BLAST/PSIBLAST alignment of GI: 254780766 and GI: 190889810 at iteration 1
>gi|190889810|ref|YP_001976352.1| DNA replication and repair protein [Rhizobium etli CIAT 652] Length = 374
>gi|226737822|sp|B3PXG8|RECF_RHIE6 RecName: Full=DNA replication and repair protein recF Length = 374
>gi|190695089|gb|ACE89174.1| DNA replication and repair protein [Rhizobium etli CIAT 652] Length = 374
 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/369 (49%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA++ L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGEVEIGTGIEAGEETTTRKLRINGTPAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD 
Sbjct: 121 RLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLARLIEERPESSPFPSASLQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L++EYA  L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ 
Sbjct: 241 VDLEDEYAAMLAESRYRDASAGRTLDGPHRADLIVHHREKAMEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDQTMFSALAD 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 RAQFFTVAD 369