BLAST/PSIBLAST alignment of GI: 254780766 and GI: 86355801 at iteration 1
>gi|86355801|ref|YP_467693.1| recombination protein F [Rhizobium etli CFN 42] Length = 374
>gi|123738428|sp|Q2KDX0|RECF_RHIEC RecName: Full=DNA replication and repair protein recF Length = 374
>gi|86279903|gb|ABC88966.1| DNA replication and repair protein [Rhizobium etli CFN 42] Length = 374
 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 181/369 (49%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAASLSLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGEVEIGTGIEAGEETTARRLRINGTPAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL+P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL +G FD 
Sbjct: 121 RLLWLIPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDDGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ L  E ++   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLTEETLESSPFPSASLQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+++Y   L + R  D+ + RTL GPHR+DL+V + +KA+  A  STGEQK +LVG+ 
Sbjct: 241 VDLEDDYRVMLAESRYRDAGAGRTLEGPHRTDLVVHHREKAMEAARCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE++R ALF I+  +G Q FMTGTD+ +F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDENRRAALFDIIDGLGGQAFMTGTDRGMFTALGD 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 RAQFFTVAD 369