.443 Sum_probs=22.5 Q ss_pred HHHEEEECCCC-EEEEECCCCCCHHHHHHHHH Q ss_conf 45536732798-79998689986444899999 Q gi|254780766|r 18 YASLRLVFDAQ-HTIFVGDNGVGKTNILEAIS 48 (375) Q Consensus 18 ~~~~~i~f~~~-~n~i~G~NG~GKT~iLEAI~ 48 (375) +++..+++.+| ...|+|++||||||++..|. T Consensus 358 L~~isl~I~~G~~vaiVG~SGsGKSTL~~LL~ 389 (581) T PRK11176 358 LRNINFKIPAGKTVALVGRSGSGKSTIANLLT 389 (581) T ss_pred CCCCCCCCCCCCEEECCCCCCCCHHHHHHHHH T ss_conf 10663357999443122899986789999998 No 494 >TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family; InterPro: IPR004346 This family includes the Helicobacter pylori protein CagE (see examples), which together with other proteins from the cag pathogenicity island (PAI), encodes a type IV transporter secretion system. The precise role of CagE is not known, but studies in animal models have shown that it is essential for pathogenesis in Helicobacter pylori induced gastritis and peptic ulceration . Indeed, the expression of the cag PAI has been shown to be essential for stimulating human gastric epithelial cell apoptosis in vitro . Similar type IV transport systems are also found in other bacteria. This family includes proteins from the trb and Vir conjugal transfer systems in Agrobacterium tumefaciens and homologues of VirB proteins from other species.; GO: 0005524 ATP binding. Probab=96.05 E-value=0.0038 Score=39.76 Aligned_cols=68 Identities=13% Similarity=0.079 Sum_probs=40.2 Q ss_pred HHCCCHH-HHHHHHHHHHHHHHHHHHHCC--CCCEEEEECCHHCCCHHHHHHHHHHHHH----CCCCEEEEECCH Q ss_conf 3122058-999999999999999998708--9978998012201598999999999741----798099980696 Q gi|254780766|r 285 AHGSTGE-QKVVLVGIFLAHARLISNTTG--FAPILLLDEISAHLDEDKRNALFRIVTD----IGSQIFMTGTDK 352 (375) Q Consensus 285 ~~~S~Gq-qk~~~l~l~La~~~~~~~~~~--~~pilLiDdi~s~LD~~~~~~ll~~l~~----~~~Qv~iTt~~~ 352 (375) .+++.|+ .+.+..++..=..++.+...| +.-++.|||.=+-|++.-....++...+ .++=+++.|=+. T Consensus 723 ~ll~~~e~~~~~~p~~~YLf~Ri~~~~dg~~r~~~~~~DEaw~~l~~p~~~~~i~~~l~t~RK~NG~~v~ATQ~~ 797 (931) T TIGR00929 723 ELLDNPELEKVATPVLLYLFHRIEEALDGSNRRFLIVIDEAWKLLGDPVFAAKIKDWLKTLRKANGIVVLATQSI 797 (931) T ss_pred HHHCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHHHCCHHHHHHHHHHHHHHHHHCCEEEEECCHH T ss_conf 642476866789999999999999972413586799851305332690789999999875766097798630014 No 495 >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE; InterPro: IPR014137 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.. Probab=96.04 E-value=0.011 Score=36.69 Aligned_cols=77 Identities=17% Similarity=0.312 Sum_probs=61.0 Q ss_pred HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHCCCHHHHHHHHHHHHHC----CCC-EEEEECCHHHHHHHH Q ss_conf 312205899999999999999999870899789980122015989999999997417----980-999806967854321 Q gi|254780766|r 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI----GSQ-IFMTGTDKSVFDSLN 359 (375) Q Consensus 285 ~~~S~Gqqk~~~l~l~La~~~~~~~~~~~~pilLiDdi~s~LD~~~~~~ll~~l~~~----~~Q-v~iTt~~~~~~~~~~ 359 (375) .++|-||-=-+-+|=-||- .+-++.+||.-|.||..+|..+++.|.++ +.= +|| |||-.....+. T Consensus 150 ~qlSGGQLQRiniARALA~---------~PkLivLDEavSnLD~~lQ~~iL~lL~~L~q~~G~aylfi-tHDL~lv~~f~ 219 (267) T TIGR02769 150 RQLSGGQLQRINIARALAV---------KPKLIVLDEAVSNLDLVLQAVILELLKKLQQEFGTAYLFI-THDLRLVQKFC 219 (267) T ss_pred CCCCCCHHHHHHHHHHHHC---------CCCEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEHH-HHHHHHHHHHH T ss_conf 0005746899999999730---------8973753222557679999999999999987009554135-64799999998 Q ss_pred CCEEEEEECCCEEE Q ss_conf 26007997289689 Q gi|254780766|r 360 ETAKFMRISNHQAL 373 (375) Q Consensus 360 ~~~~~~~i~~g~~~ 373 (375) +. +.-+++|||+ T Consensus 220 ~r--~~vm~~Gqiv 231 (267) T TIGR02769 220 QR--VLVMDKGQIV 231 (267) T ss_pred HH--HHHHCCCEEE T ss_conf 77--7554188278 No 496 >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam Probab=96.03 E-value=0.0077 Score=37.73 Aligned_cols=31 Identities=19% Similarity=0.341 Sum_probs=24.1 Q ss_pred HEEEEC--CCCEEEEECCCCCCHHHHHHHHHHH Q ss_conf 536732--7987999868998644489999997 Q gi|254780766|r 20 SLRLVF--DAQHTIFVGDNGVGKTNILEAISFL 50 (375) Q Consensus 20 ~~~i~f--~~~~n~i~G~NG~GKT~iLEAI~~l 50 (375) ..++.+ +..+.+|+|+|.+|||+.|-+|.++ T Consensus 21 pNdi~l~~~~~~~iiTGpN~sGKSt~Lk~igl~ 53 (216) T cd03284 21 PNDTELDPERQILLITGPNMAGKSTYLRQVALI 53 (216) T ss_pred CCEEEECCCCEEEEEECCCCCCHHHHHHHHHHH T ss_conf 656897898459999899877459999999999 No 497 >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. Probab=96.03 E-value=0.005 Score=38.94 Aligned_cols=26 Identities=15% Similarity=0.119 Sum_probs=12.8 Q ss_pred ECCCCCCHHHHHHHHHHHC-CCCCCCC Q ss_conf 8689986444899999972-8866667 Q gi|254780766|r 33 VGDNGVGKTNILEAISFLS-PGRGFRR 58 (375) Q Consensus 33 ~G~NG~GKT~iLEAI~~l~-~gksfR~ 58 (375) ++.+|.-=.++.++..-++ ..|.+|. T Consensus 27 ~~~~G~sl~~l~~~a~~~Gl~~~~~~~ 53 (694) T TIGR03375 27 LEDGRLTPELLPRAARRAGLSARLVKR 53 (694) T ss_pred CCCCCCCHHHHHHHHHHCCCEEEEEEC T ss_conf 999999999999999977996799957 No 498 >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Probab=96.02 E-value=0.0064 Score=38.25 Aligned_cols=25 Identities=28% Similarity=0.535 Sum_probs=13.6 Q ss_pred EECCCC-EEEEECCCCCCHHHHHHHH Q ss_conf 732798-7999868998644489999 Q gi|254780766|r 23 LVFDAQ-HTIFVGDNGVGKTNILEAI 47 (375) Q Consensus 23 i~f~~~-~n~i~G~NG~GKT~iLEAI 47 (375) +++.|| ...|+|++||||||++--+ T Consensus 494 L~I~~Ge~vaIvG~SGsGKSTL~KLL 519 (709) T COG2274 494 LEIPPGEKVAIVGRSGSGKSTLLKLL 519 (709) T ss_pred EEECCCCEEEEECCCCCCHHHHHHHH T ss_conf 77679988999879999889999998 No 499 >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Probab=96.02 E-value=0.0074 Score=37.84 Aligned_cols=28 Identities=29% Similarity=0.610 Sum_probs=14.1 Q ss_pred HEEEECCC-CEEEEECCCCCCHHHHHHHH Q ss_conf 53673279-87999868998644489999 Q gi|254780766|r 20 SLRLVFDA-QHTIFVGDNGVGKTNILEAI 47 (375) Q Consensus 20 ~~~i~f~~-~~n~i~G~NG~GKT~iLEAI 47 (375) +.++...| ....|+|+.||||||++..+ T Consensus 359 ~isl~i~~Ge~vaiVG~SGsGKSTL~~LL 387 (575) T PRK11160 359 GLSLQIKAGEKVALLGRTGCGKSTLLQLL 387 (575) T ss_pred CEEEEECCCCEEEEECCCCCCHHHHHHHH T ss_conf 71589769988999889997599999998 No 500 >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Probab=96.02 E-value=0.0081 Score=37.59 Aligned_cols=32 Identities=31% Similarity=0.499 Sum_probs=23.8 Q ss_pred HEEEECCC-CEEEEECCCCCCHHHHHHHHHHHC Q ss_conf 53673279-879998689986444899999972 Q gi|254780766|r 20 SLRLVFDA-QHTIFVGDNGVGKTNILEAISFLS 51 (375) Q Consensus 20 ~~~i~f~~-~~n~i~G~NG~GKT~iLEAI~~l~ 51 (375) +.+++-.. .++.+.|+|||||||+|--|+-+. T Consensus 20 dVSF~ae~Gei~GlLG~NGAGKTT~LRmiatlL 52 (245) T COG4555 20 DVSFEAEEGEITGLLGENGAGKTTLLRMIATLL 52 (245) T ss_pred HEEEEECCCEEEEEECCCCCCCHHHHHHHHHHC T ss_conf 525785066499987689887123799999832 Done!