BLAST/PSIBLAST alignment of GI: 254780766 and GI: 218515494 at iteration 1
>gi|218515494|ref|ZP_03512334.1| recombination protein F [Rhizobium etli 8C-3] Length = 367
 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 253/362 (69%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRNYA++ L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+Y D+TR+G+
Sbjct: 3   LKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGA 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HLR+ WL P+M
Sbjct: 63  AGGFSIFAALDGMEGEVEIGTGIEAGEETTTRKLRINGKPAKTADELTDHLRLLWLTPAM 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           D +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD SW + IE Q
Sbjct: 123 DGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDPSWLAGIEEQ 182

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +    L++EYA 
Sbjct: 183 MASLGIAMALARQEMLGLLARLIEERPESSPFPSASLQLSGFMDGQFSRPSVDLEDEYAA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
            L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ LAHARL+ N
Sbjct: 243 MLAESRYRDASAGRTLDGPHRADLIVHHREKAMEAERCSTGEQKALLVGLVLAHARLVGN 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
            TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L + A+F  +++
Sbjct: 303 LTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDQTMFSALADRAQFFTVAD 362

Query: 370 HQ 371
            +
Sbjct: 363 GK 364