BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780766|ref|YP_003065179.1| recombination protein F
[Candidatus Liberibacter asiaticus str. psy62]
         (375 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780766|ref|YP_003065179.1| recombination protein F [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040443|gb|ACT57239.1| recombination protein F [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 375

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/375 (100%), Positives = 375/375 (100%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS
Sbjct: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL
Sbjct: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS
Sbjct: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF
Sbjct: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
           CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF
Sbjct: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE
Sbjct: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360

Query: 361 TAKFMRISNHQALCI 375
           TAKFMRISNHQALCI
Sbjct: 361 TAKFMRISNHQALCI 375


>gi|315121983|ref|YP_004062472.1| recombination protein F [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495385|gb|ADR51984.1| recombination protein F [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 375

 Score =  634 bits (1634), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 303/373 (81%), Positives = 342/373 (91%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M N+IKIK LN+SEFRNY SLRLVFD+Q TIFVGDNG GKTNILEAIS LSPGRG RRAS
Sbjct: 1   MINKIKIKRLNVSEFRNYVSLRLVFDSQQTIFVGDNGAGKTNILEAISLLSPGRGLRRAS 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y+DVTRIGS S FSTFA VEGM+GLA+ISIKLE++DDRS+RCL+INDV IRVVDELN HL
Sbjct: 61  YSDVTRIGSLSLFSTFACVEGMDGLAEISIKLESKDDRSIRCLRINDVAIRVVDELNSHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+SWLVPSMDRIFSG S ERRRFLDRMVF+IDPRHRRR+IDFERLMRGRNRLL+EG FD 
Sbjct: 121 RVSWLVPSMDRIFSGPSTERRRFLDRMVFSIDPRHRRRIIDFERLMRGRNRLLSEGCFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SWCSSIE+QMA LGV+I+IARV+MI+ LSSL+ EY+QKENFPH++L+LTGFLDGK +QSF
Sbjct: 181 SWCSSIESQMAGLGVEIDIARVKMIDELSSLMAEYIQKENFPHVELNLTGFLDGKLNQSF 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             LK+EY K LFDGR++DS++RRTLIGPHRSDL+VDYCDK I I HGSTGEQKVVLVGIF
Sbjct: 241 LELKQEYVKILFDGRRIDSIARRTLIGPHRSDLVVDYCDKDIKIVHGSTGEQKVVLVGIF 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARLISNTTGFAPILLLDEISAHLDE +RNALFRIV+DIGSQIF+TGTD+S+F SL++
Sbjct: 301 LAHARLISNTTGFAPILLLDEISAHLDEGRRNALFRIVSDIGSQIFITGTDRSMFSSLSD 360

Query: 361 TAKFMRISNHQAL 373
           TA FMRI+NHQA 
Sbjct: 361 TATFMRIANHQAF 373


>gi|222084353|ref|YP_002542882.1| DNA replication and repair protein [Agrobacterium radiobacter K84]
 gi|254790457|sp|B9JGW1|RECF_AGRRK RecName: Full=DNA replication and repair protein recF
 gi|221721801|gb|ACM24957.1| DNA replication and repair protein [Agrobacterium radiobacter K84]
          Length = 375

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 258/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ I  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVFISRLKLTDFRNYAAAALTLDERHVVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R+ +P+ FS FA +EGME   +I   ++T D+ + R L+IN    + VDEL  HL
Sbjct: 61  YADVVRVAAPNGFSIFAELEGMEDTVEIGTGVDTSDETTARKLRINGTPAKTVDELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S ERRRFLDR+V ++DP H RR  DFER MR RNRLL+E  FD 
Sbjct: 121 RVLWLTPAMDGLFTGGSSERRRFLDRLVLSLDPAHGRRASDFERAMRSRNRLLSESRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GFLDG+FD+  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLIAETREATPFPSAALELSGFLDGQFDRPA 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L++ YA  L +GR  D+ + RTL GPHR+DL+V + +K +     STGEQK +LVG+ 
Sbjct: 241 LDLEDAYAGMLREGRYRDAAAGRTLDGPHRTDLLVRHREKDMEAERCSTGEQKALLVGLI 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG AP+LLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L E
Sbjct: 301 LAHARLVGNLTGHAPVLLLDEIAAHLDEGRRAALFDLIDRLGGQAFMTGTDRAMFSALGE 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 RAQFFTVAH 369


>gi|116249915|ref|YP_765753.1| recombination protein F [Rhizobium leguminosarum bv. viciae 3841]
 gi|123262032|sp|Q1MN15|RECF_RHIL3 RecName: Full=DNA replication and repair protein recF
 gi|115254563|emb|CAK05637.1| putative DNA replication and repair protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 374

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/369 (49%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAAALALDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +ET ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGDVEIGTGIETGEETTARKLRINGTTAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD 
Sbjct: 121 RLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLIEETRETSPFPSASLQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+++YA  L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ 
Sbjct: 241 VDLEDDYAAMLAESRYRDAGAGRTLEGPHRADLIVHHREKAMEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDRAMFSALGD 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 KAQFFTVAD 369


>gi|241207093|ref|YP_002978189.1| recombination protein F [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860983|gb|ACS58650.1| DNA replication and repair protein RecF [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 374

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 185/369 (50%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAAALTLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +ET ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGDVEIGTGIETSEETTARRLRINGTTAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD 
Sbjct: 121 RLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLIEETRESSPFPSAALQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+++YA  L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ 
Sbjct: 241 VDLEDDYAAMLAESRYRDAGAGRTLEGPHRADLIVHHREKAMEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQSFMTGTDRAMFAALGD 360

Query: 361 TAKFMRISN 369
            A+F  +S+
Sbjct: 361 RAQFFTVSD 369


>gi|190889810|ref|YP_001976352.1| DNA replication and repair protein [Rhizobium etli CIAT 652]
 gi|226737822|sp|B3PXG8|RECF_RHIE6 RecName: Full=DNA replication and repair protein recF
 gi|190695089|gb|ACE89174.1| DNA replication and repair protein [Rhizobium etli CIAT 652]
          Length = 374

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/369 (49%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA++ L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGEVEIGTGIEAGEETTTRKLRINGTPAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD 
Sbjct: 121 RLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLARLIEERPESSPFPSASLQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L++EYA  L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ 
Sbjct: 241 VDLEDEYAAMLAESRYRDASAGRTLDGPHRADLIVHHREKAMEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDQTMFSALAD 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 RAQFFTVAD 369


>gi|209551663|ref|YP_002283580.1| recombination protein F [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226737823|sp|B5ZWP8|RECF_RHILW RecName: Full=DNA replication and repair protein recF
 gi|209537419|gb|ACI57354.1| DNA replication and repair protein RecF [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 374

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/369 (49%), Positives = 256/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAAALDLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +ET ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGEVEIGTGIETGEETTARRLRINGTQAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD 
Sbjct: 121 RLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLIEETRETSPFPSASLQLSGFMDGQFTRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L++EYA  L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ 
Sbjct: 241 VDLEDEYAAMLSESRYRDAGAGRTLDGPHRADLIVHHREKAMEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDRAMFSALGD 360

Query: 361 TAKFMRISN 369
            A+   +++
Sbjct: 361 RAQVFTVAD 369


>gi|86355801|ref|YP_467693.1| recombination protein F [Rhizobium etli CFN 42]
 gi|123738428|sp|Q2KDX0|RECF_RHIEC RecName: Full=DNA replication and repair protein recF
 gi|86279903|gb|ABC88966.1| DNA replication and repair protein [Rhizobium etli CFN 42]
          Length = 374

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 181/369 (49%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAASLSLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGEVEIGTGIEAGEETTARRLRINGTPAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL+P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL +G FD 
Sbjct: 121 RLLWLIPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDDGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ L  E ++   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLTEETLESSPFPSASLQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+++Y   L + R  D+ + RTL GPHR+DL+V + +KA+  A  STGEQK +LVG+ 
Sbjct: 241 VDLEDDYRVMLAESRYRDAGAGRTLEGPHRTDLVVHHREKAMEAARCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE++R ALF I+  +G Q FMTGTD+ +F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDENRRAALFDIIDGLGGQAFMTGTDRGMFTALGD 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 RAQFFTVAD 369


>gi|218515494|ref|ZP_03512334.1| recombination protein F [Rhizobium etli 8C-3]
          Length = 367

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 253/362 (69%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRNYA++ L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+Y D+TR+G+
Sbjct: 3   LKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGA 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HLR+ WL P+M
Sbjct: 63  AGGFSIFAALDGMEGEVEIGTGIEAGEETTTRKLRINGKPAKTADELTDHLRLLWLTPAM 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           D +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD SW + IE Q
Sbjct: 123 DGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDPSWLAGIEEQ 182

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +    L++EYA 
Sbjct: 183 MASLGIAMALARQEMLGLLARLIEERPESSPFPSASLQLSGFMDGQFSRPSVDLEDEYAA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
            L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ LAHARL+ N
Sbjct: 243 MLAESRYRDASAGRTLDGPHRADLIVHHREKAMEAERCSTGEQKALLVGLVLAHARLVGN 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
            TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L + A+F  +++
Sbjct: 303 LTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDQTMFSALADRAQFFTVAD 362

Query: 370 HQ 371
            +
Sbjct: 363 GK 364


>gi|327192780|gb|EGE59709.1| DNA replication and repair protein [Rhizobium etli CNPAF512]
          Length = 442

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 257/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA++ L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+
Sbjct: 69  MPHKVSLSRLKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAA 128

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++G+EG  +I   +E  ++ + R L+IN    +  DEL  HL
Sbjct: 129 YGDITRVGAAGGFSIFAALDGIEGEVEIGTGIEAGEETTTRKLRINGTPAKTADELTDHL 188

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL EG FD 
Sbjct: 189 RLLWLTPAMDGLFTGASSDRRRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDP 248

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ LI E  +   FP   L L+GF+DG+F +  
Sbjct: 249 SWLAGIEEQMASLGIAMALARQEMLGLLARLIEERPESSPFPSASLQLSGFMDGQFSRPS 308

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L++EYA  L + R  D+ + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ 
Sbjct: 309 VDLEDEYAAMLAESRYRDASAGRTLDGPHRADLIVHHREKAMEAERCSTGEQKALLVGLV 368

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L +
Sbjct: 369 LAHARLVGNLTGHAPILLLDEIAAHLDEGRRAALFDLIDGLGGQAFMTGTDQTMFSALAD 428

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 429 RAQFFTVAD 437


>gi|48527207|gb|AAT45744.1| RecF [Rhizobium etli]
          Length = 374

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 180/369 (48%), Positives = 256/369 (69%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYAAASLSLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y  +TR+G+   FS FA ++GMEG  +I   +E  ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGHITRVGAAGGFSIFAALDGMEGEVEIGTGIEAGEETTARRLRINGTPAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL+P+MD +F+G S +RRRFLDR+V ++DP H RR  DFER MR RN+LL +G FD 
Sbjct: 121 RLLWLIPAMDGLFTGASSDRRRFLDRLVVSLDPAHGRRASDFERAMRSRNKLLDDGRFDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L+ L  E ++   FP   L L+GF+DG+F +  
Sbjct: 181 SWLAGIEEQMASLGIAMALARQEMLGLLTRLTEETLESSPFPSASLQLSGFMDGQFSRPS 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+++Y   L + R  D+ + RTL GPHR+DL+V + +KA+  A  STGEQK +LVG+ 
Sbjct: 241 VDLEDDYRVMLAESRYRDAGAGRTLEGPHRTDLVVHHREKAMEAARCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ N TG APILLLDEI+AHLDE++R ALF I+  +G Q FMTGTD+ +F +L +
Sbjct: 301 LAHARLVGNLTGHAPILLLDEIAAHLDENRRAALFDIIDGLGGQAFMTGTDRGMFTALGD 360

Query: 361 TAKFMRISN 369
            A+F  +++
Sbjct: 361 RAQFFTVAD 369


>gi|25453250|sp|Q8UJ65|RECF_AGRT5 RecName: Full=DNA replication and repair protein recF
          Length = 376

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/370 (50%), Positives = 253/370 (68%), Gaps = 1/370 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           MTN++ +  L +++FRNYA+  LV D +H +  GDNG GKTN+LEA+SFLSPGRG RRA 
Sbjct: 2   MTNKVSLSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLLEAVSFLSPGRGLRRAV 61

Query: 61  YADVTRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
            +DVTR+G+  + FS FA V+GM+G   I   +E   +   R L++N   ++ VDEL  H
Sbjct: 62  LSDVTRVGAEATGFSIFADVDGMDGEVAIGTGIEGDGEVVSRRLRLNGTPVKSVDELTDH 121

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           LR+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFE+ MRGRNRLL+EG FD
Sbjct: 122 LRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPGHGRRASDFEKAMRGRNRLLSEGRFD 181

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
             W   IE QMAELG+ + +AR EM+  L +LI        FP   LSL GF+D + ++ 
Sbjct: 182 PVWLDGIEKQMAELGISMAVARYEMLGLLKTLIEGRAGNAAFPSATLSLAGFMDDRLNRP 241

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L++EY   L DGR  D+ + RTL GPHR DL V + +K +     STGEQK +LVG+
Sbjct: 242 AVDLEDEYGLMLRDGRYRDAAAGRTLDGPHRVDLFVRHAEKNMEAERCSTGEQKALLVGL 301

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHA+L +N TG+AP+LLLDEI+AHLDE +R ALF ++  +G Q FMTGTD ++F +L 
Sbjct: 302 VLAHAQLTANMTGYAPVLLLDEIAAHLDEGRRAALFDLIHALGGQSFMTGTDAAMFSALG 361

Query: 360 ETAKFMRISN 369
           E A+F  +S+
Sbjct: 362 ERAQFFNVSH 371


>gi|159184149|ref|NP_353107.2| recombination protein F [Agrobacterium tumefaciens str. C58]
 gi|159139484|gb|AAK85892.2| recF-like protein [Agrobacterium tumefaciens str. C58]
          Length = 375

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/370 (50%), Positives = 253/370 (68%), Gaps = 1/370 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           MTN++ +  L +++FRNYA+  LV D +H +  GDNG GKTN+LEA+SFLSPGRG RRA 
Sbjct: 1   MTNKVSLSRLKLTDFRNYAAAALVLDERHVVLTGDNGSGKTNLLEAVSFLSPGRGLRRAV 60

Query: 61  YADVTRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
            +DVTR+G+  + FS FA V+GM+G   I   +E   +   R L++N   ++ VDEL  H
Sbjct: 61  LSDVTRVGAEATGFSIFADVDGMDGEVAIGTGIEGDGEVVSRRLRLNGTPVKSVDELTDH 120

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           LR+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFE+ MRGRNRLL+EG FD
Sbjct: 121 LRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPGHGRRASDFEKAMRGRNRLLSEGRFD 180

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
             W   IE QMAELG+ + +AR EM+  L +LI        FP   LSL GF+D + ++ 
Sbjct: 181 PVWLDGIEKQMAELGISMAVARYEMLGLLKTLIEGRAGNAAFPSATLSLAGFMDDRLNRP 240

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L++EY   L DGR  D+ + RTL GPHR DL V + +K +     STGEQK +LVG+
Sbjct: 241 AVDLEDEYGLMLRDGRYRDAAAGRTLDGPHRVDLFVRHAEKNMEAERCSTGEQKALLVGL 300

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHA+L +N TG+AP+LLLDEI+AHLDE +R ALF ++  +G Q FMTGTD ++F +L 
Sbjct: 301 VLAHAQLTANMTGYAPVLLLDEIAAHLDEGRRAALFDLIHALGGQSFMTGTDAAMFSALG 360

Query: 360 ETAKFMRISN 369
           E A+F  +S+
Sbjct: 361 ERAQFFNVSH 370


>gi|307319240|ref|ZP_07598669.1| DNA replication and repair protein RecF [Sinorhizobium meliloti
           AK83]
 gi|306895076|gb|EFN25833.1| DNA replication and repair protein RecF [Sinorhizobium meliloti
           AK83]
          Length = 374

 Score =  385 bits (988), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/369 (49%), Positives = 252/369 (68%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +S+FRNYA+L L  D +H +  G+NG GKTN++E +SFLSPGRG RRA+
Sbjct: 1   MPHKVFLTRLKLSDFRNYATLALDLDQRHVVLTGENGAGKTNLMEGVSFLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R+G+P  FS FA V+GMEG  +I    +  ++   R L+IN    R VDEL  HL
Sbjct: 61  YADVARVGAPDGFSVFAAVDGMEGSVEIGTGTQGTEEGQSRRLRINGTAARTVDELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  +F+R MR RNRLL+E   D 
Sbjct: 121 RVLWLTPAMDGLFTGPSADRRRFLDRLVLSLDPEHGRRASEFDRAMRSRNRLLSEFRPDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W S+IE +MA LG+ + +AR EM+  LS+L+        FP   LSL GFLD       
Sbjct: 181 AWLSAIEREMAGLGISMALARQEMLGLLSALVERSRSDGTFPSASLSLAGFLDDGAGIPA 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E Y   L +GR  D+ + RTL GPHRSDL++ + +K I     STGEQK +LVG+ 
Sbjct: 241 FELEERYLAMLAEGRARDAAAGRTLDGPHRSDLLIRHREKDIEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ + TG AP+LLLDEI+AHLD+ +R ALF +V  +G Q FMTGTD+++FD+L E
Sbjct: 301 LAHARLVGDMTGHAPVLLLDEIAAHLDQGRRAALFDLVDGLGGQSFMTGTDRAMFDALGE 360

Query: 361 TAKFMRISN 369
            A+++ ++N
Sbjct: 361 RAQYLAVAN 369


>gi|15963941|ref|NP_384294.1| recombination protein F [Sinorhizobium meliloti 1021]
 gi|307306353|ref|ZP_07586097.1| DNA replication and repair protein RecF [Sinorhizobium meliloti
           BL225C]
 gi|8475781|sp|P56903|RECF_RHIME RecName: Full=DNA replication and repair protein recF
 gi|15073116|emb|CAC41575.1| DNA repair protein [Sinorhizobium meliloti 1021]
 gi|306902195|gb|EFN32792.1| DNA replication and repair protein RecF [Sinorhizobium meliloti
           BL225C]
          Length = 374

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/369 (49%), Positives = 252/369 (68%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +S+FRNYA+L L  D +H +  G+NG GKTN++E +SFLSPGRG RRA+
Sbjct: 1   MPHKVFLTRLKLSDFRNYATLALDLDQRHVVLTGENGAGKTNLMEGVSFLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R+G+P  FS FA V+GMEG  +I    +  ++   R L+IN    R VDEL  HL
Sbjct: 61  YADVARVGAPDGFSVFAAVDGMEGSVEIGTGTQGTEEGQSRRLRINGTAARTVDELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  +F+R MR RNRLL+E   D 
Sbjct: 121 RVLWLTPAMDGLFTGPSADRRRFLDRLVLSLDPEHGRRASEFDRAMRSRNRLLSEFRPDP 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W S+IE +MA LG+ + +AR EM+  LS+L+        FP   LSL GFLD       
Sbjct: 181 AWLSAIEREMAGLGISMALARQEMLGLLSALVERSRSDGTFPSASLSLAGFLDDCAGIPA 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E Y   L +GR  D+ + RTL GPHRSDL++ + +K I     STGEQK +LVG+ 
Sbjct: 241 FELEERYLAMLAEGRARDAAAGRTLDGPHRSDLLIRHREKDIEAERCSTGEQKALLVGLV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ + TG AP+LLLDEI+AHLD+ +R ALF +V  +G Q FMTGTD+++FD+L E
Sbjct: 301 LAHARLVGDMTGHAPVLLLDEIAAHLDQGRRAALFDLVDGLGGQSFMTGTDRAMFDALGE 360

Query: 361 TAKFMRISN 369
            A+++ ++N
Sbjct: 361 RAQYLAVAN 369


>gi|218674981|ref|ZP_03524650.1| recombination protein F [Rhizobium etli GR56]
          Length = 354

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 243/351 (69%)

Query: 21  LRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVE 80
           + L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+Y D+TR+G+   FS FA ++
Sbjct: 1   MSLTLDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAAYGDITRVGATGGFSIFAALD 60

Query: 81  GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMER 140
           GMEG  +I   +E  ++ + R L+IN    +  DEL  HLR+ WL P+MD +F+G S +R
Sbjct: 61  GMEGEVEIGTGIEAGEETTTRRLRINGTAAKTADELTDHLRLLWLTPAMDGLFTGASSDR 120

Query: 141 RRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIA 200
           RRFLDR+V ++DP H RR  DFER MR RN+LL EG FD SW + IE QMA LG+ + +A
Sbjct: 121 RRFLDRLVLSLDPAHGRRASDFERAMRSRNKLLDEGRFDPSWLAGIEEQMASLGIAMALA 180

Query: 201 RVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSM 260
           R EM+  L+ LI E  +   FP   L L+GF+DG+F +    L++EYA  L + R  D+ 
Sbjct: 181 RQEMLGLLTRLIEERPENSPFPSASLQLSGFMDGQFSRPSVDLEDEYAAMLAESRYRDAG 240

Query: 261 SRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLD 320
           + RTL GPHR+DLIV + +KA+     STGEQK +LVG+ LAHARL+ N TG APILLLD
Sbjct: 241 AGRTLEGPHRADLIVHHREKAMEAERCSTGEQKALLVGLVLAHARLVGNLTGHAPILLLD 300

Query: 321 EISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQ 371
           EI+AHLDE +R ALF ++  +G Q FMTGTD+++F +L + A+F  +++ +
Sbjct: 301 EIAAHLDEGRRAALFDLIDGLGGQAFMTGTDRTMFSALADRAQFFTVADGK 351


>gi|325291519|ref|YP_004277383.1| recombination protein F [Agrobacterium sp. H13-3]
 gi|325059372|gb|ADY63063.1| recombination protein F [Agrobacterium sp. H13-3]
          Length = 375

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/370 (49%), Positives = 252/370 (68%), Gaps = 1/370 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           MTN++ +  L +++FRNYA+  L  D +H +  GDNG GKTN+LEA+SFLSPGRG RRA+
Sbjct: 1   MTNKVSLLRLKLTDFRNYAAASLALDDRHVVLTGDNGSGKTNLLEAVSFLSPGRGLRRAT 60

Query: 61  YADVTRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
            +DVTR+G+  + FS FA V+GM+G   I   +E   +   R L++N   ++ VDEL  H
Sbjct: 61  LSDVTRVGAEAAGFSIFADVDGMDGEVAIGTGIEGDGEVVSRRLRLNGTSVKSVDELTDH 120

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           LR+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  DFE+ MRGRNRLL+EG FD
Sbjct: 121 LRVLWLTPAMDGLFTGSSSDRRRFLDRLVLSLDPAHGRRASDFEKAMRGRNRLLSEGRFD 180

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
             W   IE QMAELG+ + +AR EM+  L SLI        FP   L+L+GF+D   ++ 
Sbjct: 181 PVWLDGIEKQMAELGISMALARYEMLGLLKSLIEGRSGNAAFPSAALALSGFMDDTLNRP 240

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L++EY   L +GR  D+ + RTL GPHR DL V + +K +     STGEQK +LVG+
Sbjct: 241 AVDLEDEYRLTLREGRYRDAAAGRTLDGPHRVDLFVRHAEKNMEAERCSTGEQKALLVGL 300

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHA+L +N TG AP+LLLDEI+AHLDE +R ALF ++  +G Q FMTGTD ++F +L 
Sbjct: 301 VLAHAQLTANMTGHAPVLLLDEIAAHLDEGRRAALFDLIHALGGQSFMTGTDAAMFSALG 360

Query: 360 ETAKFMRISN 369
           + A+F  +S+
Sbjct: 361 DRAQFFNVSH 370


>gi|222147250|ref|YP_002548207.1| recombination protein F [Agrobacterium vitis S4]
 gi|259563353|sp|B9JZ91|RECF_AGRVS RecName: Full=DNA replication and repair protein recF
 gi|221734240|gb|ACM35203.1| DNA replication and repair protein [Agrobacterium vitis S4]
          Length = 374

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/369 (49%), Positives = 248/369 (67%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M  +  I  L +++FRNY S  L  D +H +  G+NG GKTN++EA+SFLSPGRG RRA 
Sbjct: 1   MAEKTFINRLQLTDFRNYGSASLRLDGRHVVLTGNNGSGKTNLMEAVSFLSPGRGLRRAV 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
            +DV R G+ S FS FA +EGM G  ++    E  D+ +VR L+IN   +R VDEL  HL
Sbjct: 61  LSDVARAGAASGFSIFASLEGMAGDVELGTGSEVLDETAVRRLRINGASVRSVDELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S ERRRFLDR+V +IDP+H RR  DFER MR RN+LL+EG FD+
Sbjct: 121 RVLWLTPAMDGLFTGSSSERRRFLDRLVLSIDPQHGRRASDFERAMRSRNKLLSEGRFDA 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           SW + IE QMA LG+ + +AR EM+  L++LI +  + E FP   L L+GF+D     + 
Sbjct: 181 SWLAGIEQQMAALGIAMALARQEMMRLLAALIEQRREPETFPGADLMLSGFMDEHAGTAA 240

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L++ Y   L   R  D+ + RTL GPHRSDL+V + +K +     STGEQK +L+G+ 
Sbjct: 241 IDLEDTYRDSLAGSRGRDAAAGRTLEGPHRSDLLVRHREKDMEAERCSTGEQKALLIGLI 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHA L++  TGFAPILLLDEI+AHLDE +R ALF  +  +G Q FMTGTD  +F SL +
Sbjct: 301 LAHAELVATMTGFAPILLLDEIAAHLDEGRRAALFDRIDVLGGQAFMTGTDAQMFASLGD 360

Query: 361 TAKFMRISN 369
            A+F+ + +
Sbjct: 361 RAQFVTVDD 369


>gi|227824004|ref|YP_002827977.1| recombination protein F [Sinorhizobium fredii NGR234]
 gi|227343006|gb|ACP27224.1| DNA replication and repair protein, RecF [Sinorhizobium fredii
           NGR234]
          Length = 470

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/369 (49%), Positives = 253/369 (68%), Gaps = 1/369 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA+L L  D +H +  G+NG GKTN++EAISFLSPGRG RRA+
Sbjct: 98  MPHKVSLTRLKLTDFRNYAALSLELDQRHVVLTGENGAGKTNLMEAISFLSPGRGLRRAA 157

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R+G+   FS FA VEGM+G  +I       ++   R L++N    R VDEL  HL
Sbjct: 158 YADVARVGATDGFSVFAAVEGMDGPVEIGTGTAGAEEGQSRRLRLNGTPARTVDELTDHL 217

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  +F+R MR RNRLL+E   D 
Sbjct: 218 RVLWLTPAMDGLFTGPSSDRRRFLDRLVLSLDPEHGRRASEFDRAMRSRNRLLSEFRPDP 277

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W ++IE +MA LGV + +AR+EM+  L++L+ E  Q  +FP   LSL GFLD       
Sbjct: 278 AWLTAIEREMAGLGVSMALARLEMLGLLTALV-ERSQGGSFPSAGLSLAGFLDDCHGLPA 336

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E Y   L DGR  D+ + RTL GPHRSDL++ + +K +     STGEQK +LVG+ 
Sbjct: 337 YDLEERYLAMLSDGRGRDAAAGRTLDGPHRSDLLIRHREKDMEAERCSTGEQKALLVGLV 396

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ + TG AP+LLLDEI+AHLD+ +R ALF  V ++G Q FMTGTD+++F +L E
Sbjct: 397 LAHARLVGDMTGHAPVLLLDEIAAHLDQGRRAALFDRVDELGGQAFMTGTDRAMFTALGE 456

Query: 361 TAKFMRISN 369
            A ++ ++N
Sbjct: 457 RACYLTVAN 465


>gi|150398584|ref|YP_001329051.1| recombination protein F [Sinorhizobium medicae WSM419]
 gi|150030099|gb|ABR62216.1| DNA replication and repair protein RecF [Sinorhizobium medicae
           WSM419]
          Length = 409

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 184/369 (49%), Positives = 252/369 (68%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +S+FRNYA+  L  D +H +  G+NG GKTN++EAISFLSPGRG RRA+
Sbjct: 36  MPHKVFLTRLKLSDFRNYATAALDLDQRHVVLTGENGAGKTNLMEAISFLSPGRGLRRAA 95

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R+G+   FS FA V+GMEG  +I    +  ++   R L+IN    R VDELN HL
Sbjct: 96  YADVVRVGAADGFSVFAAVDGMEGPVEIGTGTQGSEEGHSRRLRINGTAARTVDELNDHL 155

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  +F+R MR RNRLL+E   D 
Sbjct: 156 RVLWLTPAMDGLFTGPSADRRRFLDRLVLSLDPEHGRRASEFDRAMRSRNRLLSEFRPDP 215

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W S+IE +MA LG+ + +AR EM+  LS+L+        FP  +LSL GFLD       
Sbjct: 216 AWVSAIEREMAGLGISMALARQEMLGLLSALVDRSRTDGTFPSARLSLAGFLDDCAGIPA 275

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E Y   L DGR  D+ + RTL GPHRSDL++ + +K I     STGEQK +LVG+ 
Sbjct: 276 FELEERYLAMLADGRARDAAAGRTLDGPHRSDLLIRHREKDIEAERCSTGEQKALLVGLV 335

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL+ + TG AP+LLLDEI+AHLD+ +R ALF +V  +G Q FMTGTD+++F++L E
Sbjct: 336 LAHARLVGDMTGHAPVLLLDEIAAHLDQGRRAALFDLVDGLGGQAFMTGTDQTMFEALGE 395

Query: 361 TAKFMRISN 369
            A ++ ++N
Sbjct: 396 RAHYLAVAN 404


>gi|163757765|ref|ZP_02164854.1| putative DNA replication and repair protein [Hoeflea phototrophica
           DFL-43]
 gi|162285267|gb|EDQ35549.1| putative DNA replication and repair protein [Hoeflea phototrophica
           DFL-43]
          Length = 382

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 172/374 (45%), Positives = 245/374 (65%), Gaps = 2/374 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M  ++ I+ L ++ FRNYAS  L  DA+H + VGDNG GKTN++EA+S LSPGRG RRA 
Sbjct: 1   MAQKVHIERLKLTGFRNYASQSLELDARHVVLVGDNGAGKTNLMEAVSLLSPGRGMRRAP 60

Query: 61  YADVTRIGS--PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
           Y+DV + GS   S FS FA +EGM G  DI   ++  ++   R ++IN    R  D++ +
Sbjct: 61  YSDVIKAGSEPASGFSIFASLEGMAGPVDIGTGVDGLEESGARKVRINGSPARSADDMLE 120

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
           HLR+ WL PSMD +F+G + +RRRFLDR+V ++DP H  R + +ER MR RNRLL+EG  
Sbjct: 121 HLRLLWLTPSMDGLFTGSAGDRRRFLDRLVLSVDPAHGSRALSYERAMRSRNRLLSEGRA 180

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
           D +W   +EAQM+ELGV + +AR E++  LS+LI +   +  FP   + L GFL+ +  +
Sbjct: 181 DPTWLDGLEAQMSELGVAMAMARSEVVRLLSALIDDSQAESPFPAASVRLEGFLEDEGLE 240

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +   ++  +   +  GR  D+ + RTL GPHR DL+V +  KA+  A  STGEQK +L+G
Sbjct: 241 TASDMEVAFIDLMKHGRGRDAAAGRTLSGPHRMDLVVHHRAKAMPAALSSTGEQKALLIG 300

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           I L HA+L+ + TG APILLLDE++AHLDE +R ALF ++  +  Q FMTGTD ++F SL
Sbjct: 301 IILGHAQLVRSLTGHAPILLLDEVAAHLDEGRRAALFDLIETLDCQAFMTGTDAAMFGSL 360

Query: 359 NETAKFMRISNHQA 372
               +   +S  +A
Sbjct: 361 GPRGQMFEVSEGRA 374


>gi|260461963|ref|ZP_05810208.1| DNA replication and repair protein RecF [Mesorhizobium
           opportunistum WSM2075]
 gi|259032210|gb|EEW33476.1| DNA replication and repair protein RecF [Mesorhizobium
           opportunistum WSM2075]
          Length = 377

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/370 (45%), Positives = 232/370 (62%), Gaps = 1/370 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M  +  I  L ++ FRNYA+L +       +F GDNG GKTN+LEAISFL+PGRG RRA 
Sbjct: 1   MPGQTHISKLTLTNFRNYAALAIDLAPGAVVFSGDNGAGKTNLLEAISFLTPGRGLRRAP 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R G    F+  AR++G +G  +I   +   D    R ++IN    R  +++ + L
Sbjct: 61  YADVARAGGDGGFALHARLDGPDGQVEIGTGISGGDSEGGRRVRINGATARSAEDMLEWL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G + +RRRFLDR+V AIDP H +R +D+E+ MRGRNRLLTE   D 
Sbjct: 121 RVVWLTPAMDTLFTGPAADRRRFLDRLVLAIDPGHGQRALDYEKAMRGRNRLLTENSRDD 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            W  +IE QMAE GV I  AR EM+  L+++I        FP   + L G L+ +   + 
Sbjct: 181 RWFEAIEIQMAETGVAIAAARAEMVRLLAAMIDRLPDSGPFPQADIGLAGDLEAEIAGTP 240

Query: 241 CA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E + + L DGR  D  + RTL GPHRSDL+V +  KA+     STGEQK +LVGI
Sbjct: 241 AVDVEERFRRALADGRDRDRAAGRTLEGPHRSDLLVRHRPKAMPAELCSTGEQKALLVGI 300

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L+HARL    +G  PILLLDEI+AHLD  +R ALF I+ ++  Q FMTGTD ++F SL 
Sbjct: 301 VLSHARLTGEVSGMTPILLLDEIAAHLDGGRRAALFSILEELNCQAFMTGTDAALFSSLQ 360

Query: 360 ETAKFMRISN 369
             A+F+ + +
Sbjct: 361 GRAQFLTVDH 370


>gi|13474646|ref|NP_106215.1| recombination protein F [Mesorhizobium loti MAFF303099]
 gi|20978640|sp|Q98BH1|RECF_RHILO RecName: Full=DNA replication and repair protein recF
 gi|14025401|dbj|BAB52001.1| RecF protein [Mesorhizobium loti MAFF303099]
          Length = 379

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 233/370 (62%), Gaps = 1/370 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M  +  I  L ++ FRNYA+L +       +F GDNG GKTN+LEAIS L+PGRG RRA 
Sbjct: 1   MPAQTHISKLTLTNFRNYAALAIDLAPGAVVFSGDNGAGKTNLLEAISLLTPGRGLRRAP 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R G    F+  AR++G +G  +I   +   +    R ++IN    R  +++ + L
Sbjct: 61  YADVAREGGDGGFALHARLDGPDGQVEIGTGISVGEGEGGRRVRINGATARSAEDMLEWL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G + +RRRFLDR+V AIDP H +R +D+E+ MRGRNRLLT+G  D 
Sbjct: 121 RVVWLTPAMDALFTGPAADRRRFLDRLVLAIDPGHGQRALDYEKAMRGRNRLLTDGSRDD 180

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            W  +IE QMAE GV I  AR E++  L+++I        FP   +SL+G L+ +   + 
Sbjct: 181 RWFEAIETQMAETGVAIAAARAELVRLLAAMIDRLPDTGPFPQADISLSGDLEAEVSSAP 240

Query: 241 CA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E + + L  GR  D  + RTL GPHRSDL+V +  KA+     STGEQK +LVGI
Sbjct: 241 AVDVEERFRRALAGGRDRDRAAGRTLEGPHRSDLLVRHRPKAMPAELCSTGEQKALLVGI 300

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L+HARL    +G  PILLLDEI+AHLD  +R ALF I+ ++  Q FMTGTD ++F SL 
Sbjct: 301 VLSHARLTGEMSGMTPILLLDEIAAHLDGGRRAALFSILEELNCQAFMTGTDAALFSSLM 360

Query: 360 ETAKFMRISN 369
             A+F+ + +
Sbjct: 361 GRAQFLTVDH 370


>gi|319779752|ref|YP_004139228.1| DNA replication and repair protein RecF [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317165640|gb|ADV09178.1| DNA replication and repair protein RecF [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 381

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 170/372 (45%), Positives = 234/372 (62%), Gaps = 3/372 (0%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M  +  I  L ++ FRNYA+L +       +F GDNG GKTN+LEAISFL+PGRG RRA 
Sbjct: 1   MPAQNHISKLTLTNFRNYAALTIDLAPGAVVFSGDNGAGKTNLLEAISFLTPGRGLRRAP 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRD--DRSVRCLQINDVVIRVVDELNK 118
           YADV R G    F+  AR++G +G  +I   +   D      R ++IN    R  +++ +
Sbjct: 61  YADVAREGGDGGFALHARLDGPDGQVEIGTGISGGDTAGEGGRRVRINGASARSAEDMLE 120

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
            LR+ WL P+MD +F+G + +RRRFLDR+V AIDP H +R ID+E+ MRGRNRLLTE   
Sbjct: 121 WLRVVWLTPAMDALFTGPAADRRRFLDRLVLAIDPGHGQRAIDYEKAMRGRNRLLTESSR 180

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
           D  W  +IE QMAE GV I  AR EM+  L+++I        FP   + L+G L+ +   
Sbjct: 181 DDRWFDAIETQMAETGVAIAAARAEMVRLLAAMIDRLPDTGPFPQADIGLSGELEAEIAV 240

Query: 239 SFCA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
           +    ++E + + L +GR+ D  + RTL GPHRSDL+V +  KA+     STGEQK +LV
Sbjct: 241 APAVDVEERFRRTLAEGRERDRAAGRTLDGPHRSDLVVRHRPKAMPAELCSTGEQKALLV 300

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
           GI L+HARL    +G  PILLLDEI+AHLD  +R ALF I+ ++  Q FMTGTD ++F S
Sbjct: 301 GIVLSHARLTGEMSGMTPILLLDEIAAHLDSGRRAALFSILEELNCQAFMTGTDAALFSS 360

Query: 358 LNETAKFMRISN 369
           L   A+F+ + +
Sbjct: 361 LQGRAQFLTVDH 372


>gi|225626554|ref|ZP_03784593.1| DNA replication and repair protein RecF [Brucella ceti str. Cudo]
 gi|260169593|ref|ZP_05756404.1| recombination protein F [Brucella sp. F5/99]
 gi|261759119|ref|ZP_06002828.1| DNA replication and repair protein recF [Brucella sp. F5/99]
 gi|225618211|gb|EEH15254.1| DNA replication and repair protein RecF [Brucella ceti str. Cudo]
 gi|261739103|gb|EEY27099.1| DNA replication and repair protein recF [Brucella sp. F5/99]
          Length = 384

 Score =  318 bits (815), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARTQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|294851413|ref|ZP_06792086.1| DNA replication and repair protein recF [Brucella sp. NVSL 07-0026]
 gi|294820002|gb|EFG37001.1| DNA replication and repair protein recF [Brucella sp. NVSL 07-0026]
          Length = 384

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 234/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R + IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVCINGIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIVAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|110632365|ref|YP_672573.1| recombination protein F [Mesorhizobium sp. BNC1]
 gi|110283349|gb|ABG61408.1| DNA replication and repair protein RecF [Chelativorans sp. BNC1]
          Length = 391

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 166/370 (44%), Positives = 225/370 (60%), Gaps = 4/370 (1%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           ++ I  L +S FRNYASL L       +  G+NG GKTN+LEAISFLSPGRG RRA+  +
Sbjct: 16  QVHIAKLTLSNFRNYASLSLGLQPGAVVLTGENGAGKTNLLEAISFLSPGRGLRRATLEE 75

Query: 64  VTRIGSPSFFSTFARVEGMEGLADI---SIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
             RIGS   F+  A VEG  G   I   +         S R ++I+    R  + +   L
Sbjct: 76  AMRIGSSDGFAVHAEVEGPYGSCRIGTGTAGTAAEGSESGRRVRIDGEPQRSAEAMLDWL 135

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL P+MD +F+G S +RRRFLDR+V AIDP H RR  D+E+ MR RNRL  +   D 
Sbjct: 136 RVIWLTPAMDALFTGASADRRRFLDRLVLAIDPAHGRRAADYEKAMRSRNRLFADDVRDD 195

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W  +IE QMAE GV I  AR EM+  L+++I        FP   L+L G +D    ++ 
Sbjct: 196 AWFDAIEMQMAETGVAIAAARAEMLRLLAAMIERLPAGSPFPKALLALEGTVDEAIARNP 255

Query: 241 CA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E++  +L + R  D  + R L GPHRS+L+V +  K +     STGEQK +LVG+
Sbjct: 256 AVEVEEDFRTRLREERPRDRAAGRALEGPHRSELLVRHAPKDMPAESCSTGEQKALLVGL 315

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHARL +  +G APILLLDEISAH D D+R ALF I+ D+  Q FMTGT++++F SL 
Sbjct: 316 VLAHARLTAELSGMAPILLLDEISAHFDADRRAALFDILEDLNCQAFMTGTERALFSSLE 375

Query: 360 ETAKFMRISN 369
             A+F+ +S 
Sbjct: 376 GRAQFLAVSG 385


>gi|114704369|ref|ZP_01437277.1| DNA replication and repair protein [Fulvimarina pelagi HTCC2506]
 gi|114539154|gb|EAU42274.1| DNA replication and repair protein [Fulvimarina pelagi HTCC2506]
          Length = 385

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/372 (44%), Positives = 234/372 (62%), Gaps = 4/372 (1%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M  + +I  L + +FRNY  L L F  +  +F G NG GKTN+LEA+S LSPGRG RRA 
Sbjct: 6   MGRQSEIGHLRLFDFRNYELLDLSFQKRFVVFAGPNGAGKTNLLEALSLLSPGRGLRRAP 65

Query: 61  YADVTRIGSPSFFSTFA--RVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
           Y ++ R G+ S FS  A  R+   E     S++L+     S R ++I++   +  +EL  
Sbjct: 66  YGEMARQGTQSGFSVKASVRIASEETTVVTSVRLDGEGPNS-RLVRIDETQAKSAEELLD 124

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
             RI WL P+MD +F+G + +RRRFLDRMV +IDP H RR  DFER MR RN+LL++   
Sbjct: 125 IARIVWLTPAMDGLFTGPAGDRRRFLDRMVLSIDPTHGRRASDFERAMRSRNKLLSDNRI 184

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLT-GFLDGKFD 237
           D  W + IE QMAELGV + +AR E++  L++ I        FP   L L+ GF +G  D
Sbjct: 185 DDRWLAGIEMQMAELGVAMAVARNELVANLTNAIALADPDLPFPKAGLVLSPGFEEGGLD 244

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
                +++ Y ++L   R  D+ + RTL GPHR+DL V +  K +     STGEQK +LV
Sbjct: 245 GPAVQVEDRYRERLARDRYRDAGAGRTLEGPHRADLEVTHLAKHMPAGLSSTGEQKALLV 304

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
           G+ +AHARL S  +G APILLLDEI+AHLD  +R +LF +V D+G Q FMTGTD+S+F++
Sbjct: 305 GLIIAHARLTSVLSGMAPILLLDEIAAHLDARRRASLFDLVGDLGGQTFMTGTDESLFEA 364

Query: 358 LNETAKFMRISN 369
           L + A+ + I++
Sbjct: 365 LGDRAQIITIAD 376


>gi|254718227|ref|ZP_05180038.1| recombination protein F [Brucella sp. 83/13]
 gi|265983183|ref|ZP_06095918.1| DNA replication and repair protein recF [Brucella sp. 83/13]
 gi|306839967|ref|ZP_07472761.1| DNA replication and repair protein RecF [Brucella sp. NF 2653]
 gi|264661775|gb|EEZ32036.1| DNA replication and repair protein recF [Brucella sp. 83/13]
 gi|306404931|gb|EFM61216.1| DNA replication and repair protein RecF [Brucella sp. NF 2653]
          Length = 384

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 236/372 (63%), Gaps = 4/372 (1%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
            +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y
Sbjct: 11  PDRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAY 70

Query: 62  ADVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
            DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + 
Sbjct: 71  DDVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYA 128

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           RI W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D 
Sbjct: 129 RILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDD 188

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QS 239
            W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++
Sbjct: 189 QWLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEA 248

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L+E++ + L DGR  D ++ RTL GPHR+DLIV +  K++  A  STGEQK +L+G+
Sbjct: 249 ALDLEEDFRRSLRDGRARDRVAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGL 308

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L 
Sbjct: 309 ILAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALA 368

Query: 360 ETAKFMRISNHQ 371
             A+F  +S  Q
Sbjct: 369 GDAQFFNVSAGQ 380


>gi|148560734|ref|YP_001258052.1| recombination protein F [Brucella ovis ATCC 25840]
 gi|148371991|gb|ABQ61970.1| recF protein [Brucella ovis ATCC 25840]
          Length = 384

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 236/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMDR+F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDRLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q F+TGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFITGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|254694809|ref|ZP_05156637.1| recombination protein F [Brucella abortus bv. 3 str. Tulya]
 gi|261215134|ref|ZP_05929415.1| DNA replication and repair protein recF [Brucella abortus bv. 3
           str. Tulya]
 gi|260916741|gb|EEX83602.1| DNA replication and repair protein recF [Brucella abortus bv. 3
           str. Tulya]
          Length = 384

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 169/371 (45%), Positives = 235/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   FS  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFSIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINRIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|239830849|ref|ZP_04679178.1| DNA replication and repair protein RecF [Ochrobactrum intermedium
           LMG 3301]
 gi|239823116|gb|EEQ94684.1| DNA replication and repair protein RecF [Ochrobactrum intermedium
           LMG 3301]
          Length = 384

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/368 (45%), Positives = 236/368 (64%), Gaps = 4/368 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EA+SFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAVSFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  S   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARTSSLDGFAIHAALDCMIYGEAEIGTGTAGGG-EGGRKVRINGIAASG-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+ER MR RNRLL++G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYERAMRSRNRLLSDGNGDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE+QMAELG  I  AR E +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIESQMAELGTAIAAARAEAMRLIAAMIERLPAEGPFPKADCFLEGTLEQRISVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  KA+  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLEGPHRTDLIVQHRPKAMPAALCSTGEQKALLIGLV 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++F++L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDTGRRAALFGILNELGGQAFMTGTDRALFEALEG 369

Query: 361 TAKFMRIS 368
            A+F  ++
Sbjct: 370 EAQFFNVA 377


>gi|23500919|ref|NP_697046.1| recombination protein F [Brucella suis 1330]
 gi|161617994|ref|YP_001591881.1| recombination protein F [Brucella canis ATCC 23365]
 gi|163842280|ref|YP_001626684.1| recombination protein F [Brucella suis ATCC 23445]
 gi|254705188|ref|ZP_05167016.1| recombination protein F [Brucella suis bv. 3 str. 686]
 gi|254707296|ref|ZP_05169124.1| recombination protein F [Brucella pinnipedialis M163/99/10]
 gi|254709165|ref|ZP_05170976.1| recombination protein F [Brucella pinnipedialis B2/94]
 gi|256030689|ref|ZP_05444303.1| recombination protein F [Brucella pinnipedialis M292/94/1]
 gi|256158693|ref|ZP_05456572.1| recombination protein F [Brucella ceti M490/95/1]
 gi|256254094|ref|ZP_05459630.1| recombination protein F [Brucella ceti B1/94]
 gi|256368468|ref|YP_003105974.1| recombination protein F [Brucella microti CCM 4915]
 gi|260567346|ref|ZP_05837816.1| DNA replication and repair protein recF [Brucella suis bv. 4 str.
           40]
 gi|261221234|ref|ZP_05935515.1| DNA replication and repair protein recF [Brucella ceti B1/94]
 gi|261314777|ref|ZP_05953974.1| DNA replication and repair protein recF [Brucella pinnipedialis
           M163/99/10]
 gi|261316662|ref|ZP_05955859.1| DNA replication and repair protein recF [Brucella pinnipedialis
           B2/94]
 gi|261755892|ref|ZP_05999601.1| DNA replication and repair protein recF [Brucella suis bv. 3 str.
           686]
 gi|265987734|ref|ZP_06100291.1| DNA replication and repair protein recF [Brucella pinnipedialis
           M292/94/1]
 gi|265997195|ref|ZP_06109752.1| DNA replication and repair protein recF [Brucella ceti M490/95/1]
 gi|306843605|ref|ZP_07476206.1| DNA replication and repair protein RecF [Brucella sp. BO1]
 gi|38258604|sp|Q8G3E5|RECF_BRUSU RecName: Full=DNA replication and repair protein recF
 gi|23346772|gb|AAN28961.1| recF protein [Brucella suis 1330]
 gi|161334805|gb|ABX61110.1| DNA replication and repair protein RecF [Brucella canis ATCC 23365]
 gi|163673003|gb|ABY37114.1| DNA replication and repair protein RecF [Brucella suis ATCC 23445]
 gi|255998626|gb|ACU47025.1| recombination protein F [Brucella microti CCM 4915]
 gi|260156864|gb|EEW91944.1| DNA replication and repair protein recF [Brucella suis bv. 4 str.
           40]
 gi|260919818|gb|EEX86471.1| DNA replication and repair protein recF [Brucella ceti B1/94]
 gi|261295885|gb|EEX99381.1| DNA replication and repair protein recF [Brucella pinnipedialis
           B2/94]
 gi|261303803|gb|EEY07300.1| DNA replication and repair protein recF [Brucella pinnipedialis
           M163/99/10]
 gi|261745645|gb|EEY33571.1| DNA replication and repair protein recF [Brucella suis bv. 3 str.
           686]
 gi|262551663|gb|EEZ07653.1| DNA replication and repair protein recF [Brucella ceti M490/95/1]
 gi|264659931|gb|EEZ30192.1| DNA replication and repair protein recF [Brucella pinnipedialis
           M292/94/1]
 gi|306276296|gb|EFM57996.1| DNA replication and repair protein RecF [Brucella sp. BO1]
          Length = 384

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|306842702|ref|ZP_07475345.1| DNA replication and repair protein RecF [Brucella sp. BO2]
 gi|306287148|gb|EFM58650.1| DNA replication and repair protein RecF [Brucella sp. BO2]
          Length = 384

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 235/372 (63%), Gaps = 4/372 (1%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
            +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y
Sbjct: 11  PDRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAY 70

Query: 62  ADVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
            DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + 
Sbjct: 71  DDVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYA 128

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           RI W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D 
Sbjct: 129 RILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDD 188

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QS 239
            W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++
Sbjct: 189 QWLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEA 248

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+
Sbjct: 249 ALDLEEDFRRSLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGL 308

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L 
Sbjct: 309 ILAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALA 368

Query: 360 ETAKFMRISNHQ 371
             A+F  +S  Q
Sbjct: 369 GDAQFFNVSAGQ 380


>gi|256060148|ref|ZP_05450330.1| recombination protein F [Brucella neotomae 5K33]
 gi|261324125|ref|ZP_05963322.1| DNA replication and repair protein recF [Brucella neotomae 5K33]
 gi|261300105|gb|EEY03602.1| DNA replication and repair protein recF [Brucella neotomae 5K33]
          Length = 384

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|17988224|ref|NP_540858.1| recombination protein F [Brucella melitensis bv. 1 str. 16M]
 gi|62288994|ref|YP_220787.1| recombination protein F [Brucella abortus bv. 1 str. 9-941]
 gi|82698935|ref|YP_413509.1| recombination protein F [Brucella melitensis biovar Abortus 2308]
 gi|189023271|ref|YP_001934039.1| recombination protein F [Brucella abortus S19]
 gi|225851549|ref|YP_002731782.1| recombination protein F [Brucella melitensis ATCC 23457]
 gi|237814484|ref|ZP_04593482.1| DNA replication and repair protein RecF [Brucella abortus str. 2308
           A]
 gi|254690320|ref|ZP_05153574.1| recombination protein F [Brucella abortus bv. 6 str. 870]
 gi|254696437|ref|ZP_05158265.1| recombination protein F [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731349|ref|ZP_05189927.1| recombination protein F [Brucella abortus bv. 4 str. 292]
 gi|256045793|ref|ZP_05448671.1| recombination protein F [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112512|ref|ZP_05453433.1| recombination protein F [Brucella melitensis bv. 3 str. Ether]
 gi|256258574|ref|ZP_05464110.1| recombination protein F [Brucella abortus bv. 9 str. C68]
 gi|256264942|ref|ZP_05467474.1| recombination protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|260546288|ref|ZP_05822028.1| recombination protein F [Brucella abortus NCTC 8038]
 gi|260563086|ref|ZP_05833572.1| recombination protein F [Brucella melitensis bv. 1 str. 16M]
 gi|260755859|ref|ZP_05868207.1| DNA replication and repair protein recF [Brucella abortus bv. 6
           str. 870]
 gi|260759082|ref|ZP_05871430.1| DNA replication and repair protein recF [Brucella abortus bv. 4
           str. 292]
 gi|260760808|ref|ZP_05873151.1| DNA replication and repair protein recF [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260884884|ref|ZP_05896498.1| DNA replication and repair protein recF [Brucella abortus bv. 9
           str. C68]
 gi|265992208|ref|ZP_06104765.1| DNA replication and repair protein recF [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265993948|ref|ZP_06106505.1| DNA replication and repair protein recF [Brucella melitensis bv. 3
           str. Ether]
 gi|297247411|ref|ZP_06931129.1| DNA replication and repair protein recF [Brucella abortus bv. 5
           str. B3196]
 gi|20978586|sp|Q8YED7|RECF_BRUME RecName: Full=DNA replication and repair protein recF
 gi|81309491|sp|Q57G08|RECF_BRUAB RecName: Full=DNA replication and repair protein recF
 gi|97180679|sp|Q2YPM3|RECF_BRUA2 RecName: Full=DNA replication and repair protein recF
 gi|17983989|gb|AAL53122.1| recf protein [Brucella melitensis bv. 1 str. 16M]
 gi|62195126|gb|AAX73426.1| RecF, recF protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615036|emb|CAJ09959.1| RecF protein:ATP/GTP-binding site motif A (P-loop):Aldehyde
           dehydrogenase:SMC protein, N-terminal:AAA ATPase
           [Brucella melitensis biovar Abortus 2308]
 gi|189018843|gb|ACD71565.1| recombination protein F [Brucella abortus S19]
 gi|225639914|gb|ACN99827.1| DNA replication and repair protein RecF [Brucella melitensis ATCC
           23457]
 gi|237789321|gb|EEP63531.1| DNA replication and repair protein RecF [Brucella abortus str. 2308
           A]
 gi|260096395|gb|EEW80271.1| recombination protein F [Brucella abortus NCTC 8038]
 gi|260153102|gb|EEW88194.1| recombination protein F [Brucella melitensis bv. 1 str. 16M]
 gi|260669400|gb|EEX56340.1| DNA replication and repair protein recF [Brucella abortus bv. 4
           str. 292]
 gi|260671240|gb|EEX58061.1| DNA replication and repair protein recF [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260675967|gb|EEX62788.1| DNA replication and repair protein recF [Brucella abortus bv. 6
           str. 870]
 gi|260874412|gb|EEX81481.1| DNA replication and repair protein recF [Brucella abortus bv. 9
           str. C68]
 gi|262764929|gb|EEZ10850.1| DNA replication and repair protein recF [Brucella melitensis bv. 3
           str. Ether]
 gi|263003274|gb|EEZ15567.1| DNA replication and repair protein recF [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263095427|gb|EEZ19028.1| recombination protein F [Brucella melitensis bv. 2 str. 63/9]
 gi|297174580|gb|EFH33927.1| DNA replication and repair protein recF [Brucella abortus bv. 5
           str. B3196]
 gi|326408014|gb|ADZ65079.1| recombination protein F [Brucella melitensis M28]
 gi|326537732|gb|ADZ85947.1| DNA replication and repair protein RecF [Brucella melitensis M5-90]
          Length = 384

 Score =  309 bits (792), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 235/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINRIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|49474938|ref|YP_032979.1| recombination protein F [Bartonella henselae str. Houston-1]
 gi|49237743|emb|CAF26935.1| DNA replication and repair protein recF [Bartonella henselae str.
           Houston-1]
          Length = 377

 Score =  308 bits (789), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 230/370 (62%), Gaps = 6/370 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ ++ L +  +RNY S  + F  QH +F G NG GKTN+LEA+SFLSPGRG RRA+Y+
Sbjct: 6   HKVAVRQLKLLRYRNYFSFNIRFSGQHVVFTGHNGSGKTNLLEALSFLSPGRGLRRAAYS 65

Query: 63  DVTRI-GSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           DV+   G    F  FAR+E  + G  +I   LE  D+   R + IN V     D L  + 
Sbjct: 66  DVSFANGGGEGFVVFARLECALYGEVNIGTALEMSDNS--RKVHINGVN-ETGDCLTDYC 122

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
            +S L PSMD +F+G S+ERRRFLDRMV AIDP H RR+ D++R+MR RNRL  +G  D 
Sbjct: 123 HMSILTPSMDGLFTGSSLERRRFLDRMVLAIDPLHSRRIADYDRVMRARNRLFLDGNEDC 182

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-S 239
           +W  ++E QMAEL   I+ AR+++I  L+ ++     +  FP   L + GFL+    + S
Sbjct: 183 AWFDALEKQMAELATAISAARIDVIRLLNDMLARTPSQLPFPRAFLQIDGFLEAALSKIS 242

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E++  +L   R +D  + RTL GPHR+DL V Y DK +  A  STGEQK +L G+
Sbjct: 243 AVEVEEQFCDRLQHNRAIDRAAGRTLEGPHRTDLQVFYADKNMAAASCSTGEQKALLTGL 302

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L HARL    +   PILLLDEI AHLD  +R ALF I+ D+G Q FMTGTD  +F++L 
Sbjct: 303 VLCHARLTGLMSERTPILLLDEIVAHLDSHRRAALFDILDDLGGQTFMTGTDPILFNALK 362

Query: 360 ETAKFMRISN 369
             A+F  I +
Sbjct: 363 GRAEFFAIKD 372


>gi|254700821|ref|ZP_05162649.1| recombination protein F [Brucella suis bv. 5 str. 513]
 gi|261751327|ref|ZP_05995036.1| DNA replication and repair protein recF [Brucella suis bv. 5 str.
           513]
 gi|261741080|gb|EEY29006.1| DNA replication and repair protein recF [Brucella suis bv. 5 str.
           513]
          Length = 384

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/372 (45%), Positives = 234/372 (62%), Gaps = 4/372 (1%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
            +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y
Sbjct: 11  PDRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAY 70

Query: 62  ADVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
            DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + 
Sbjct: 71  DDVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYA 128

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           RI W+VPSMD +F G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D 
Sbjct: 129 RILWVVPSMDGLFIGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDD 188

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QS 239
            W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++
Sbjct: 189 QWLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEA 248

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+
Sbjct: 249 ALDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGL 308

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L 
Sbjct: 309 ILAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALA 368

Query: 360 ETAKFMRISNHQ 371
             A+F  +S  Q
Sbjct: 369 GDAQFFNVSAGQ 380


>gi|118590458|ref|ZP_01547860.1| recombination protein F [Stappia aggregata IAM 12614]
 gi|118436921|gb|EAV43560.1| recombination protein F [Stappia aggregata IAM 12614]
          Length = 382

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/371 (43%), Positives = 234/371 (63%), Gaps = 9/371 (2%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L+++ FRNY++L L   A+   FVG NG GKTNILEAISFL+ GRG RRA+ AD+ 
Sbjct: 8   QLTRLSLTGFRNYSALTLPLTAKMAAFVGPNGAGKTNILEAISFLTAGRGLRRAALADIA 67

Query: 66  RIGSPSFFSTFARV--EGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           R G    +S  A V  +G E      +   T    S R ++I+   +R  + L  ++R+ 
Sbjct: 68  RKGGDGSWSVAATVLLDGFETRIGTGLVAGT----SGRKVRIDGEEVRGSESLLDYMRVL 123

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WLVPSMD +F+G   +RRRFLDR+  AIDP H RR+ DFE  +R RNRLL +G  D+ + 
Sbjct: 124 WLVPSMDGLFTGPGSDRRRFLDRLTLAIDPTHGRRVSDFENALRQRNRLLDQGGSDA-YL 182

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIM-EYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           S++E Q+AELG  ++IAR E ++ LS +I  +  Q   FPH  +SL G  + +      +
Sbjct: 183 SALEQQVAELGTAVSIARTETVDLLSRMIAGQATQDLPFPHASVSLEGAFEAETAGLSAS 242

Query: 243 LKEE-YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            +E+ Y + L DGR  D  + RTL GPH SDL V +  KA+  +  STGEQK +L+G+ L
Sbjct: 243 DREDRYRQMLQDGRHRDRAAGRTLNGPHLSDLTVFHAAKAMPASQSSTGEQKALLIGLIL 302

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHA L +  +G  P+LLLDE++AHLD D+R+ALF  +  +G Q+FMTGTD+++F++L   
Sbjct: 303 AHAELTAKVSGMTPVLLLDEVAAHLDPDRRSALFSKLDSLGGQVFMTGTDEALFEALPAE 362

Query: 362 AKFMRISNHQA 372
           A+   I  H+ 
Sbjct: 363 AEVFEIREHKG 373


>gi|254713411|ref|ZP_05175222.1| recombination protein F [Brucella ceti M644/93/1]
 gi|254716232|ref|ZP_05178043.1| recombination protein F [Brucella ceti M13/05/1]
 gi|261218005|ref|ZP_05932286.1| DNA replication and repair protein recF [Brucella ceti M13/05/1]
 gi|261321145|ref|ZP_05960342.1| DNA replication and repair protein recF [Brucella ceti M644/93/1]
 gi|260923094|gb|EEX89662.1| DNA replication and repair protein recF [Brucella ceti M13/05/1]
 gi|261293835|gb|EEX97331.1| DNA replication and repair protein recF [Brucella ceti M644/93/1]
          Length = 384

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 234/371 (63%), Gaps = 4/371 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y 
Sbjct: 12  DRVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYD 71

Query: 63  DVTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           DV R  +   F+  A ++ M  G A+I            R ++IN +     D+L  + R
Sbjct: 72  DVARANAEGGFAIHAALDCMIYGDAEIGTGTAGGG-EGGRKVRINGIAASA-DDLLDYAR 129

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           I W+V SMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  
Sbjct: 130 ILWVVSSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQ 189

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSF 240
           W  +IE QMAELG  I  AR + +  ++++I     +  FP     L G L+ +   ++ 
Sbjct: 190 WLDAIENQMAELGTAIAAARAQAMRLIAAMIERLPAEGPFPKADCFLEGALESRIGVEAA 249

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ 
Sbjct: 250 LDLEEDFRRTLRDGRARDRAAGRTLDGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLI 309

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++FD+L  
Sbjct: 310 LAHARLTAELSGMAPILLLDEIAAHLDMGRRAALFGILDELGGQAFMTGTDRALFDALAG 369

Query: 361 TAKFMRISNHQ 371
            A+F  +S  Q
Sbjct: 370 DAQFFNVSAGQ 380


>gi|153007350|ref|YP_001368565.1| recombination protein F [Ochrobactrum anthropi ATCC 49188]
 gi|151559238|gb|ABS12736.1| DNA replication and repair protein RecF [Ochrobactrum anthropi ATCC
           49188]
          Length = 387

 Score =  305 bits (782), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 168/367 (45%), Positives = 235/367 (64%), Gaps = 4/367 (1%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R+ I+ L +  FRNYA L L     H +  G+NG GKTN++EAISFLSPGRG RRA+Y D
Sbjct: 13  RVSIRRLKLVNFRNYAELSLPLGPGHVVLTGENGSGKTNLIEAISFLSPGRGLRRAAYDD 72

Query: 64  VTRIGSPSFFSTFARVEGM-EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           V R  S   F+  A ++ M  G A+I            R ++IN +     D L+ + RI
Sbjct: 73  VARANSLDGFAIHAALDCMIYGEAEIGTGTAGGG-EGGRKVRINGIAGSGDDMLD-YARI 130

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            W+VPSMD +F+G + +RRRFLDRMV AID  H +R++D+E+ MR RNRLL +G  D  W
Sbjct: 131 LWVVPSMDGLFTGGASDRRRFLDRMVLAIDTAHGKRVLDYEKAMRSRNRLLNDGSNDDQW 190

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD-QSFC 241
             +IE+QMAELG  I  AR E +  ++++I     +  FP     L G L+ + + ++  
Sbjct: 191 LDAIESQMAELGTAIAAARAEAMRLIAAMIERLPVEGPFPKADCFLEGTLEQRINVEAAL 250

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            L+E++ + L DGR  D  + RTL GPHR+DLIV +  K++  A  STGEQK +L+G+ L
Sbjct: 251 DLEEDFRRTLRDGRARDRAAGRTLEGPHRTDLIVQHRPKSMPAALCSTGEQKALLIGLVL 310

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHARL +  +G APILLLDEI+AHLD  +R ALF I+ ++G Q FMTGTD+++F++L   
Sbjct: 311 AHARLTAELSGMAPILLLDEIAAHLDTGRRAALFGILDELGGQAFMTGTDRALFEALEGE 370

Query: 362 AKFMRIS 368
           A+F  +S
Sbjct: 371 AQFFNVS 377


>gi|163867417|ref|YP_001608614.1| recombination protein F [Bartonella tribocorum CIP 105476]
 gi|161017061|emb|CAK00619.1| DNA replication and repair protein [Bartonella tribocorum CIP
           105476]
          Length = 377

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 166/370 (44%), Positives = 228/370 (61%), Gaps = 6/370 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ ++ L +  +RNY+   + F  QH +F G NG GKTN+LEA+SFLSPGRG RRA+Y+
Sbjct: 6   HKVSVRQLKLLRYRNYSFFNIHFSGQHVVFTGHNGAGKTNLLEALSFLSPGRGLRRAAYS 65

Query: 63  DVTRI-GSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           D++ I G    F  FA +E  + G   I   LE  D+   R + I D V    D L  + 
Sbjct: 66  DISFIDGGGEGFVVFACLECALYGEVKIGTALEVSDNS--RKVHI-DGVNEPSDCLTDYC 122

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
            IS L PSMD +F+G S+ERRRFLDRMV AIDP H RR+ D+++ MR RNRL  +G  D+
Sbjct: 123 HISILTPSMDGLFTGPSLERRRFLDRMVLAIDPLHSRRIADYDKTMRARNRLFLDGNEDN 182

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQS 239
           +W +++E QMAEL   I+ AR+++I  L+ +  +   +  FP   L + GFL+    D S
Sbjct: 183 AWFNALEKQMAELATAISAARIDVIRLLNDMFTQMPSQIPFPRAFLQIDGFLETALGDIS 242

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E++   L   R MD  + RTL GPHR+DL V Y DK       STGEQK +L G+
Sbjct: 243 ATEVEEQFCDLLRRNRAMDRAAGRTLEGPHRTDLQVFYADKNRAATSCSTGEQKALLTGL 302

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L HARL    +  APILLLDE++AHLD  +R ALF I+ D+  Q FMTGTD+ +FD L 
Sbjct: 303 VLCHARLTGMISQRAPILLLDEMAAHLDSHRRAALFDILDDLSVQTFMTGTDRLLFDDLK 362

Query: 360 ETAKFMRISN 369
             A+F  I +
Sbjct: 363 GRAEFFEIKD 372


>gi|240849791|ref|YP_002971179.1| DNA replication and repair protein RecF [Bartonella grahamii
           as4aup]
 gi|240266914|gb|ACS50502.1| DNA replication and repair protein RecF [Bartonella grahamii
           as4aup]
          Length = 377

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 166/370 (44%), Positives = 224/370 (60%), Gaps = 6/370 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ ++ L +  +RNY    + F  QH +F G NG GKTN+LEA+SFLSPGRG RRA+Y+
Sbjct: 6   HKVAVRQLKLLRYRNYPFFNIHFSGQHVVFTGHNGAGKTNLLEALSFLSPGRGLRRAAYS 65

Query: 63  DVTRIGSPSFFSTF-ARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           DV+ +          AR+E  + G   I   LE  D+   R + IN V     D L  + 
Sbjct: 66  DVSFVDGGGGGFVVFARLECALYGEVKIGTALEVSDNS--RKVHINGVN-ESGDCLTDYC 122

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
            IS L PSMD +F G S+ERR FLDRMV AIDP HRRR+ D++R MR RNRL  +G  D 
Sbjct: 123 HISVLTPSMDGLFIGPSLERRSFLDRMVLAIDPLHRRRIADYDRAMRARNRLFLDGNEDC 182

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-S 239
           +W  ++E QMAEL   I+ ARV++I  L+ +  +   +  FP   L + GFL+    + S
Sbjct: 183 AWFDALEKQMAELATAISAARVDVIRLLNDMFTQMPSQIPFPRAFLQIDGFLETALSEIS 242

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E++  +L   R MD  + RTL GPHR+DL V Y DK I     STGEQK +L G+
Sbjct: 243 AIEVEEKFCDRLRHNRAMDRAAGRTLEGPHRADLQVFYADKNIAATSCSTGEQKALLTGL 302

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L HARL    +  APILLLDE++AHLD  +R ALF I+ D+  Q FMTGTD+ +FD L 
Sbjct: 303 VLCHARLTGMMSEKAPILLLDEMAAHLDSHRRAALFDILDDLAVQTFMTGTDRLLFDDLK 362

Query: 360 ETAKFMRISN 369
             A+F  I +
Sbjct: 363 GRAEFFEIKD 372


>gi|319407988|emb|CBI81642.1| DNA replication and repair protein [Bartonella schoenbuchensis R1]
          Length = 390

 Score =  298 bits (764), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 230/370 (62%), Gaps = 6/370 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ ++ L ++ +RNY S  +    QH +F G NG GKTN+LEA+SFLSPGRG RRA+Y+
Sbjct: 9   HKVTVRQLKLTHYRNYCSFNIHLSGQHVVFTGHNGAGKTNLLEALSFLSPGRGLRRAAYS 68

Query: 63  DVT-RIGSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           D++   G  + F  FAR++  + G  +I   LET D  S R + IN V     D L  + 
Sbjct: 69  DISFSKGVGAAFVVFARLQCALYGEVNIGTTLETSD--SGRKVHINGVH-ESCDCLTDYC 125

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
            +S L PSMD +F G S++RRRFLDRMV AID  H RR+ D+++ MR RNRL  +G  + 
Sbjct: 126 HVSVLTPSMDGLFMGPSLDRRRFLDRMVLAIDSLHGRRIADYDKAMRARNRLFLDGNENC 185

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-S 239
           +W  ++EAQMAEL   I  ARV++I  L+ +  +      FP   L + GFL+      S
Sbjct: 186 AWFDALEAQMAELATAIAAARVDVIQLLNDMSEQTSSYTPFPRAFLQIDGFLEKALGTTS 245

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E++  +L   R +D  +RRTL GPHR+DL V Y DK I     STGEQK +L G+
Sbjct: 246 AIEVEEQFLDRLRRNRPIDCAARRTLEGPHRTDLQVFYADKNIAATSCSTGEQKALLTGL 305

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L HARL    +   PILLLDE++AHLD  +R ALF I+ D+GSQ FMTGTD+ +FDSL 
Sbjct: 306 VLCHARLTGMMSNMTPILLLDEMAAHLDSRRRAALFDILDDLGSQTFMTGTDRILFDSLK 365

Query: 360 ETAKFMRISN 369
             A+F  I +
Sbjct: 366 GRAEFFEIED 375


>gi|319898311|ref|YP_004158404.1| DNA replication and repair protein [Bartonella clarridgeiae 73]
 gi|319402275|emb|CBI75814.1| DNA replication and repair protein [Bartonella clarridgeiae 73]
          Length = 380

 Score =  296 bits (757), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 169/372 (45%), Positives = 230/372 (61%), Gaps = 10/372 (2%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ ++ L ++ +RNY SL L    QH +  G NG GKTN+LEA+SFLSPGRG RRA+Y+
Sbjct: 9   HKVAVRQLKLANYRNYCSLVLHLLGQHVVLTGRNGAGKTNLLEALSFLSPGRGLRRAAYS 68

Query: 63  DVT---RIGSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
           DV+   R G+   F  FAR+E  + G  +I   LE  D  S R + IN +     D L  
Sbjct: 69  DVSFSERKGAG--FVVFARLECALYGEVNIGTALEVND--SSRKVHINGIN-EASDCLTD 123

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
           +  IS L PSMDR+F+G S++RRRFLDRMV +ID  H RR+ D++R+MR RNRL  +   
Sbjct: 124 YCHISILTPSMDRLFTGPSLDRRRFLDRMVLSIDSLHGRRIADYDRVMRARNRLFLDRNN 183

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-D 237
           D +W  ++E QMAEL   I  AR+++I  L+ +  +      FP   L + GFL+    +
Sbjct: 184 DRAWLDALEVQMAELATAIAAARIDVIQLLNDMFAQTSSCIPFPRALLKVDGFLEKALRE 243

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            S   ++E++  +L   R +D  + RTL GPHR+DL V Y DK +     STGEQK +L 
Sbjct: 244 TSAIEVEEQFLHRLRKNRAIDCAAGRTLEGPHRTDLQVFYADKNMDATFCSTGEQKALLT 303

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
           G+ L HARL S  +  APILLLDEI+AH D  +R ALF I+ D+G Q FMTGTD  +FDS
Sbjct: 304 GLVLCHARLTSTISNMAPILLLDEIAAHFDSHRRAALFDILDDLGGQAFMTGTDHVLFDS 363

Query: 358 LNETAKFMRISN 369
           L   A+F  I N
Sbjct: 364 LKGRAEFFEIEN 375


>gi|90420504|ref|ZP_01228411.1| DNA replication and repair protein recF [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335232|gb|EAS48985.1| DNA replication and repair protein recF [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 407

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 226/367 (61%), Gaps = 2/367 (0%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +++FRNY +L L F     +FVGDNG GKTN+LEAIS L+PGRG RRA Y DV
Sbjct: 21  VRLDELRLADFRNYETLSLRFTRGFVVFVGDNGAGKTNLLEAISLLTPGRGLRRAPYQDV 80

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKL-ETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R G    FS  A    +     I+ K+       + R ++I++   +  DEL   LRI 
Sbjct: 81  ARKGGSGGFSVRANAASLGVETIIATKMMPDPAGAAARSVRIDETAAKSADELLDLLRIL 140

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P+MD +F+G + +RRRFLDRMV A+DP H RR  D+ER +R RNRLL +   D SW 
Sbjct: 141 WLTPAMDGLFTGPAGDRRRFLDRMVLAVDPTHGRRAADYERAVRSRNRLLADNRLDDSWL 200

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG-KFDQSFCA 242
           S IEAQMAELG+ + +AR E++  L+ +I        FP   L LT   DG    +    
Sbjct: 201 SGIEAQMAELGIAMALARSELVGMLAGMIARTGAGSPFPSAGLELTSGYDGLDLARPSAD 260

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++E   +L   R  D  + RTL G HR++L V +  KA+  A  STGEQK +L+G+ LA
Sbjct: 261 VEDEARMRLRSARYGDRAAGRTLEGAHRAELSVTHLAKAMPAALSSTGEQKALLIGLVLA 320

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HARL++  +   P+LLLDEI+AHLD  +R ALF ++ ++G Q FMTGTD S+F +L + A
Sbjct: 321 HARLVAAMSSLPPLLLLDEIAAHLDPGRRAALFDLIAELGVQAFMTGTDASLFAALGDRA 380

Query: 363 KFMRISN 369
           + M +S 
Sbjct: 381 QIMEVSG 387


>gi|254503692|ref|ZP_05115843.1| RecF/RecN/SMC N terminal domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222439763|gb|EEE46442.1| RecF/RecN/SMC N terminal domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 385

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 157/374 (41%), Positives = 228/374 (60%), Gaps = 9/374 (2%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L ++ FRNYA + +   A    FVG NG GKTNILEAISFL+ GRG RRA+  D+ 
Sbjct: 8   RLTRLTLTGFRNYAIMGIGLSAGMVAFVGANGAGKTNILEAISFLTAGRGLRRAALTDIA 67

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV--RCLQINDVVIRVVDELNKHLRIS 123
           R+G    +S  A++     L DI   L T     V  R ++I+   +R  + L  ++R+ 
Sbjct: 68  RVGGDGTWSVSAKIH----LDDIETSLGTGATAGVPGRKVRIDGEDMRSSESLLDYMRVL 123

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WLVPSMD +F+G   +RRRFLDR+  AIDP H RR+ DFE  +R RN+LL +G  D+ + 
Sbjct: 124 WLVPSMDGLFTGPGSDRRRFLDRLTLAIDPAHGRRVSDFENALRQRNKLLDQGGSDA-YL 182

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLI-MEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           S++E Q+A LG  ++ AR E +  L  +I    ++   FP   LSL G  + +      +
Sbjct: 183 SALELQVASLGTAVSFARQETVGLLKQMIDGRPIENTTFPQAMLSLEGTFEAETIGMSAS 242

Query: 243 LKEEYAKKLFD-GRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            +E++ ++L + GR  D  + RTL GPH SDL V +  K +  A  STGEQK +L+G+ L
Sbjct: 243 DQEDHYRRLLEQGRHRDRAAGRTLTGPHLSDLKVRHAAKDMPAAQSSTGEQKALLIGLVL 302

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHA L +  +G  P+LLLDE++AHLD D+R ALF  +  +G Q+FMTGTD S+FD+L   
Sbjct: 303 AHAELTAKVSGMTPVLLLDEVAAHLDPDRRAALFERLDALGGQVFMTGTDASLFDALPVH 362

Query: 362 AKFMRISNHQALCI 375
           ++   + N++A  I
Sbjct: 363 SEVFEVGNNEARLI 376


>gi|304392439|ref|ZP_07374380.1| DNA replication and repair protein RecF [Ahrensia sp. R2A130]
 gi|303295543|gb|EFL89902.1| DNA replication and repair protein RecF [Ahrensia sp. R2A130]
          Length = 391

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 228/377 (60%), Gaps = 19/377 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I  L +  FRNY +LRL+ D +H +  G+NG GKTN+LEAISFLSPGRG RR SY  V
Sbjct: 11  VAITTLKLDHFRNYDTLRLLCDHRHVVLTGENGSGKTNLLEAISFLSPGRGLRRTSYDQV 70

Query: 65  TRI-GSPS----FFSTFARVEGMEGLADISIKLETRDDRSV---RCLQINDVVIRVVDEL 116
            +  GS S     ++  A +E   G   I   L+ R    V   R + IN    R  ++L
Sbjct: 71  AKADGSDSPRSGTWAVHAELETPAGELTIGTGLQ-RGPNGVDGQRRISINGAPKRTSEDL 129

Query: 117 NKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG 176
            + LR+ WLVP+MD +F+G + +RRRFLDRMV AIDP H RR+ D+ER MR RN+LL E 
Sbjct: 130 LERLRVVWLVPAMDGLFTGAASDRRRFLDRMVLAIDPGHGRRVNDYERAMRSRNKLLDEN 189

Query: 177 YFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN---FPHIKLSLTGFLD 233
             D SW   IEAQ+AE G  I  AR E++  LS    ++   EN   FP  +L L G L+
Sbjct: 190 RIDDSWLGGIEAQLAEQGTAIAFARSELVGLLS----DHAAPENASPFPTARLLLEGALE 245

Query: 234 ---GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
               + + S   +++ +  +L   R  D  + RTL GPHRS+L V +  K +  A  STG
Sbjct: 246 EEIARGEGSAADVEDSFRDRLSANRYRDRAAGRTLEGPHRSNLAVIHAPKNMAAALCSTG 305

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           EQK +L G+ LAHA+L++  TG  P+LLLDE +AHLD  +R ALF ++  IG Q +MTGT
Sbjct: 306 EQKALLTGLVLAHAKLVAKLTGIPPVLLLDECAAHLDAQRRAALFDLIDTIGCQAWMTGT 365

Query: 351 DKSVFDSLNETAKFMRI 367
           D  +F++L + A++  +
Sbjct: 366 DAPLFEALGDRAQYFTV 382


>gi|319406519|emb|CBI80161.1| DNA replication and repair protein [Bartonella sp. 1-1C]
          Length = 370

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 226/368 (61%), Gaps = 6/368 (1%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ L +  +RNY SL L     H +  G NGVGKTN+LEA+SFLSPGRG RRA+Y+D+
Sbjct: 1   MAVRQLKLENYRNYCSLALHLLGHHVVLTGRNGVGKTNLLEALSFLSPGRGLRRAAYSDI 60

Query: 65  T-RIGSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           +   G  + F  FAR++  + G A+I   LE  D    R + IN V    +D L  +  I
Sbjct: 61  SCSEGGGTGFVVFARLQCTLYGEANIGTALEVND--GGRKVHINGVN-EAIDCLMDYCHI 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
           S L PSMD +F+G +++RRRFLDRMV +ID  H RR+ D++R+MR RNRL  +G  D  W
Sbjct: 118 SILTPSMDGLFTGPALDRRRFLDRMVLSIDSLHGRRIADYDRVMRARNRLFLDGNDDRVW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
             ++E QMAEL   I  ARV++I  L+ +  +      FP   L + G L+    + S  
Sbjct: 178 LDALEVQMAELATAIAAARVDVIQLLNDMFAQVSSCIPFPRAFLQVDGCLEKALREMSAI 237

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            ++E++  +L + R +D ++ RTL GPHR+DL V Y DK I     STGEQK +L G+ L
Sbjct: 238 EVEEQFLSRLRNNRAIDCVAGRTLEGPHRTDLKVFYADKNINATLCSTGEQKALLTGLVL 297

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
            HARL S  +   PILLLDEI+AH D  +R ALF I+ D+G Q FMTGTD  +FDSL   
Sbjct: 298 CHARLTSMISNMTPILLLDEIAAHFDSHRRAALFDILDDLGGQAFMTGTDHILFDSLKGR 357

Query: 362 AKFMRISN 369
           A+F  I N
Sbjct: 358 AEFFEIEN 365


>gi|319403603|emb|CBI77188.1| DNA replication and repair protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 370

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 224/368 (60%), Gaps = 6/368 (1%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ L +  +RNY SL L     H +F G NG GKTN+LEA+SFLSPGRG RRA+Y+D+
Sbjct: 1   MAVRQLKLENYRNYCSLVLHLLGHHVVFTGRNGAGKTNLLEALSFLSPGRGLRRAAYSDI 60

Query: 65  TRI-GSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           +   GS + F  FAR++  + G A+I   LE  D    R + IN V     D L  +  I
Sbjct: 61  SYSEGSGTGFVVFARLQCALYGEANIGTALEVND--GGRKVHINGVN-EASDCLMDYCHI 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
           S L PSMD +F G +++RRRFLDRMV +ID  H RR+ D++R+MR RNRL  +G  D  W
Sbjct: 118 SILTPSMDGLFIGPALDRRRFLDRMVLSIDSLHGRRIADYDRVMRARNRLFLDGNNDRVW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
             ++E QMAEL   I  ARV++I  L+    +      FP   L + GFL+    + S  
Sbjct: 178 LDALEVQMAELATAIAAARVDVIQLLNDTFAQVSSCVPFPRAFLQVDGFLEKALREMSAI 237

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            ++E++  +L + R +D ++ RTL GPHR+DL V Y DK +     STGEQK +L G+ L
Sbjct: 238 EVEEQFLNRLRNNRAIDCVAGRTLEGPHRTDLQVFYADKNMNATLCSTGEQKALLAGLVL 297

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
            HARL S  +   PI LLDEI+AH D  +R ALF I+ D+G Q FMTGTD  +FDSL   
Sbjct: 298 CHARLTSMISNMTPIFLLDEIAAHFDSHRRAALFDILDDLGGQAFMTGTDHILFDSLKGR 357

Query: 362 AKFMRISN 369
           A+F  I N
Sbjct: 358 AEFFEIEN 365


>gi|319405030|emb|CBI78640.1| DNA replication and repair protein [Bartonella sp. AR 15-3]
          Length = 370

 Score =  288 bits (737), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 166/368 (45%), Positives = 225/368 (61%), Gaps = 6/368 (1%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ L +  +RNY SL L    QH +  G NGVGKTN+LEA+SFLSPGRG RRA Y+D+
Sbjct: 1   MAVRQLKLENYRNYCSLALHLLGQHVVLTGRNGVGKTNLLEALSFLSPGRGLRRAPYSDI 60

Query: 65  T-RIGSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           +   GS + F  FAR++  + G A+I   LE  D    R + IN V     D L  +  I
Sbjct: 61  SCSEGSGTGFVVFARLQCALYGEANIGTALEAND--GGRKVHINGVN-EASDCLMDYCHI 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
           S L PSMD +F+G +++RRRFLDRMV +ID  H RR+ D++R+MR RNRL  +   D +W
Sbjct: 118 SILTPSMDGLFTGPALDRRRFLDRMVLSIDSLHGRRIADYDRVMRARNRLFLDRNDDRAW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-SFC 241
             ++E QMAEL   I  ARV++I  L+ +  +      FP   L + GFL+    + S  
Sbjct: 178 LDALELQMAELATAIAAARVDIIQLLNDMFAQVSAWIPFPRAFLQVDGFLEKALSETSAI 237

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            ++E++  +L + R +D  + R L GPHR+DL V Y DK +     STGEQK +L G+ L
Sbjct: 238 EVEEQFLYRLRNNRAIDCAAGRALEGPHRTDLQVFYADKNMDATFCSTGEQKALLTGLVL 297

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
            HARL S  +   PILLLDEI+AH D  +R ALF I+ D+G Q FMTGTD  +FDSL   
Sbjct: 298 CHARLTSTISKMTPILLLDEIAAHFDSHRRAALFDILDDLGGQAFMTGTDHILFDSLKGR 357

Query: 362 AKFMRISN 369
           A+F  I N
Sbjct: 358 AEFFEIEN 365


>gi|49473790|ref|YP_031832.1| recombination protein F [Bartonella quintana str. Toulouse]
 gi|49239293|emb|CAF25619.1| DNA replication and repair protein recF [Bartonella quintana str.
           Toulouse]
          Length = 377

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 166/370 (44%), Positives = 233/370 (62%), Gaps = 6/370 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ ++ L +  +RNY+S  + F  QH +F G NG GKTN+LEA+SFLSPGRG RRA+Y+
Sbjct: 6   HKVTVRQLRLVRYRNYSSFNIHFSGQHVVFTGHNGAGKTNLLEALSFLSPGRGLRRAAYS 65

Query: 63  DVTRIGSP-SFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           DV+   S  + F  FAR++  + G  DI    +  DD S R + IN V  +  D L  + 
Sbjct: 66  DVSFADSGNTGFVVFARLQCALYGEVDIGTAWDI-DDNS-RKVHINGVN-KTGDCLTDYC 122

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
            +S L PSMD +F+G S+ERRRFLDRMV AIDP H RR++D++R MR RNRL ++G  D 
Sbjct: 123 HMSVLTPSMDGLFTGSSLERRRFLDRMVLAIDPFHGRRIMDYDRAMRARNRLFSDGSEDR 182

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-S 239
           +W  ++E QMAEL   I  AR+++I  L+ +  +      FP   L + GFL+    + S
Sbjct: 183 AWFDALEKQMAELATAIAAARIDIIRLLNGMFAQAPVHTPFPRAFLQVDGFLETALSKAS 242

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++E++  +L   R +D  + RTL GPHR+DL + Y DK +  A  STGEQK ++ G+
Sbjct: 243 AIEVEEQFCDRLQHNRAIDRAAGRTLEGPHRTDLQIFYADKNMAAASCSTGEQKALVTGL 302

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L HARL    +  APILLLDEI AHLD  +R ALF ++ D+G Q FMTGTD  +FD+L 
Sbjct: 303 VLCHARLTGIMSERAPILLLDEIVAHLDSHRRAALFDLLDDLGGQTFMTGTDPILFDALK 362

Query: 360 ETAKFMRISN 369
             A+F  I +
Sbjct: 363 GRAEFFEIKD 372


>gi|328541627|ref|YP_004301736.1| DNA replication and repair protein recF [polymorphum gilvum
           SL003B-26A1]
 gi|326411379|gb|ADZ68442.1| DNA replication and repair protein recF [Polymorphum gilvum
           SL003B-26A1]
          Length = 377

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 158/380 (41%), Positives = 225/380 (59%), Gaps = 15/380 (3%)

Query: 1   MTNRIKIKF--LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRR 58
           M++R+ +    L +++FRNY+ L L   A     VGDNG GKTNILEAIS L+ GRG RR
Sbjct: 1   MSSRVSVAIERLTLTDFRNYSLLVLEPSAPLVALVGDNGAGKTNILEAISLLTAGRGLRR 60

Query: 59  ASYADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
           A+ AD+ R+  P  ++  A +    G  +  I        + R ++I+    R  + L  
Sbjct: 61  AALADIARLDGPGGWAISALLRTQAG--ETVIGTGYTPGEAGRRVRIDGTEARSSEALLD 118

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
           HLR+ WLVPSMD +F+G   ERRRFLDR+  ++DP H RR+ D+ER +R RNRLL EG  
Sbjct: 119 HLRVLWLVPSMDGLFTGPGSERRRFLDRLTLSLDPTHGRRVNDYERALRQRNRLLEEGG- 177

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLI-MEYVQKENFPHIKLSLTGFLDGKFD 237
            +++  SIE Q+AELG  + +AR E ++ L   I  +      FP   L++    DG+F+
Sbjct: 178 SAAYLDSIERQVAELGAAVALARGETVSLLQGCIDAQAATGLPFPRALLAV----DGEFE 233

Query: 238 ---QSFCALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
              Q   A   E    + L DGR  D  + RTL GPHRSDL+V +  K I  A  STGEQ
Sbjct: 234 VETQGLGASDREDRLRRMLRDGRTRDRAAGRTLCGPHRSDLVVQHAAKGIPAAQSSTGEQ 293

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           K +LVG+ LAHA L +   G  P+LLLDEI+AHLD  +R ALF  +  +  Q+ MTGTD 
Sbjct: 294 KALLVGLILAHADLTAAVAGMTPVLLLDEIAAHLDPGRRAALFSRLEALACQVVMTGTDA 353

Query: 353 SVFDSLNETAKFMRISNHQA 372
            +F+++   ++ + ++ ++A
Sbjct: 354 GLFEAMPAGSEILAVAGNRA 373


>gi|307942710|ref|ZP_07658055.1| DNA replication and repair protein RecF [Roseibium sp. TrichSKD4]
 gi|307773506|gb|EFO32722.1| DNA replication and repair protein RecF [Roseibium sp. TrichSKD4]
          Length = 379

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/370 (41%), Positives = 238/370 (64%), Gaps = 6/370 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L+++ FRNYASL L   AQ   FVG NG GKTNILEA+S+L+ GRG RRA+ AD+T
Sbjct: 8   RLNRLSLTNFRNYASLDLDLAAQLVAFVGANGTGKTNILEAVSYLTAGRGLRRANLADIT 67

Query: 66  -RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +      +S  ++V+  +GL D+SI    + + + R ++I+ V  R  D L  ++RI W
Sbjct: 68  CKQVQEGGWSVASKVD-QDGL-DVSIGTGLKQNEAGRRVRIDGVDQRTSDSLLDYVRILW 125

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L+P+MD +F+G   +RRRFLDR+  +++P H R++  FE+ +R RNRLL +G   +S+ +
Sbjct: 126 LIPAMDGLFTGPGSDRRRFLDRLTLSLNPAHGRQVSSFEKALRQRNRLLEQGG-SASYLT 184

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQ-KENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++E Q+AELG  + ++R E ++ L   + E  +    FP   L LTG  + + +    + 
Sbjct: 185 AVEQQVAELGTSVALSRRETVSLLQGTLSEQAELGLPFPIAGLELTGDFEAETEGLSASD 244

Query: 244 KEEYAKKLF-DGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +E++ +KL  DGR  D  + RTL GPH SDL V +  K +  +  STGEQK +L+G+ LA
Sbjct: 245 QEDHFRKLLEDGRPRDRAAGRTLTGPHLSDLHVRHTAKDMPASQSSTGEQKALLIGLILA 304

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA L ++ +G  PILLLDE++AHLD ++R ALF  +  +G Q+FMTGTD+S+F+SL   +
Sbjct: 305 HADLSASVSGLTPILLLDEVAAHLDPNRREALFARLDALGCQVFMTGTDESLFESLPIPS 364

Query: 363 KFMRISNHQA 372
           +   I + +A
Sbjct: 365 QIFAIEDGKA 374


>gi|121602459|ref|YP_989526.1| recombination protein F [Bartonella bacilliformis KC583]
 gi|120614636|gb|ABM45237.1| DNA replication and repair protein recF [Bartonella bacilliformis
           KC583]
          Length = 378

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 162/370 (43%), Positives = 225/370 (60%), Gaps = 6/370 (1%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ +  L ++ +RNY  L + F ++H +F G NG GKTN+LEA+SFL+PGRG RRA+Y+
Sbjct: 2   HRVAVTQLKLAHYRNYHFLNVNFSSRHVVFTGHNGAGKTNLLEALSFLAPGRGLRRAAYS 61

Query: 63  DVT-RIGSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           DV+   G    F  FAR++  + G   I   LE     S R L IN       D L  + 
Sbjct: 62  DVSCSRGEGEGFVVFARLQCALYGEVSIGTALEAGG--SNRRLHINGEN-EACDCLTDYC 118

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
            IS L PSMD +F G +++RRRFLDRMV AID  H RR+ D+++ MR RNRL  +G  D 
Sbjct: 119 HISALTPSMDGLFMGPTLDRRRFLDRMVLAIDSLHGRRIADYDKAMRARNRLFADGNDDR 178

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-S 239
           +W +++E QMAEL   I  AR++++  L+   ++      FP   L + G L+    + S
Sbjct: 179 AWFNALEMQMAELATAIAAARIDVVQLLNDTFVQMSASIPFPRAFLQIDGSLEEALRKMS 238

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              ++EE+  +L   R MD  + RTL GPHR+DL V Y DK +  A  STGEQK +L+G+
Sbjct: 239 AVDVEEEFLDRLRRNRAMDRAAGRTLEGPHRTDLQVFYADKNMAAASCSTGEQKALLIGL 298

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L HA L    +  API LLDE++AHLD  +R ALF I+ D+G Q FMTGTD+ +FDSL 
Sbjct: 299 VLCHAHLTGVMSNMAPIFLLDEMAAHLDFYRRAALFDILDDLGGQTFMTGTDRILFDSLK 358

Query: 360 ETAKFMRISN 369
             A+F  I +
Sbjct: 359 GRAEFFEIED 368


>gi|254472181|ref|ZP_05085581.1| DNA replication and repair protein [Pseudovibrio sp. JE062]
 gi|211958464|gb|EEA93664.1| DNA replication and repair protein [Pseudovibrio sp. JE062]
          Length = 376

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/369 (40%), Positives = 225/369 (60%), Gaps = 9/369 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +++FRNY++  +  +++   FVGDNG GKTNILEAISFLS GRG RRA+  D+
Sbjct: 7   VALSRLALTDFRNYSAASVELNSRMIAFVGDNGAGKTNILEAISFLSAGRGLRRATLGDI 66

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      ++  A ++G  G   I   L   +    R ++I+    R  + L ++LR+ W
Sbjct: 67  ARADGAGGWAVSAVLDGEYGETRIGTGLTAGEPG--RRVRIDGEEARSSEALLEYLRVLW 124

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVPSMD +F+G + +RR+FLDR+V +++P H R +  FE+ +R RNRLL+EG     +  
Sbjct: 125 LVPSMDGLFTGSASDRRKFLDRLVLSLNPSHGRMVASFEKALRQRNRLLSEGG-TPEFLD 183

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKE---NFPHIKLSLTG-FLDGKFDQSF 240
           +IEAQ+AELG  + +AR E ++ L+  +    QK+    FP  ++ L G F       S 
Sbjct: 184 AIEAQVAELGTAVALARSETVSLLAKTL--ETQKQLGLPFPSAEIHLQGAFETATIGMSA 241

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
              ++ Y + L +GR  D  + RTL GPHRSDL V + +K +  A  STGEQK +L+G+ 
Sbjct: 242 SDREDCYRELLVEGRFRDRAAGRTLDGPHRSDLYVVHSEKQMPAAQASTGEQKALLIGLV 301

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHA L S+ +G  PILLLDE++AHLD  +R ALF  +  +G Q+FMTGTD+++F  L  
Sbjct: 302 LAHADLTSSISGMTPILLLDEVAAHLDPGRREALFTRLEVLGGQVFMTGTDQNLFKDLPS 361

Query: 361 TAKFMRISN 369
            A+   +  
Sbjct: 362 AAQIFEVEG 370


>gi|115522033|ref|YP_778944.1| recombination protein F [Rhodopseudomonas palustris BisA53]
 gi|115515980|gb|ABJ03964.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           BisA53]
          Length = 379

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 211/369 (57%), Gaps = 6/369 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNYA+  L  +A   +  G NG GKTN LEAIS LSPGRG RRA+  D+ 
Sbjct: 5   RIHRLTLTHFRNYAAASLRVNADLVVLAGPNGAGKTNCLEAISLLSPGRGLRRATLDDIA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV----RCLQINDVVIRVVDELNKHLR 121
                  ++  A +EG  GLA +   ++ R D +     RC +I+   +        HLR
Sbjct: 65  DNQGDGSWAVSAEIEGALGLATLGTGIDPRGDEAASTTRRC-RIDRENVGSAAAFGDHLR 123

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WL P+MD +F G + ERRRF DR+V AID +H  R+   +R +R RNRLL +   D+ 
Sbjct: 124 MVWLTPAMDALFMGAASERRRFFDRLVLAIDSQHSARVSALDRSLRSRNRLLEQRSGDTH 183

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSF 240
           W  ++E + AEL V +   R E    L++ +        FP  +++L G+++G    +  
Sbjct: 184 WLDAVERETAELAVAVAAMRGETATRLAAALSARGAASPFPSAEIALDGWMEGALRSEPA 243

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
            A+++ Y   L DGR  D+ + RTL GPH +DL V Y  KA+     STGEQK +L+G+ 
Sbjct: 244 TAVEDRYRAILRDGRPRDAAAGRTLDGPHLTDLRVIYAPKAMPARDASTGEQKALLIGLI 303

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHA L++  TG  P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D + F  L  
Sbjct: 304 LAHAHLVAEMTGITPLLLLDEVVAHLDPSRRRALFEELAKLGAQVWMTGADPAAFVDLGA 363

Query: 361 TAKFMRISN 369
           + +   + N
Sbjct: 364 SGEMFEVDN 372


>gi|86747131|ref|YP_483627.1| recombination protein F [Rhodopseudomonas palustris HaA2]
 gi|86570159|gb|ABD04716.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           HaA2]
          Length = 378

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 210/367 (57%), Gaps = 3/367 (0%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNY +  L   A+  + VG NG GKTN LEAISFLSPGRG RRA+  DV 
Sbjct: 5   RITRLTLTHFRNYRAAVLTTSAERVVLVGANGAGKTNCLEAISFLSPGRGLRRATLDDVA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRIS 123
                  ++  A VEG  GLA +   ++    D  + R  +I+   +        HLR+ 
Sbjct: 65  DNEGDGSWAVAAEVEGALGLATLGTGIDPPRADAATSRRCRIDREPVGSATAFGDHLRMV 124

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P+MD +F G + ERRRF DR+V AID +H  R+   +R +R RNRLL   Y D+ W 
Sbjct: 125 WLTPAMDGLFMGAASERRRFFDRLVLAIDSQHSGRVSALDRSLRSRNRLLEVRYPDAHWL 184

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFCA 242
            +IE + AEL V +   R +    L++++        FP  K+ L G+++     +   A
Sbjct: 185 DAIERETAELAVAVAAMRGQTAMRLAAMLDARGAASAFPSAKIMLDGWMESALLTEPATA 244

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++ Y   L +GR  D+ + RTL GPH +DL V Y  KA+     STGEQK +L+G+ LA
Sbjct: 245 VEDRYRTILREGRPRDAAAGRTLDGPHLTDLEVVYAPKAMPARDASTGEQKALLIGLVLA 304

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA+L+S  TG  P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D + F  +   A
Sbjct: 305 HAQLVSEMTGITPLLLLDEVVAHLDPSRRAALFEELAKLGAQVWMTGADPAAFAEIGSGA 364

Query: 363 KFMRISN 369
           +   + +
Sbjct: 365 EIFTVES 371


>gi|148251630|ref|YP_001236215.1| recombination protein F [Bradyrhizobium sp. BTAi1]
 gi|146403803|gb|ABQ32309.1| DNA replication and repair protein RecF [Bradyrhizobium sp. BTAi1]
          Length = 378

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 144/359 (40%), Positives = 209/359 (58%), Gaps = 5/359 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FR+Y +  +   A     VG NG GKTN LEAISF +PGRG RRA+  DV 
Sbjct: 5   RINRLALTHFRSYRAASVSVQADMVALVGANGAGKTNCLEAISFFAPGRGLRRATLEDVA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLET-RDDRSV--RCLQINDVVIRVVDELNKHLRI 122
                  ++  A +EG  GLA     +E  R+D ++  RC +I+   +        H+R+
Sbjct: 65  DNQGDGSWAISAEIEGALGLATFGTGIEPPRNDAAIVRRC-RIDREPVGSAAAFGDHIRM 123

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P+MD +F G + ERRRF DR+V AID  H  R+   ER +R RNRLL    FD  W
Sbjct: 124 VWLTPAMDGLFMGAASERRRFFDRLVLAIDSEHSSRVSALERSLRSRNRLLEVRNFDDHW 183

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
           C +IE + AEL V +  +R +    L++++ +  Q   FP  +++L G+++     +   
Sbjct: 184 CDAIERETAELAVAVAASRGQTAVKLAAMLRQRGQASAFPSAEIALAGWMENALLTEPAL 243

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           A+++ Y   L D R  D+ + RTL GPH +DL V Y  K++     STGEQK +L+G+ L
Sbjct: 244 AVEDRYRALLRDNRARDAAAGRTLDGPHLTDLHVIYAPKSMPARDASTGEQKALLIGLIL 303

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           AHA L++ TTG  P+LLLDEI AHLD  +R ALF  +  +G+Q+++TG D + F  L E
Sbjct: 304 AHATLVAETTGIVPMLLLDEIVAHLDPGRRTALFAELGTLGAQVWLTGADPAAFAELRE 362


>gi|27375938|ref|NP_767467.1| recombination protein F [Bradyrhizobium japonicum USDA 110]
 gi|27349076|dbj|BAC46092.1| DNA replication and repair protein [Bradyrhizobium japonicum USDA
           110]
          Length = 378

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 207/354 (58%), Gaps = 5/354 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNY +  L   A     VG NG GKTN +EAISFLSPGRG RRA+  DV 
Sbjct: 5   RIHRLTLTHFRNYRAAGLETAADMVALVGPNGAGKTNCIEAISFLSPGRGLRRATLEDVA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLET-RDDRSV--RCLQINDVVIRVVDELNKHLRI 122
                  ++  A+VEG  GLA +   +E  R D +V  RC +I+   +        H+R+
Sbjct: 65  DNQGDGSWAVSAQVEGALGLATLGTGIEPPRADAAVSRRC-RIDREPVNSAAAFGDHIRM 123

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P+MD +F G + ERRRF DR+V AID  H  R+   ER +R RNRLL    +D  W
Sbjct: 124 VWLTPAMDGLFMGAASERRRFFDRLVLAIDSEHSSRINALERSLRSRNRLLETRNYDDHW 183

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
           C +IE + AEL V +   R +    L+ ++    Q   FP  +++L G+++     ++  
Sbjct: 184 CDAIERETAELAVAVAATRGQTAARLTGMLSARAQASAFPSAQIALDGWMENALLRETAT 243

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           ++++ Y + L D R  D+++ RT  GPH +DL V Y  K +     STGEQK +L+G+ L
Sbjct: 244 SVEDRYRQILRDNRPRDAIAGRTTDGPHLTDLQVIYAPKGMPARDASTGEQKALLIGLVL 303

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           AHA L++  TG  P+LLLDE+ AHLD ++R ALF  +  +G+Q+++TG D + F
Sbjct: 304 AHATLVAEMTGIVPLLLLDEVVAHLDPNRRAALFEELKKLGAQVWLTGADPAAF 357


>gi|90421531|ref|YP_529901.1| recombination protein F [Rhodopseudomonas palustris BisB18]
 gi|90103545|gb|ABD85582.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           BisB18]
          Length = 379

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 143/368 (38%), Positives = 207/368 (56%), Gaps = 5/368 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           KI  L ++ FRNY +  +       + VG NG GKTN LEAIS LSPGRG RRA+  D+ 
Sbjct: 5   KIHRLTLTHFRNYRAASVTVRGDVVVLVGPNGAGKTNCLEAISLLSPGRGLRRATLDDIA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV---RCLQINDVVIRVVDELNKHLRI 122
                  ++  A VEG  GLA +   ++ R + +    RC +I+   +        HLR+
Sbjct: 65  DNHGDGSWAVSAEVEGALGLATLGTGIDPRTEAAATTRRC-RIDRENVGSAAAFGDHLRM 123

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P+MD +F G + ERRRF DR+V AID +H  R+   +R +R RNRLL +   DS W
Sbjct: 124 VWLTPAMDGLFLGAASERRRFFDRLVLAIDSQHSSRVSALDRSLRSRNRLLEQRSHDSHW 183

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
             +IE + AEL V +   R E +  L++ + +      FP   ++L G+++     +   
Sbjct: 184 LDAIERETAELAVAVAAMRGETVTRLAAALAQRSADSAFPSATIALDGWMENALRSEPAT 243

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           A+++ Y   L D R  D+ + RTL GPH +DL V Y  K +     STGEQK +L+G+ L
Sbjct: 244 AVEDRYRTSLRDNRARDAAAGRTLDGPHLTDLRVIYTPKNMPARDASTGEQKALLIGLVL 303

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHA L++  TG  P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D + F  L E 
Sbjct: 304 AHAYLVAEMTGITPLLLLDEVVAHLDPSRRKALFGELARLGAQVWMTGADPAAFVDLGEG 363

Query: 362 AKFMRISN 369
            +   + N
Sbjct: 364 GELFEVDN 371


>gi|299133397|ref|ZP_07026592.1| DNA replication and repair protein RecF [Afipia sp. 1NLS2]
 gi|298593534|gb|EFI53734.1| DNA replication and repair protein RecF [Afipia sp. 1NLS2]
          Length = 383

 Score =  271 bits (694), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 205/354 (57%), Gaps = 4/354 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L++++FR+Y +  +       + VG NG GKTN LEAIS L+PGRG RRA + D+ 
Sbjct: 9   RILRLSLTQFRSYRAASVTTRGDLVVLVGPNGAGKTNCLEAISLLAPGRGLRRARFEDIA 68

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLET---RDDRSVRCLQINDVVIRVVDELNKHLRI 122
                  ++  A VEG  GLA +   ++     D  + R ++I+   +       +HLR+
Sbjct: 69  NRAGDGSWAVSAEVEGAGGLATLGTGIDAPTGEDGSAKRRIRIDREAVSSASAFGEHLRM 128

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL PSMD +F+G + ERRR  DR+V AID  H  R+   ER +R RNRLL +  FD+ W
Sbjct: 129 VWLTPSMDGLFTGPASERRRLFDRLVLAIDKDHSSRVSALERSLRSRNRLLEDRNFDAHW 188

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
           C +IE + AEL V +   R   +  LS+++        FP  +++L G+++     +   
Sbjct: 189 CEAIERETAELAVAVAAQRGHTLQRLSAMLAARGATSAFPSARITLDGWMENALMSEPAT 248

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           A+++ Y   L   R +D+ + RTL GPH +DL V Y  K +     STGEQK +L+G+ L
Sbjct: 249 AVEDHYRDILRKSRLLDAAAGRTLNGPHLTDLHVIYAPKEMPAKEASTGEQKALLIGLIL 308

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           AHA L++  TG  P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D + F
Sbjct: 309 AHASLVAEMTGIVPLLLLDEVVAHLDPRRRAALFDELATLGAQVWMTGADPAAF 362


>gi|91974485|ref|YP_567144.1| recombination protein F [Rhodopseudomonas palustris BisB5]
 gi|91680941|gb|ABE37243.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           BisB5]
          Length = 378

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 209/367 (56%), Gaps = 3/367 (0%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNY +  L    +  + VG NG GKTN LEAISFLSPGRG RRA+  DV+
Sbjct: 5   RITRLTLTHFRNYRAAALHTRGERVVLVGANGAGKTNCLEAISFLSPGRGLRRATLDDVS 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRIS 123
                  ++  A VEG  GLA +   ++    D  + R  +I+   +        HLR+ 
Sbjct: 65  DHQGDGSWAVSAEVEGALGLATLGTGIDPPRADAATTRRCRIDREPVGSATAFGDHLRMV 124

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P+MD +F G + ERRRF DR+V AID +H  R+   +R +R RNRLL E   D  W 
Sbjct: 125 WLTPAMDGLFMGAASERRRFFDRLVLAIDSQHSSRVSALDRSLRSRNRLLEERNADRHWL 184

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFCA 242
            +IE + AEL V +   R +    L++++        FP  K+ L G+++     +   A
Sbjct: 185 DAIERETAELAVAVAAMRGQTAARLAAMLDARGAASAFPSAKIMLDGWMESALLTEPATA 244

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++ Y   L DGR  D+ + RTL GPH +DL V Y  KA+     STGEQK +L+G+ LA
Sbjct: 245 VEDRYRAILRDGRLRDAAAGRTLDGPHLTDLQVIYAPKAMPARDASTGEQKALLIGLVLA 304

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA+L+S  TG  P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D + F  +   A
Sbjct: 305 HAQLVSEITGITPLLLLDEVVAHLDPARRRALFAELERLGAQVWMTGADPAGFAEIGPDA 364

Query: 363 KFMRISN 369
           +   + +
Sbjct: 365 EIFTVES 371


>gi|154250461|ref|YP_001411285.1| DNA replication and repair protein RecF [Parvibaculum
           lavamentivorans DS-1]
 gi|154154411|gb|ABS61628.1| DNA replication and repair protein RecF [Parvibaculum
           lavamentivorans DS-1]
          Length = 412

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 220/370 (59%), Gaps = 4/370 (1%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
           + R ++  L +++FR+YA   L  D +  +  G+NG GKTN+LEA+S LSPGRG R A+Y
Sbjct: 30  SPRARLSRLVVTDFRSYARAELALDGRPVVLTGENGAGKTNLLEAVSLLSPGRGLRGAAY 89

Query: 62  ADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQIN-DVVIRVVDELNKHL 120
           A++ R      ++  A +E   G   +   +E     S R   +  D        L  HL
Sbjct: 90  AEIARDNGEGGWAVAATLEAEHGPVRLGTGIEPGMAPSSRSRSVRIDGEPAGPSALAAHL 149

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           RI WL P+MDR+F   + ERRRFLDR+V   DP H  R   +ER +R R++LL +  FD 
Sbjct: 150 RIVWLTPAMDRLFVEGASERRRFLDRLVMGFDPAHGTRAAAYERALRERSKLLADDVFDD 209

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W S +E+QMAE GV +  AR+E++  L    ++   +  FP   ++L G L+    ++ 
Sbjct: 210 AWLSGLESQMAEHGVALAAARLEIVARLRG-ALDVAPEGPFPRAHVALEGSLETALAEAA 268

Query: 241 CA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              +++ +  +L + R  D+ + R L GPHRSDL+V +  K       STGEQK +L+GI
Sbjct: 269 AVDVEDGFRARLAEMRGRDAAAGRALDGPHRSDLLVRHTAKDREARQCSTGEQKALLIGI 328

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA+ARL++   G AP+LLLDE++AHLD  +R ALF  +  +G Q FMTGTD S+F++L 
Sbjct: 329 VLANARLLA-AMGRAPLLLLDEVAAHLDAGRRAALFDEIVSLGLQAFMTGTDPSLFETLG 387

Query: 360 ETAKFMRISN 369
           E A+ +R+++
Sbjct: 388 ERAQDLRVAH 397


>gi|39933083|ref|NP_945359.1| recombination protein F [Rhodopseudomonas palustris CGA009]
 gi|39652708|emb|CAE25447.1| putative RecF protein [Rhodopseudomonas palustris CGA009]
          Length = 388

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 204/370 (55%), Gaps = 4/370 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNY    L   A   + VG NG GKTN LEAISFLSPGRG RRA+  DV 
Sbjct: 14  RITRLTLTHFRNYRGASLTTTADQVVLVGPNGAGKTNCLEAISFLSPGRGLRRATLEDVA 73

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRIS 123
                  ++    +EG  GLA +   +E    D  + R  +I+   +        HLR+ 
Sbjct: 74  NHEGDGSWAVSTEIEGALGLATLGTGIEPPRGDTTTTRRCRIDREPVGSAAAFGDHLRMV 133

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSW 182
           WL PSMD +F G + ERRRF DR+V AID  H  R+   +R +R RNRLL +    DS W
Sbjct: 134 WLTPSMDGLFMGAASERRRFFDRLVLAIDSGHSARVSALDRSLRSRNRLLEDVRNADSHW 193

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
             +IE + AEL + +   R +    L++++        FP  KL L G+++     +   
Sbjct: 194 LDAIERETAELAIAVAAQRGQTALKLAAMLDARGATSAFPSAKLMLDGWMENALTSEPAT 253

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           A+++ Y   L D R  D+ + RTL GPH +DL V Y  KA+     STGEQK +L+G+ L
Sbjct: 254 AVEDRYRAILRDSRGRDAAAGRTLDGPHLTDLEVIYAPKAMPARDASTGEQKALLIGLVL 313

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHA+L++ TT   P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D   F  +   
Sbjct: 314 AHAQLVAETTSITPLLLLDEVVAHLDPGRREALFTELGKLGAQVWMTGADPMAFAEIGPA 373

Query: 362 AKFMRISNHQ 371
           A    + N Q
Sbjct: 374 AGIFDVENGQ 383


>gi|146337178|ref|YP_001202226.1| recombination protein F [Bradyrhizobium sp. ORS278]
 gi|146189984|emb|CAL73976.1| DNA replication and repair protein recF [Bradyrhizobium sp. ORS278]
          Length = 378

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 145/359 (40%), Positives = 206/359 (57%), Gaps = 5/359 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L+++ FR+Y +  +   A     VG NG GKTN LEAISF +PGRG RRA+  DV 
Sbjct: 5   RINRLSLTHFRSYRAAGVSVQADMVALVGANGAGKTNCLEAISFFAPGRGLRRATLEDVA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLET-RDDRSV--RCLQINDVVIRVVDELNKHLRI 122
                  ++  A +EG  GLA     +E  R D S   RC +I+   +        H+R+
Sbjct: 65  DNQGDGSWAISAEIEGALGLATFGTGIEPPRGDASTTRRC-RIDREPVGSAAAFGDHIRM 123

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL PSMD +F G + ERRRF DR+V AID  H  R+   ER +R RNRLL    FD  W
Sbjct: 124 VWLTPSMDGLFMGAASERRRFFDRLVLAIDSEHSSRVSALERSLRSRNRLLEVRNFDDHW 183

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
           C +IE + AEL V +  +R +    L++++ +      FP  +++L G+++     +   
Sbjct: 184 CDAIERETAELAVAVAASRGQTAVKLAAMLRQRGAASAFPSAEIALDGWMENALLTEPAL 243

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           A+++ Y   L D R  D+ + RTL GPH +DL V Y  K +     STGEQK +L+G+ L
Sbjct: 244 AVEDRYRALLRDNRARDAAAGRTLDGPHLTDLHVIYAPKNMPARDASTGEQKALLIGLIL 303

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           AHA L++ TTG  P+LLLDEI AHLD  +R ALF  +  +G+Q+++TG D + F  L E
Sbjct: 304 AHATLVAETTGIVPMLLLDEIVAHLDPGRRTALFAELGTLGAQVWLTGADPAAFAELRE 362


>gi|192288436|ref|YP_001989041.1| recombination protein F [Rhodopseudomonas palustris TIE-1]
 gi|192282185|gb|ACE98565.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           TIE-1]
          Length = 379

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 146/368 (39%), Positives = 204/368 (55%), Gaps = 4/368 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNY    L   A   + VG NG GKTN LEAISFLSPGRG RRA+  DV 
Sbjct: 5   RITRLTLTHFRNYRGASLTTTADQVVLVGPNGAGKTNCLEAISFLSPGRGLRRATLEDVA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRIS 123
                  ++  A VEG  GLA +   +E    D  + R  +I+   +        HLR+ 
Sbjct: 65  NHEGDGSWAVSAEVEGALGLATLGTGIEPPRGDTPTTRRCRIDREPVGSAAAFGDHLRMV 124

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSW 182
           WL PSMD +F G + ERRRF DR+V AID  H  R+   +R +R RNRLL +    DS W
Sbjct: 125 WLTPSMDGLFMGAASERRRFFDRLVLAIDSGHSARVSALDRSLRSRNRLLEDIRNADSHW 184

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
             +IE + AEL + +   R +    L++++        FP  KL L G+++     +   
Sbjct: 185 LDAIERETAELAIAVAAQRGQTALKLAAMLDARGATSAFPSAKLMLDGWMENALTSEPAT 244

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
           A+++ Y   L D R  D+ + RTL GPH +DL V Y  KA+     STGEQK +L+G+ L
Sbjct: 245 AVEDRYRAILRDSRGRDAAAGRTLDGPHLTDLEVIYAPKAMPARDASTGEQKALLIGLVL 304

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHA+L++ TT   P+LLLDE+ AHLD  +R ALF  +  +G+Q++MTG D   F  +   
Sbjct: 305 AHAQLVAETTSITPLLLLDEVVAHLDPGRREALFTELGKLGAQVWMTGADPMAFAEIGPA 364

Query: 362 AKFMRISN 369
           A    + +
Sbjct: 365 AGIFDVES 372


>gi|158422636|ref|YP_001523928.1| recombination protein F [Azorhizobium caulinodans ORS 571]
 gi|158329525|dbj|BAF87010.1| DNA replication and repair protein [Azorhizobium caulinodans ORS
           571]
          Length = 378

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 138/364 (37%), Positives = 215/364 (59%), Gaps = 4/364 (1%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R +++ L +S FR+Y++ ++       +  G NG GKTNILEA+S LSPGRG RRA+   
Sbjct: 5   RARVRRLTLSRFRSYSAAQIEVADGPVVLTGPNGAGKTNILEAVSLLSPGRGLRRAALDA 64

Query: 64  VTRIGSPSFFSTFARVEGMEGLADISIKLE-TRDDRSVRCLQINDVVIRVVDELNKHLRI 122
             + G    ++  A VEG  G  D+    + +R D S R  +I+   +   +    HL++
Sbjct: 65  FAQAGGDGSWAVAAHVEGALGPVDLGTGSDASRPDGSTRRCRIDRESVSSANAFLDHLKV 124

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P MD +F+G   +RRRFLDR+V A+D  H  R+   ER +R RNR+L +G  D+  
Sbjct: 125 VWLTPEMDGLFTGPPADRRRFLDRLVLAVDASHGTRVNALERALRSRNRVLEDGG-DNRM 183

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYV-QKENFPHIKLSLTGFLDGKF-DQSF 240
            S++E ++AELGV +  AR+E +  L+  I  +  +   FPH  ++L G L+    D   
Sbjct: 184 LSAVEHELAELGVAVAAARLETVQRLAGEIAAHADETSPFPHADIALDGALERMLTDAPA 243

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +++ Y   L D R  D  + RTL GPH  DL+V +  K +  A  STGEQK +L+G+ 
Sbjct: 244 VEVEDRYRALLQDNRPRDRAAGRTLEGPHLCDLVVAHGPKGLPAARCSTGEQKSLLIGLA 303

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           L+HARL++   G AP++LLD++ A+LD ++R+ +F  +  +G+Q++MTG D S F +L+ 
Sbjct: 304 LSHARLVTAMQGLAPVVLLDDVVAYLDAERRSGMFAALKALGAQVWMTGADPSAFAALDG 363

Query: 361 TAKF 364
             +F
Sbjct: 364 AERF 367


>gi|288959568|ref|YP_003449909.1| DNA replication and repair protein [Azospirillum sp. B510]
 gi|288911876|dbj|BAI73365.1| DNA replication and repair protein [Azospirillum sp. B510]
          Length = 394

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 216/371 (58%), Gaps = 10/371 (2%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ + ++ FR Y S+RL  D +    +G NG GKTN+LEA+SFL+PGRG R A  A+V R
Sbjct: 20  VRRMTLTRFRGYDSVRLEPDHRPVALIGPNGAGKTNLLEAVSFLAPGRGLRGARLAEVER 79

Query: 67  IGSP--SFFSTFARVEGMEGLADISIKLETRD-----DRSVRCLQINDVVIRVVDELNKH 119
           +GSP  + ++  A ++   G  +I    E  D     DR  R ++I+    +    L +H
Sbjct: 80  LGSPPGAGWAVAATLDTPLGPVEIGTGREPHDGNRASDRDRRLVRIDGHPAKGQTALAEH 139

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           + + WL P MDR+F   +  RRRFLDR+VF  DP H  R+  +E  +R R RLL +G FD
Sbjct: 140 VAMVWLTPQMDRLFLEGASGRRRFLDRLVFGFDPAHAGRLSRYEHALRERARLLRDGRFD 199

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
             W  ++E QMA  G+ +  AR E++  L +     +    FP   L++ G ++   D+ 
Sbjct: 200 EGWLGALEDQMATTGIAVAAARREVVQRLRAACARSIGP--FPAADLAVAGTVERWLDEG 257

Query: 240 FCALKEEYAK-KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
                E+  +  L  GR+ D+      +GPH+SDL V +  K +  A  STGEQK +L+ 
Sbjct: 258 PALAAEDSLRDSLRLGRRADADGGGATLGPHKSDLAVRHAPKDMPAALCSTGEQKALLIA 317

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           I LA+ARL++   G APILLLDE++AHLD ++R ALF  +  +G+Q +MTGTD+ +F+ L
Sbjct: 318 IVLANARLLAAERGAAPILLLDEVAAHLDPERRAALFGEILALGAQAWMTGTDEGIFNPL 377

Query: 359 NETAKFMRISN 369
            E A+  RI +
Sbjct: 378 GEDARRFRIED 388


>gi|75674202|ref|YP_316623.1| recombination protein F [Nitrobacter winogradskyi Nb-255]
 gi|74419072|gb|ABA03271.1| DNA replication and repair protein RecF [Nitrobacter winogradskyi
           Nb-255]
          Length = 385

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 137/367 (37%), Positives = 211/367 (57%), Gaps = 6/367 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +++ L+++ FRNY +      +   + VG NG GKTN LEAIS LSPGRG RRA+  D+ 
Sbjct: 9   RVRRLSLTHFRNYRAATFETRSNMIVLVGPNGAGKTNCLEAISLLSPGRGLRRATRDDIA 68

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV----RCLQINDVVIRVVDELNKHLR 121
                  ++  A ++G  GLA +   ++   + +     RC +I+   +        HLR
Sbjct: 69  DNTGDGSWAVSAEMQGALGLATLGTGIDAPGNEAAPSGRRC-RIDREPVASAAAFGDHLR 127

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WL PSMD +F+G + +RRRFLDR+V AID  H  R+   ER +R RNRLL   + D  
Sbjct: 128 MVWLTPSMDGLFTGPASDRRRFLDRLVLAIDSEHSGRVSALERSLRSRNRLLEMRHHDDL 187

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSF 240
           WC +IE + AEL V +   R + +  L++ +       +FP   + L G+++     +  
Sbjct: 188 WCEAIERKTAELAVAVAAMRAQTVTRLTAALEARGGGSSFPAASIHLDGWMENALLTEPA 247

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +++ Y + L   R  D+ + RTL GPH +DL V Y  K +     STGEQK +L+G+ 
Sbjct: 248 TVVEDRYREILRASRPRDAAAGRTLEGPHLTDLEVIYAPKNMPAKEASTGEQKALLIGLV 307

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHARL++  TG  P+LLLDE+ AHLD D+R ALF  +  +G+Q++M+G D + F +L+ 
Sbjct: 308 LAHARLVAEMTGIIPLLLLDEVVAHLDPDRRGALFGELAGLGAQVWMSGADPAAFANLSA 367

Query: 361 TAKFMRI 367
            ++  R+
Sbjct: 368 GSETFRV 374


>gi|316931399|ref|YP_004106381.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           DX-1]
 gi|315599113|gb|ADU41648.1| DNA replication and repair protein RecF [Rhodopseudomonas palustris
           DX-1]
          Length = 394

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/368 (38%), Positives = 203/368 (55%), Gaps = 4/368 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L ++ FRNY S  L   A   + VG NG GKTN LEA+S LSPGRG RRA   D+ 
Sbjct: 20  RITRLTLTHFRNYRSASLTTTADQVVLVGPNGAGKTNCLEAVSLLSPGRGLRRARLEDIA 79

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRIS 123
                  ++  A VEG  GLA +   +E    D  + R  +I+   +        HLR+ 
Sbjct: 80  GHEGDGSWAVSAEVEGALGLATLGTGIEPPRGDVATTRRCRIDREPVGSAAAFGDHLRMV 139

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSW 182
           WL PSMD +F G + ERRRF DR+V AID  H  R+   +R +R RNRLL +    DS W
Sbjct: 140 WLTPSMDGLFMGAASERRRFFDRLVLAIDSGHSARVSALDRSLRSRNRLLEDIRNADSHW 199

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFC 241
             +IE + AEL + +   R +    L+++I        FP  ++ L G+++     +   
Sbjct: 200 LDAIERETAELAIAVAAQRGQTATKLAAMIDARGATSAFPSARIMLDGWMESALASEPAT 259

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            +++ Y   L D R  D+ + RTL GPH +DL V Y  KA+     STGEQK +L+G+ L
Sbjct: 260 VVEDRYRAVLRDNRSRDAAAGRTLDGPHLTDLEVIYAPKAMPAREASTGEQKALLIGLVL 319

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHA+L++ TT   P+LLLDE+ AHLD  +R ALF  ++ +G+Q++MTG D   F  +   
Sbjct: 320 AHAQLVAETTSITPLLLLDEVVAHLDPGRRAALFGELSRLGAQVWMTGADPLAFAEIGPA 379

Query: 362 AKFMRISN 369
           A    + N
Sbjct: 380 AAIFDVDN 387


>gi|163797312|ref|ZP_02191265.1| recombination protein F [alpha proteobacterium BAL199]
 gi|159177403|gb|EDP61959.1| recombination protein F [alpha proteobacterium BAL199]
          Length = 410

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/377 (38%), Positives = 220/377 (58%), Gaps = 13/377 (3%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           + +R+ ++ L ++ FRNYA+  L  D    +  G NG GKTN+LEA+SFL+PGRG RRA 
Sbjct: 21  VPHRLAVRRLTLTRFRNYAAESLDIDGPAVVLTGPNGAGKTNLLEAVSFLTPGRGLRRAR 80

Query: 61  YADVTRI-------GSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVV 113
            ++V R+        S + ++  ARV+G  G  +I    +   D   R ++++    R  
Sbjct: 81  LSEVDRLVPADTIDTSSTAWAVAARVDGKLGAVNIGTGRDPDSDGERRLVRVDGAPARSQ 140

Query: 114 DELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL 173
             L  H+ +SWL P+MDR+F   +  RRRFLDRMVFA DP H  R+  +E   R RNRL+
Sbjct: 141 STLGDHVTVSWLTPAMDRLFLDGASGRRRFLDRMVFAFDPEHSTRVNHYEHAWRERNRLI 200

Query: 174 TEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD 233
            +G  D +W +++E  +A  G+ +  AR  ++  L+ +  E   +  FP  +L+L G +D
Sbjct: 201 KDGVRDPAWFAALEETLAATGIAVAAARSSLVARLNQVCAET--EPPFPAAELTLDGTVD 258

Query: 234 GKFDQSFC-ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
              D++    +++     L  GR+  S       GPHRSDL+V +  K +     STGEQ
Sbjct: 259 RWLDEAPALEIEDRLRATLAAGRRPGSPEAE---GPHRSDLLVRHVPKNMPAERCSTGEQ 315

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           K +LVGI LAHARL +   G +PILLLDE++AHLD+ +R ALF  V  +G Q ++TGTD+
Sbjct: 316 KALLVGIVLAHARLQAIEEGASPILLLDEVAAHLDDRRRTALFEAVLALGGQAWLTGTDR 375

Query: 353 SVFDSLNETAKFMRISN 369
            VF  + + A+ + +++
Sbjct: 376 GVFAPIADRAQIVEVTD 392


>gi|209883687|ref|YP_002287544.1| DNA replication and repair protein RecF [Oligotropha
           carboxidovorans OM5]
 gi|209871883|gb|ACI91679.1| DNA replication and repair protein RecF [Oligotropha
           carboxidovorans OM5]
          Length = 382

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 138/357 (38%), Positives = 204/357 (57%), Gaps = 7/357 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L+++EFR+Y +  +   +   + VG NG GKTN LEAIS L+PGRG RRA + D+ 
Sbjct: 5   RILRLSLTEFRSYHAASVRPQSDLVVLVGPNGAGKTNCLEAISLLAPGRGLRRARFEDIA 64

Query: 66  -RIG--SPSFFSTFARVEGMEGLADISIKLET---RDDRSVRCLQINDVVIRVVDELNKH 119
            R G      ++  A VEG  GLA +   ++        + R  +I+   +       +H
Sbjct: 65  NRAGDDGDGSWAVSAEVEGALGLATLGTGIDAPSAEGGNAKRRARIDREAVSSASAFGEH 124

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           LR+ WL P+MD +F+G + ERRRF DR+V AID  H  R+   ER +R RNRLL +  FD
Sbjct: 125 LRMVWLTPAMDGLFTGPASERRRFFDRLVLAIDKDHSSRVSALERSLRSRNRLLEDRNFD 184

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQ 238
             WC +IE + AEL V +   R   +  L+ ++        FP  +++L G+++     +
Sbjct: 185 PHWCEAIERETAELAVAVAAQRGHTLRRLAGMLAARGATSVFPSARITLDGWMENALMSE 244

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
              A+++ Y   L   R +D+ + RTL GPH +DL V Y  K +     STGEQK +L+G
Sbjct: 245 PATAVEDRYRDILRKSRLLDAAAGRTLNGPHLTDLHVIYAPKNMPAKEASTGEQKALLIG 304

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           + LAHA L++  TG  P+LLLDE+ AHLD  +R ALF  +  +G Q++MTG D + F
Sbjct: 305 LILAHASLVAEMTGIVPLLLLDEVVAHLDPRRRAALFDELATLGGQVWMTGADPAAF 361


>gi|170748658|ref|YP_001754918.1| DNA replication and repair protein RecF [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655180|gb|ACB24235.1| DNA replication and repair protein RecF [Methylobacterium
           radiotolerans JCM 2831]
          Length = 384

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 205/370 (55%), Gaps = 8/370 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L   +FRN+A L L   A+    VG+NG GKTN+LEA+S   PGRG RRA +A +
Sbjct: 16  LRVTRLIARDFRNHADLELTPRARFVALVGENGAGKTNLLEALSLFVPGRGLRRAEFAAM 75

Query: 65  TRIGSPSFFS---TFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
            R G P  F+   T  R EG E      ++    D R+ R  +I+          ++ LR
Sbjct: 76  ARSGGPGGFAVSLTLDR-EGAEHRLGTGLEPPGPDGRASRLCRIDGATAASPVAFSEFLR 134

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WL P +D +F G + +RRRFLDR+V A+D  H  R+   ER +R RNRLL E   D  
Sbjct: 135 VVWLTPDLDGLFRGAAGDRRRFLDRLVLAVDAAHGARVSAMERALRSRNRLLEERPDDDR 194

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ-KENFPHIKLSLTGFLDGKFDQSF 240
           W  ++E ++AELGV + +AR E    L  LI E     + FP   + L G LD      +
Sbjct: 195 WLDAVEREVAELGVAVALARRETAERLDRLIAETRDDAQPFPWAAIRLEGDLD-DLVAVW 253

Query: 241 CALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
            A++ E  Y   L +GR  D  + RTLIGP  SDL+V +  K +     STGEQK +L+G
Sbjct: 254 PAIEAEDRYRMALRNGRNRDRAAGRTLIGPQSSDLVVRHGPKDVPAGTASTGEQKALLIG 313

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + LAHARL+   +G AP++LLDE++AHLD  +R  LF  +  +  Q++MTG D   F   
Sbjct: 314 LVLAHARLVRAMSGIAPLILLDEVAAHLDPRRRAGLFEALEALPGQVWMTGADPGAFAQA 373

Query: 359 NETAKFMRIS 368
               + +RI 
Sbjct: 374 GTRTEVLRIG 383


>gi|332559821|ref|ZP_08414143.1| recombination protein F [Rhodobacter sphaeroides WS8N]
 gi|332277533|gb|EGJ22848.1| recombination protein F [Rhodobacter sphaeroides WS8N]
          Length = 363

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 208/369 (56%), Gaps = 17/369 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++ + R+ FD +   FVG NG GKTN+LEAIS LSPGRG RRA+  ++
Sbjct: 4   LAVTSLALSHFRSHRAARMAFDGRPVAFVGANGAGKTNLLEAISLLSPGRGLRRAAADEI 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A V G+  + +I    E    R VR         +V+  L + LRI W
Sbjct: 64  ARRPEALGWKVAAAVTGLHSVHEIETWAEGGGARQVRI--DGKAATQVM--LGRLLRIVW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR+++  +  RRRFLDR+  +  P H   ++D+E+ MR RNRLL E   D+ W  
Sbjct: 120 LVPAMDRLWTEAAEGRRRFLDRVAMSFAPHHAEAVLDYEKAMRERNRLLKEQVADAHWHG 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E +MAE    I   R E +  L  +  +   +  FP   LS+        D       
Sbjct: 180 ALEGRMAEAARAIRAHREEAVARL--MAAQGAAETAFPRAVLSVAS------DD-----P 226

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+ A    +GR+ D  + RTL+GPHR+DL   Y  K +  A  STGEQK +L+ + LA+A
Sbjct: 227 EDLAAAWAEGRRRDMAAGRTLVGPHRADLTAIYAAKDVPAAQCSTGEQKALLISLILANA 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G AP+LLLDE++AHLDE +R ALF  +  +G+Q FMTGT   +F +L + A+ 
Sbjct: 287 RALAEDLGAAPVLLLDEVAAHLDEGRRAALFDEICALGAQAFMTGTGPELFTALGDRAQR 346

Query: 365 MRISNHQAL 373
           + ++  Q L
Sbjct: 347 IEVTEAQGL 355


>gi|240136786|ref|YP_002961253.1| putative RecF protein [Methylobacterium extorquens AM1]
 gi|240006750|gb|ACS37976.1| putative RecF protein [Methylobacterium extorquens AM1]
          Length = 385

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 145/363 (39%), Positives = 201/363 (55%), Gaps = 6/363 (1%)

Query: 14  EFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFF 73
           +FRN+  L L    +    VG+NG GKTNILEA+S   PGRG RRA  A + R+G P  F
Sbjct: 17  DFRNHVDLDLATTRRFVALVGENGAGKTNILEAVSLFCPGRGLRRADLATMARVGGPGGF 76

Query: 74  STFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
           +  A +E  E         E    D R  R  +I+          ++ LRI WL P  D 
Sbjct: 77  AVSATLEASEAEHRFGSGYEPPGYDGRGTRVCRIDGANAPSPVAFSEFLRIVWLTPDFDG 136

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           +F G + +RRRFLDR+V A+D  H  R+   ER +R RNRLL E   D  W  ++E ++A
Sbjct: 137 LFRGAAGDRRRFLDRLVLAVDAGHGARVSAMERALRSRNRLLDERPDDGRWLDAVEREVA 196

Query: 192 ELGVKINIARVEMINALSSLIMEYVQ-KENFPHIKLSLTGFLDGKFDQSFCALKEE--YA 248
           ELGV + +AR E +  L  LI E       FP   L L G LD      + AL+ E  + 
Sbjct: 197 ELGVAVALARRETVERLDRLIAETRDDAAPFPWASLRLEGDLD-DLVAVWPALEAEDRFR 255

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           + L  GR  D  + RTLIGP  +DL+V +  K +  A  STGEQK +L+G+ LAHARL+ 
Sbjct: 256 RALMQGRHRDRAAGRTLIGPQTTDLVVRHGPKDVPAATASTGEQKALLIGLVLAHARLVR 315

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
             +G AP++LLDE++AHLD  +R  LF  +  +  Q++MTG D ++F  L   A  + I+
Sbjct: 316 AMSGLAPLILLDEVAAHLDPRRRGGLFDALEALEGQVWMTGADPALFAELEGRADMVNIA 375

Query: 369 NHQ 371
           + +
Sbjct: 376 DGR 378


>gi|218528086|ref|YP_002418902.1| DNA replication and repair protein RecF [Methylobacterium
           chloromethanicum CM4]
 gi|218520389|gb|ACK80974.1| DNA replication and repair protein RecF [Methylobacterium
           chloromethanicum CM4]
          Length = 385

 Score =  259 bits (662), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 145/363 (39%), Positives = 201/363 (55%), Gaps = 6/363 (1%)

Query: 14  EFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFF 73
           +FRN+  L L    +    VG+NG GKTNILEA+S   PGRG RRA  A + R+G P  F
Sbjct: 17  DFRNHVDLDLATTRRFVALVGENGAGKTNILEAVSLFCPGRGLRRADLATMARVGGPGGF 76

Query: 74  STFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
           +  A +E  E         E    D R  R  +I+          ++ LRI WL P  D 
Sbjct: 77  AVSATLEASEAEHRFGSGYEPPGYDGRGTRVCRIDGANAPSPVAFSEFLRIVWLTPDFDG 136

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           +F G + +RRRFLDR+V A+D  H  R+   ER +R RNRLL E   D  W  ++E ++A
Sbjct: 137 LFRGAAGDRRRFLDRLVLAVDAGHGARVSAMERALRSRNRLLDERPDDGRWLDAVEREVA 196

Query: 192 ELGVKINIARVEMINALSSLIMEYVQ-KENFPHIKLSLTGFLDGKFDQSFCALKEE--YA 248
           ELGV + +AR E +  L  LI E       FP   L L G LD      + AL+ E  + 
Sbjct: 197 ELGVAVALARRETVERLDRLIAETRDDAAPFPWASLRLEGDLD-DLVAVWPALEAEDRFR 255

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           + L  GR  D  + RTLIGP  +DL+V +  K +  A  STGEQK +L+G+ LAHARL+ 
Sbjct: 256 RALMQGRHRDRAAGRTLIGPQTTDLVVRHGPKDVPAATASTGEQKALLIGLVLAHARLVR 315

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
             +G AP++LLDE++AHLD  +R  LF  +  +  Q++MTG D ++F  L   A  + I+
Sbjct: 316 AMSGLAPLILLDEVAAHLDPRRRGGLFDALEALEGQVWMTGADPALFAELEGRADMVNIA 375

Query: 369 NHQ 371
           + +
Sbjct: 376 DGR 378


>gi|163849460|ref|YP_001637503.1| DNA replication and repair protein RecF [Methylobacterium
           extorquens PA1]
 gi|254558656|ref|YP_003065751.1| RecF protein [Methylobacterium extorquens DM4]
 gi|163661065|gb|ABY28432.1| DNA replication and repair protein RecF [Methylobacterium
           extorquens PA1]
 gi|254265934|emb|CAX21683.1| putative RecF protein [Methylobacterium extorquens DM4]
          Length = 384

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 144/363 (39%), Positives = 201/363 (55%), Gaps = 6/363 (1%)

Query: 14  EFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFF 73
           +FRN+  L L    +    VG+NG GKTNILEA+S   PGRG RRA  A + R+G P  F
Sbjct: 17  DFRNHVDLDLATTRRFVALVGENGAGKTNILEAVSLFCPGRGLRRADLATMARVGGPGGF 76

Query: 74  STFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
           +  A +E  E         E    D R  R  +I+          ++ LRI WL P  D 
Sbjct: 77  AVSATLEASEAEHRFGSGYEPPGYDGRGTRVCRIDGANAPSPVAFSEFLRIVWLTPDFDG 136

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           +F G + +RRRFLDR+V A+D  H  R+   ER +R RNRLL E   D  W  ++E ++A
Sbjct: 137 LFRGAAGDRRRFLDRLVLAVDAGHGARVSAMERALRSRNRLLDERPDDGRWLDAVEREVA 196

Query: 192 ELGVKINIARVEMINALSSLIMEYVQ-KENFPHIKLSLTGFLDGKFDQSFCALKEE--YA 248
           ELGV + +AR E +  L  LI E       FP   L L G LD      + AL+ E  + 
Sbjct: 197 ELGVAVALARRETVERLDRLIAETRDDAAPFPWASLRLEGDLD-DLVAVWPALEAEDRFR 255

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           + L  GR  D  + RTLIGP  +DL+V +  K +  A  STGEQK +L+G+ LAHARL+ 
Sbjct: 256 RALMQGRHRDRAAGRTLIGPQTTDLVVRHGPKDVPAATASTGEQKALLIGLVLAHARLVR 315

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
             +G AP++LLDE++AHLD  +R  LF  +  +  Q++MTG D ++F  L   A  + ++
Sbjct: 316 AMSGLAPLILLDEVAAHLDPRRRGGLFDALEALEGQVWMTGADPALFAELEGRADLIGVA 375

Query: 369 NHQ 371
           + +
Sbjct: 376 DGR 378


>gi|85713966|ref|ZP_01044955.1| recombination protein F [Nitrobacter sp. Nb-311A]
 gi|85699092|gb|EAQ36960.1| recombination protein F [Nitrobacter sp. Nb-311A]
          Length = 381

 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 206/355 (58%), Gaps = 6/355 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I  L++S+FRNY+S  L   +   +  G NG GKTN LEAIS LSPGRG RRA+  D+ 
Sbjct: 5   RILRLSLSQFRNYSSAALKTRSNMVVLAGPNGAGKTNCLEAISLLSPGRGLRRATRDDIA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV----RCLQINDVVIRVVDELNKHLR 121
                  ++  A V+G  GLA +   ++  ++ +     RC +I+   +        HLR
Sbjct: 65  DNRGDGSWAVSAEVQGPLGLATLGTGIDAPNNETAPGGRRC-RIDREPVASAAAFGDHLR 123

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WL PSMD +F+G + +RRRFLDR+V AID  H  R+   ER +R RNRLL     D  
Sbjct: 124 MVWLTPSMDGLFTGPASDRRRFLDRLVLAIDSDHSGRVSALERSLRSRNRLLEMRNHDDL 183

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSF 240
           WC ++E + AEL V +   R + I  LS  +       +FP  ++ L G+++ K   +  
Sbjct: 184 WCDAVERETAELAVAVAAMRAQTITRLSVALEARGSTSSFPSARIGLDGWMENKLLTEPA 243

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
            A+++ Y + L   R  D+ + RTL GPH +D  V Y  K +     STGEQK +L+G+ 
Sbjct: 244 TAVEDRYREILRASRARDAAAGRTLEGPHLTDFEVIYAPKDMPAKEASTGEQKALLIGLV 303

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           LAHARL++  TG  P+LLLDE+ AHLD  +R+ALF  +  +G+Q++M+G D + F
Sbjct: 304 LAHARLVAEMTGIIPLLLLDEVVAHLDPHRRDALFSELAGLGAQVWMSGADPAAF 358


>gi|221640843|ref|YP_002527105.1| recombination protein F [Rhodobacter sphaeroides KD131]
 gi|221161624|gb|ACM02604.1| DNA replication and repair protein recF [Rhodobacter sphaeroides
           KD131]
          Length = 363

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 206/369 (55%), Gaps = 17/369 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++ + R+ FD +   FVG NG GKTN+LEAIS LSPGRG RRA+  ++
Sbjct: 4   LAVTSLALSHFRSHRAARMAFDGRPVAFVGANGAGKTNLLEAISLLSPGRGLRRAAADEI 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A V G+    +I    E    R VR         +V+  L + LRI W
Sbjct: 64  ARRPEALGWKVAAAVTGLHSGHEIETWAEGGGARQVRV--DGKAATQVM--LGRLLRIVW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR+++  +  RRRFLDR+  +  P H   ++D+E+ MR RNRLL E   D+ W  
Sbjct: 120 LVPAMDRLWTEAAEGRRRFLDRVAMSFAPHHAEAVLDYEKAMRERNRLLKEQVADAHWHG 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E +MAE    I   R E +  L  +  +   +  FP   LS+        D       
Sbjct: 180 ALEGRMAEAARAIRAHREEAVARL--MAAQGAAETAFPRAMLSVAS------DD-----P 226

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+      +GR+ D  + RTL+GPHR+DL   Y  K +  A  STGEQK +L+ + LA+A
Sbjct: 227 EDLGAAWAEGRRRDMAAGRTLVGPHRADLTAIYAAKDVPAAQCSTGEQKALLISLILANA 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G AP+LLLDE++AHLDE +R ALF  +  +G+Q FMTGT   +F +L + A+ 
Sbjct: 287 RALAEDLGAAPVLLLDEVAAHLDEGRRAALFDEICALGAQAFMTGTGPELFTALGDRAQR 346

Query: 365 MRISNHQAL 373
           + ++  Q L
Sbjct: 347 IEVTEAQGL 355


>gi|188579290|ref|YP_001922735.1| DNA replication and repair protein RecF [Methylobacterium populi
           BJ001]
 gi|179342788|gb|ACB78200.1| DNA replication and repair protein RecF [Methylobacterium populi
           BJ001]
          Length = 385

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/374 (38%), Positives = 204/374 (54%), Gaps = 6/374 (1%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           +    ++  L   +FRN+  L L    +    VG+NG GKTNILEA+S   PGRG RRA 
Sbjct: 4   LPGGTRLTRLIARDFRNHIDLDLATTRRFVALVGENGAGKTNILEAVSLFCPGRGLRRAD 63

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNK 118
            A + R+G P  F+  A +E  E    +    E    D R  R  +I+          ++
Sbjct: 64  LATMARVGGPGGFAVSATLETAEAEHRLGSGYEPPGYDGRGTRVCRIDGAPAPSPVAFSE 123

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
            LRI WL P  D +F G + +RRRFLDR+V A+D  H  R+   ER +R RNRLL E   
Sbjct: 124 FLRIVWLTPDFDGLFRGAAGDRRRFLDRLVLAVDAGHGARVSAMERALRSRNRLLDERPD 183

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ-KENFPHIKLSLTGFLDGKFD 237
           D  W  ++E ++AELGV + +AR E +  L  LI E       FP   + L G LD    
Sbjct: 184 DGRWLDAVEREVAELGVAVALARRETVERLDRLIAETRDDAAPFPWASIRLEGDLD-DLV 242

Query: 238 QSFCALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
             + AL+ E  + + L  GR  D  + RTLIGP  +DL+V +  K +  A  STGEQK +
Sbjct: 243 AVWPALEAEDRFRRALMQGRHRDRAAGRTLIGPQTTDLLVRHGPKDVPAATASTGEQKAL 302

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+G+ LAHARL+   +G  P++LLDE++AHLD  +R  LF  +  +  Q++MTG D ++F
Sbjct: 303 LIGLVLAHARLVRAMSGLTPLILLDEVAAHLDPRRRGGLFDALEALEGQVWMTGADPALF 362

Query: 356 DSLNETAKFMRISN 369
             L   A  + I++
Sbjct: 363 TELQGRADMVNIAD 376


>gi|126460791|ref|YP_001041905.1| recombination protein F [Rhodobacter sphaeroides ATCC 17029]
 gi|126102455|gb|ABN75133.1| DNA replication and repair protein RecF [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 363

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 206/369 (55%), Gaps = 17/369 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++ + R+ FD +   FVG NG GKTN+LEAIS LSPGRG RRA+  ++
Sbjct: 4   LAVTSLALSHFRSHRAARMAFDGRPVAFVGANGAGKTNLLEAISLLSPGRGLRRAAADEI 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A V G+    +I    E    R VR         +V+  L + LRI W
Sbjct: 64  ARRPEALGWKVAAAVTGLHSGHEIETWAEGGGARQVRI--DGKAATQVM--LGRLLRIVW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR+++  +  RRRFLDR+  +  P H   ++D+E+ MR RNRLL E   D+ W  
Sbjct: 120 LVPAMDRLWTEAAEGRRRFLDRVAMSFAPHHAEAVLDYEKAMRERNRLLKEQVADAHWHG 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E +MAE    I   R E +  L  +  +   +  FP   LS+        D       
Sbjct: 180 ALEGRMAEAARAIRAHREEAVARL--MAAQGAAETAFPRAVLSVAS------DD-----P 226

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+ A    +GR+ D  + RTL+GPHR+DL   Y  K +  A  STGEQK +L+ + LA+A
Sbjct: 227 EDLAAAWAEGRRRDMAAGRTLVGPHRADLTAIYAAKDVPAAQCSTGEQKALLISLILANA 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G AP+LLLDE++AHLDE +R ALF  +  +G+Q FMTGT   +F +L   A+ 
Sbjct: 287 RALAEDLGAAPVLLLDEVAAHLDEGRRAALFDEICALGAQAFMTGTGPELFTALGYRAQR 346

Query: 365 MRISNHQAL 373
           + ++  Q L
Sbjct: 347 IEVTEAQGL 355


>gi|77464922|ref|YP_354426.1| recombination protein F [Rhodobacter sphaeroides 2.4.1]
 gi|77389340|gb|ABA80525.1| RecF protein [Rhodobacter sphaeroides 2.4.1]
          Length = 368

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 206/370 (55%), Gaps = 17/370 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++ + R+ FD +   FVG NG GKTN+LEAIS LSPGRG RRA+  ++
Sbjct: 9   LAVTSLALSHFRSHRAARMGFDGRPVAFVGSNGAGKTNLLEAISLLSPGRGLRRAAADEI 68

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A V G+    +I    E    R VR         +V+  L + LRI W
Sbjct: 69  ARRPEALGWKVAAAVTGLHSGHEIETWAEGGGARQVRV--DGKAATQVM--LGRLLRIVW 124

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR+++  +  RRRFLDR+  +  P H   ++D+E+ MR RNRLL E   D+ W  
Sbjct: 125 LVPAMDRLWTEAAEGRRRFLDRVAMSFAPHHAEAVLDYEKAMRERNRLLKEQVADAHWHG 184

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E +MAE    I   R E +  L  +  +   +  FP   LS+        D       
Sbjct: 185 ALEGRMAEAARAIRAHRDEAVARL--MAAQGAAETAFPRAMLSVAS------DD-----P 231

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+      +GR+ D  + RTL+GPHR+DL   Y  K +  A  STGEQK +L+ + LA+A
Sbjct: 232 EDLGAAWAEGRRRDMAAGRTLVGPHRADLTAIYAAKDVPAAQCSTGEQKALLISLILANA 291

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G AP+LLLDE++AHLDE +R ALF  +  +G+Q FMTGT   +F +L + A+ 
Sbjct: 292 RALAEDLGAAPVLLLDEVAAHLDEGRRAALFDEICALGAQAFMTGTGPELFTALGDRAQR 351

Query: 365 MRISNHQALC 374
           + ++  Q L 
Sbjct: 352 IEVTEAQGLS 361


>gi|209966327|ref|YP_002299242.1| recombination protein F [Rhodospirillum centenum SW]
 gi|209959793|gb|ACJ00430.1| DNA replication and repair protein RecF, putative [Rhodospirillum
           centenum SW]
          Length = 377

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 206/371 (55%), Gaps = 12/371 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIG- 68
           L ++ FR+Y + RL  DA+  +  G NG GKTN+LEA+SFL+PGRG RRA  A++ R G 
Sbjct: 4   LTVTRFRSYLTARLDCDARPVVLTGPNGAGKTNLLEAVSFLAPGRGLRRARLAEIERTGP 63

Query: 69  ----SPSFFSTFARVEGMEGLADISIKLETR--DDRSVRCLQINDVVIRVVDELNKHLRI 122
               +   ++  A +E   G  +I    +     +   R +QI+    +    L +H+ +
Sbjct: 64  AEGWAGPGWAVAATLETPAGPVEIGTGRDPAAGPESERRLVQIDGRAAKGQIALARHVAV 123

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P MDR+F   +  RRRFLDR+VF  DP H  R+  +E  +R R RLL EG  D +W
Sbjct: 124 VWLTPQMDRLFLEAASGRRRFLDRLVFGFDPAHAGRLSQYEAALRERARLLREGPADPAW 183

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            +++E +MA LGV +  AR +M+  L++     V    FP   +++ G +D     +  A
Sbjct: 184 LTTLEDRMATLGVAVAAARADMVARLAAAAALGVGP--FPAPGMAMAGGVD-DLVAAGPA 240

Query: 243 LKEEYAKKLFDGRKMDSMSRR--TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
           L  E A +          +      IGPHRSDL V    K +    GSTGEQK +L+ I 
Sbjct: 241 LAAEDALRRTLRDSRRRDAEAGGAAIGPHRSDLCVTCRAKEMPAERGSTGEQKALLIAIV 300

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA+ARL+   TG AP+LLLDE++AHLD D+R ALF  +   GSQ +MTGTD  VF  L  
Sbjct: 301 LANARLMKAETGTAPLLLLDEVAAHLDADRRAALFAEILATGSQAWMTGTDAQVFAELGA 360

Query: 361 TAKFMRISNHQ 371
            A  +R+ + +
Sbjct: 361 AASHVRVEDSR 371


>gi|220920057|ref|YP_002495358.1| DNA replication and repair protein RecF [Methylobacterium nodulans
           ORS 2060]
 gi|219944663|gb|ACL55055.1| DNA replication and repair protein RecF [Methylobacterium nodulans
           ORS 2060]
          Length = 382

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 205/370 (55%), Gaps = 7/370 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L   +FRN+ASL L         VG+NG GKTNILEA+S  +PGRG RRA +A + 
Sbjct: 8   RVTRLIARDFRNHASLDLGVSRPFVALVGENGAGKTNILEALSLFAPGRGLRRADFAAMA 67

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLE---TRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           R G P  F+    + G  G   +    E   TR++R+ R  +I+           +HLR+
Sbjct: 68  REGGPGGFAVSLNLAGPHGEHRVGTAWEPPQTREERAGRLCRIDGASAPSPTAFAEHLRV 127

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P +D +F G + ERRRFLDR+V A+D  H  R+   ER +R RNRLL E   D+ W
Sbjct: 128 VWLTPDLDALFRGPAGERRRFLDRLVLAVDAGHGARVSALERALRSRNRLLEERPDDTPW 187

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYV-QKENFPHIKLSLTGFLDGKFDQSFC 241
             ++E ++AEL + + +AR E +  L  LI+    +   FP   + L G +D      + 
Sbjct: 188 LDAVEREVAELAIAVALARRETVERLDRLILASRDEASPFPWAGVRLEGEID-DLVAVWP 246

Query: 242 ALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           A+  E  +   L   R  D  + RTL GP  SDL+V +  K +     STGEQK +L+G+
Sbjct: 247 AVDAEDRFRAMLRQNRFRDRAAGRTLAGPQASDLLVRHGPKDVPAGTASTGEQKALLIGL 306

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHARL++  +G  P++LLDE++AHLD  +R  LF  +  +  Q++MTG D ++F  L 
Sbjct: 307 VLAHARLVAGMSGLPPLVLLDEVAAHLDPRRRAGLFDALEALPGQVWMTGADPALFAELG 366

Query: 360 ETAKFMRISN 369
                + +++
Sbjct: 367 NRGDLIAVAD 376


>gi|170738370|ref|YP_001767025.1| DNA replication and repair protein RecF [Methylobacterium sp. 4-46]
 gi|168192644|gb|ACA14591.1| DNA replication and repair protein RecF [Methylobacterium sp. 4-46]
          Length = 382

 Score =  255 bits (652), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 140/372 (37%), Positives = 203/372 (54%), Gaps = 7/372 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L   +FRN+ASL L         VG+NG GKTNILEA+S  +PGRG RRA +A + 
Sbjct: 8   RVTRLIARDFRNHASLDLGVGRPFVALVGENGAGKTNILEALSLFAPGRGLRRADFAAMA 67

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLET---RDDRSVRCLQINDVVIRVVDELNKHLRI 122
           R G P  F+    VEG  G   +    E    R++R  R  +I+           + LR+
Sbjct: 68  REGGPGGFAVSLSVEGPHGEHRVGTAWEPPQGREERGGRQCRIDGASAPSPTAFAEQLRV 127

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P +D +F G + +RRRFLDR+V A+D  H  R+   ER +R RNRLL E   D  W
Sbjct: 128 VWLTPDLDALFRGPAGDRRRFLDRLVLAVDAGHGSRVSALERALRSRNRLLEERPEDGPW 187

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFC 241
             +IE ++AEL + + +AR E +  L  LI+      + FP   + L G +D      + 
Sbjct: 188 LDAIEREVAELAIAVALARRETVERLDRLILATRDAASPFPWAGVRLEGDID-DLVAVWP 246

Query: 242 ALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           A+  E  +   L   R  D  + RTL GP  SDL+V +  K +     STGEQK +L+G+
Sbjct: 247 AVDAEDRFRATLRQNRFRDRAAGRTLAGPQASDLVVRHGPKDVPAGTASTGEQKALLIGL 306

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LAHARL++  +G AP++LLDE++AHLD  +R  LF  +  +  Q++MTG D ++F  L 
Sbjct: 307 VLAHARLVAGMSGLAPLVLLDEVAAHLDPRRRAGLFDALEALPGQVWMTGADPALFAELG 366

Query: 360 ETAKFMRISNHQ 371
                + ++  Q
Sbjct: 367 SRGDVVAVAEGQ 378


>gi|92115636|ref|YP_575365.1| recombination protein F [Nitrobacter hamburgensis X14]
 gi|91798530|gb|ABE60905.1| DNA replication and repair protein RecF [Nitrobacter hamburgensis
           X14]
          Length = 379

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 143/376 (38%), Positives = 210/376 (55%), Gaps = 11/376 (2%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I+ L+++ FRNY +  L   +   + VG NG GKTN LEAIS LSPGRG RRA+  +V 
Sbjct: 5   RIRRLSLTHFRNYRAAALETRSDVVVLVGPNGAGKTNCLEAISLLSPGRGLRRATREEVA 64

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV----RCLQINDVVIRVVDELNKHLR 121
                  ++  A VEG  GLA +   ++     +     RC +I+            HLR
Sbjct: 65  DHRGDGSWAVSAEVEGALGLATLGTGIDAPGSDAASSGRRC-RIDREPAGSAAAFGDHLR 123

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WL PSMD +F G + ERRRF DR+V AID  H  R+   ER +R RNRLL     D  
Sbjct: 124 MVWLTPSMDGLFGGAASERRRFFDRLVLAIDSDHSGRVSALERSLRSRNRLLETRNSDDH 183

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSF 240
           WC ++E Q AEL V +   R + +  L++ +        FP  ++ L G+++     +  
Sbjct: 184 WCDAVERQTAELAVAVAAMRAQTVTRLAAALEARGAASAFPSARIGLDGWMENALLTEPA 243

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
            A+++ Y + L   R  D+ + RTL GPH +DL V Y  K++     STGEQK +L+G+ 
Sbjct: 244 TAVEDRYREILRANRARDAAAGRTLDGPHLTDLEVIYAPKSMPARDASTGEQKALLIGLV 303

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHA L++  TG AP+LLLDE+ AHLD D+R ALF  +  +G+Q++M+G D + F ++  
Sbjct: 304 LAHAGLVAEMTGIAPLLLLDEVVAHLDPDRRGALFGELKGLGAQVWMSGADPAAFANVGA 363

Query: 361 TAKFM-----RISNHQ 371
            ++       RI+  Q
Sbjct: 364 GSEIFDVDAGRIAQRQ 379


>gi|163733264|ref|ZP_02140708.1| recombination protein F [Roseobacter litoralis Och 149]
 gi|161393799|gb|EDQ18124.1| recombination protein F [Roseobacter litoralis Och 149]
          Length = 366

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 143/364 (39%), Positives = 213/364 (58%), Gaps = 13/364 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L IS FR++   RL+ DA+     G NG GKTN+LEA+S LSPGRG RRAS  D+
Sbjct: 3   LHLTELMISHFRSHRVARLMVDARPVALFGPNGAGKTNVLEAVSLLSPGRGLRRASAQDM 62

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLET-RDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           TR      +   A+V  +      S ++ET  ++ + R ++IN         L +  R+ 
Sbjct: 63  TRRPEALGWKVSAQVTSL----GQSQEIETWSEEGAARQVKINSKTA-AQTALGRVSRVL 117

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+PSMDR++   +  RRRFLDRM  + +P H    + +E+ MR RNRLL     + SW 
Sbjct: 118 WLIPSMDRLWIEGAEGRRRFLDRMTLSFEPGHADATLAYEKAMRERNRLLKNMVREPSWY 177

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
            ++E QMA+ GV I+  R   +  L++  ++      FP  +L L    +    +    L
Sbjct: 178 QALEVQMAQAGVVIDQNRRMALRQLAAAQLDATTA--FPAAELELI-HNEAPLPEGESTL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           ++ +A    D R  D  + RTLIGPHR+DLI  Y  K +     STGEQK +LV + LA+
Sbjct: 235 RDAFA----DSRSRDLAAGRTLIGPHRADLIGTYRAKGVAAKDCSTGEQKALLVSLILAN 290

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           AR ++  +G AP+LLLDE++AHLD D+R AL+  +T +G+Q +MTGT+KS+FD+L + A+
Sbjct: 291 ARALAQESGAAPLLLLDEVAAHLDADRRAALYDEITALGAQAWMTGTEKSLFDTLGDDAQ 350

Query: 364 FMRI 367
           +  I
Sbjct: 351 YFEI 354


>gi|217979344|ref|YP_002363491.1| DNA replication and repair protein RecF [Methylocella silvestris
           BL2]
 gi|217504720|gb|ACK52129.1| DNA replication and repair protein RecF [Methylocella silvestris
           BL2]
          Length = 398

 Score =  251 bits (642), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 143/372 (38%), Positives = 219/372 (58%), Gaps = 8/372 (2%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R  ++ L +++FR+YASL +   AQ  +  GDNG GKTN+LEA+S L+PGRG RRA  +D
Sbjct: 20  RRGVRRLTLADFRSYASLDMEILAQTVVLTGDNGAGKTNVLEALSLLTPGRGLRRAELSD 79

Query: 64  VTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNKHLRI 122
             R      F+    ++   G   +   +E     ++ R  +I+      +     H+R+
Sbjct: 80  CARNFGGGGFAVSIEIDAEGGRLQLGTGVEPNGGAALARKFRIDREPAPSIRAFCDHIRV 139

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS- 181
            WL P+MD +F G   +RRRFLDR+V ++D  H  R+   ER +R RNRLL E    +  
Sbjct: 140 VWLTPAMDGLFVGSPGDRRRFLDRLVLSLDADHGARVNALERALRSRNRLLEERGAGNER 199

Query: 182 -WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKE--NFPHIKLSLTGFLDGKFDQ 238
            W  ++E ++AEL + +  AR E ++ L++LI +   +    FP  +LSL G +D +  +
Sbjct: 200 LWLDAVEREVAELAIAVAAARFETVSKLAALIAQAGPETEGGFPLAELSLDGDID-RLIE 258

Query: 239 SFCALK--EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           +  AL+  +EY K L D R  D+ + RTLIGP  SDL V +  K    +H STGEQK +L
Sbjct: 259 TRPALEAEDEYRKILRDNRGRDAAAGRTLIGPQSSDLAVRHARKQAAASHSSTGEQKALL 318

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           VG+ LA ARLI   +G AP++LLDEI+AH D  +R AL+ ++  +G+Q+++TG D S F 
Sbjct: 319 VGLILAQARLIKAMSGLAPLVLLDEIAAHFDPKRRAALYELLGALGAQVWLTGADPSAFA 378

Query: 357 SLNETAKFMRIS 368
            L   A+ ++++
Sbjct: 379 ELEGKAQMLQVT 390


>gi|146276062|ref|YP_001166221.1| recombination protein F [Rhodobacter sphaeroides ATCC 17025]
 gi|145554303|gb|ABP68916.1| DNA replication and repair protein RecF [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 363

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 137/369 (37%), Positives = 204/369 (55%), Gaps = 17/369 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++ + R+ FD +   FVG NG GKTN+LEAIS LSPGRG RRA+  ++
Sbjct: 4   LAVTSLALSHFRSHRAARMAFDGRPVAFVGANGAGKTNVLEAISLLSPGRGLRRAAADEI 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A V G+    ++    E    R VR         +V+  L + LRI W
Sbjct: 64  ARRPEALGWKVAAAVRGLHSDHEVETWAEGGGARQVRI--DGKAATQVM--LGRLLRIVW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR+++  +  RRRFLDR+  +  P H   ++D+E+ MR RNRLL E   D+ W +
Sbjct: 120 LVPAMDRLWTEAAEGRRRFLDRVAMSFAPDHAEAVLDYEKAMRERNRLLKEQVADAHWHA 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E +MAE    I   R   +  L  +  +   +  FP   LS+                
Sbjct: 180 ALEGRMAEAARVIRAHREAAVARL--MAAQGAAETAFPRAMLSVA-----------SEDP 226

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+ A    +GR+ D  + RTL+GPHR+DL   Y  K +  A  STGEQK +L+ + LA+ 
Sbjct: 227 EDLAAAWAEGRRRDMAAGRTLLGPHRADLTAIYAAKGVPAAQCSTGEQKALLISLVLANG 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G APILLLDE++AHLDE +R ALF  +  +G+Q +MTGT   +F +L   A+ 
Sbjct: 287 RALAEDLGAAPILLLDEVAAHLDEGRRAALFDEICALGAQAYMTGTGPELFTALGGRAQR 346

Query: 365 MRISNHQAL 373
           + ++  + L
Sbjct: 347 IEVTEAEGL 355


>gi|304319869|ref|YP_003853512.1| recombination protein F [Parvularcula bermudensis HTCC2503]
 gi|303298772|gb|ADM08371.1| recombination protein F [Parvularcula bermudensis HTCC2503]
          Length = 375

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 145/356 (40%), Positives = 204/356 (57%), Gaps = 5/356 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L +S FR+Y S    F+ + T F G NG GKTNILEA+S + PGRG RRA+  D+T
Sbjct: 7   RVTRLALSSFRSYRSAEWRFEKRQTAFYGPNGAGKTNILEALSLMGPGRGLRRAALGDLT 66

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
           R GS   +     +   EG   ++++ E    +  R +Q++   +R    L   +R  WL
Sbjct: 67  RQGSDGGWGIGVDLGTGEGRRRLALRAEGVPLK--RHVQVDGEPVRSTGTLLDSVRFQWL 124

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P+ DR+F+    ERRRFLDRMV A  P H R  + FE  +R R   L  G+   +    
Sbjct: 125 TPAQDRLFTDSPGERRRFLDRMVLARCPSHGRDTLTFENALRQRQAALEAGW-PPAILEP 183

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG-FLDGKFDQSFCALK 244
           +EAQMAE G+ I+ AR + + AL  +  E VQ+  FP   LSL+G F D     +  A +
Sbjct: 184 LEAQMAEAGIAIDEARRQTLAALQ-VNYERVQETAFPRAGLSLSGPFEDIAGIPTLAARR 242

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E YA  L  GR+ D  + RTL+GPHRSDL V +  K       STGEQK +L+G+ LAHA
Sbjct: 243 ESYADLLERGRRRDREAGRTLLGPHRSDLEVVHLGKDQPARLCSTGEQKALLIGLVLAHA 302

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
                 T    +LLLDE++AHLDED+R AL  ++  +   +FMTGTD+++FD+  +
Sbjct: 303 TASLAATQAPLVLLLDEVAAHLDEDRRAALAAMLDQLAICVFMTGTDRALFDAWGD 358


>gi|255262668|ref|ZP_05342010.1| DNA replication and repair protein RecF [Thalassiobium sp. R2A62]
 gi|255105003|gb|EET47677.1| DNA replication and repair protein RecF [Thalassiobium sp. R2A62]
          Length = 368

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 139/371 (37%), Positives = 210/371 (56%), Gaps = 11/371 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L IS FR++  + L  DA+     G NGVGKTN++EAIS LSPGRG RR+S  D+
Sbjct: 4   LRLSELTISHFRSHKRVALEIDARPVAIYGANGVGKTNLIEAISLLSPGRGLRRSSAEDI 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           TR      +   A +  +  L +I    E    R V+     D        L +  R+ W
Sbjct: 64  TRRPEAVGWKVRAVLHSLNQLHEIETWSEGGSARQVKV----DSKASTQVALGRIGRLLW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L+P+MDR++   +  RRRFLDR   + +P H   ++ +++ MR RNRLL +   D  W  
Sbjct: 120 LIPAMDRLWIEGAEGRRRFLDRATLSFEPTHAEAVLTYDKAMRERNRLLKDQVRDGHWYV 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           +IEAQMAE G++I   R   I+ L  +  +   +  FP   L L   L+G  D+   A  
Sbjct: 180 AIEAQMAEAGLRITQNRAFAISEL--MAAQASARTAFPTAVLQL---LEG--DEGLPASV 232

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           +++   L + R+ D  + RTLIGPHR+DL   Y  K I     STGEQK +L+ + LA+ 
Sbjct: 233 DDHRTALSENRQRDLYAGRTLIGPHRTDLGATYAAKDIPAKDCSTGEQKALLISLILANG 292

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++ + G  P+LLLDE++AHLD D+R AL+  +T +G+Q +MTGT   +FD+L + A++
Sbjct: 293 RALAQSFGAPPLLLLDEVAAHLDADRRAALYDEITALGAQAWMTGTGPELFDTLGDRAQY 352

Query: 365 MRISNHQALCI 375
           + +S   A  +
Sbjct: 353 LDVSEDCAALV 363


>gi|110677618|ref|YP_680625.1| recombination protein F [Roseobacter denitrificans OCh 114]
 gi|109453734|gb|ABG29939.1| DNA replication and repair protein RecF, putative [Roseobacter
           denitrificans OCh 114]
          Length = 366

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 140/360 (38%), Positives = 203/360 (56%), Gaps = 11/360 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FR++   R   D +     G NG GKTNILEA+S LSPGRG RRAS  D+TR   
Sbjct: 8   LMVSHFRSHRVARFALDQRPVALFGPNGAGKTNILEAVSLLSPGRGLRRASAQDMTRRPE 67

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              +   A+V  +    ++    +    R VR   IN         L +  R+ WL+PSM
Sbjct: 68  ALGWKITAQVMSLGQHQEVETWSQEGAARQVR---INGKTA-AQTALGRVSRVLWLIPSM 123

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR++   +  RRRFLDRM  + +P H    + +E+ MR RNRLL     + SW  ++E Q
Sbjct: 124 DRLWIEGAEGRRRFLDRMTLSFEPGHADATLAYEKAMRERNRLLKNMVREPSWYQALELQ 183

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA+ GV ++  R   +  L++   +      FP  +L L    D        AL++ +A 
Sbjct: 184 MAQAGVVVDQNRRMALRQLAAAQSDATTA--FPAAELELI-HNDAPLPDGETALRDAFA- 239

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
              D R  D  + RTL+GPHR+DLI  Y  K +     STGEQK +LV + LA+AR ++ 
Sbjct: 240 ---DSRSRDLAAGRTLVGPHRADLIGTYRAKGVAARDCSTGEQKALLVSLILANARALAQ 296

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
            +G AP+LLLDE++AHLD D+R AL+  +T +G+Q +MTGT+KS+FD+L + A++  I+ 
Sbjct: 297 DSGAAPLLLLDEVAAHLDADRRAALYDEITALGAQAWMTGTEKSLFDTLGDGAQYFEITE 356


>gi|114769642|ref|ZP_01447252.1| recombination protein F [alpha proteobacterium HTCC2255]
 gi|114549347|gb|EAU52229.1| recombination protein F [alpha proteobacterium HTCC2255]
          Length = 364

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 210/370 (56%), Gaps = 20/370 (5%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +RI +  L IS FR+Y ++ ++         G NG GKTNILEA+S LSPGRG RR+   
Sbjct: 2   SRIAVTNLKISHFRSYKNVEILTSGCPVALFGSNGAGKTNILEALSLLSPGRGLRRSRVD 61

Query: 63  DVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           ++ R      +   A ++ +  + +I         RSVR     D  +     L +  RI
Sbjct: 62  EMERKPEGIGWKISATLQSLGQIHEIETIYSGDGSRSVRI----DGKVTTQTALGRIARI 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WLVP MDR++   +  RRRFLDR+  + +P H +  +D+ER MR RN++L EG  D +W
Sbjct: 118 VWLVPVMDRLWVDGAEGRRRFLDRLSMSFEPSHAQYTLDYERAMRERNKMLKEGINDPAW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGKFDQSF 240
            S++E+QMAE G KI   R+  I+     IME     + +FP  +L L G      +++ 
Sbjct: 178 YSAVESQMAESGRKIEQNRLYTIDR----IMEAQTNVQTSFPTAQLGLVG----ANNEAI 229

Query: 241 CA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
               LK+ +A    + R+ D  + RTLIGPHR DL   Y  K       STGEQK +LV 
Sbjct: 230 IVDDLKDAFA----NNRRADLFAGRTLIGPHRDDLTAMYSAKETAAKLCSTGEQKALLVS 285

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + LA+ R +S   G APILLLDE+SAHLD +++NAL+  +  +G+Q +MTGT K +F++ 
Sbjct: 286 LILANGRALSQDFGSAPILLLDEVSAHLDIERQNALYEEIISLGAQAWMTGTGKELFEAF 345

Query: 359 NETAKFMRIS 368
            + A+F+ ++
Sbjct: 346 GDRAQFLEVN 355


>gi|260431696|ref|ZP_05785667.1| recombination protein F [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415524|gb|EEX08783.1| recombination protein F [Silicibacter lacuscaerulensis ITI-1157]
          Length = 366

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 143/368 (38%), Positives = 207/368 (56%), Gaps = 21/368 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++   R+  D +     G NG GKTNILEA+S  SPGRG RRAS A++
Sbjct: 3   LALTELTVSHFRSHKLARMALDGRPVALYGPNGAGKTNILEAVSLFSPGRGMRRASAAEM 62

Query: 65  TRIGSPSFFSTFARVEGMEGLADIS---IKLET-RDDRSVRCLQINDVVIRVVDELNKHL 120
           TR   P           + GL D+     ++ET  +  + R ++I+      +D L K  
Sbjct: 63  TR--RPEALGW-----KLSGLLDVQGRRSEIETWSEGGAARQVRIDGKAASQID-LGKLA 114

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS 180
           R+ WL+P+MDR++   +  RRRFLDR+  + DP H    + +E+ MR RNRLL E   D+
Sbjct: 115 RVVWLMPAMDRLWIEGAEGRRRFLDRVTLSFDPSHAEAALTYEKAMRERNRLLKEQVRDA 174

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQS 239
            W +++EAQMAE G +I+ AR   +NAL+ L     Q E  FP  +L L    +G    S
Sbjct: 175 HWYAALEAQMAETGHRIHTAR---MNALAQLRAAQEQAETAFPSAELELVQP-EGAMPDS 230

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E  A+  F     D  + RTL+GPHRSDL   +  K +  +  STGEQK +LV +
Sbjct: 231 AQDLLEALAESRF----RDLSAGRTLVGPHRSDLYGVFAAKGVAASECSTGEQKALLVSL 286

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            L++AR ++   G  PILLLDE++AHLD D+R AL+  +  +G+Q +MT T   +F  L 
Sbjct: 287 ILSNARALAAQVGAPPILLLDEVAAHLDADRRAALYDEICALGAQAWMTATGPELFAELG 346

Query: 360 ETAKFMRI 367
           E A+   +
Sbjct: 347 ERAQAFEV 354


>gi|297184290|gb|ADI20407.1| recombinational DNA repair ATPase (recf pathway) [uncultured alpha
           proteobacterium EB080_L43F08]
          Length = 364

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 210/370 (56%), Gaps = 20/370 (5%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +RI +  L IS FR+Y ++ ++         G NG GKTNILEA+S LSPGRG RR+   
Sbjct: 2   SRIAVTNLKISHFRSYKNVEILTSGCPVALFGSNGAGKTNILEALSLLSPGRGLRRSRVD 61

Query: 63  DVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           ++ R      +   A ++ +  + +I         RSVR     D  +     L +  RI
Sbjct: 62  EMERKPEGIGWKISATLQSLGQIHEIETIYSGDGSRSVRI----DGKVTTQTALGRIARI 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WLVP MDR++   +  RRRFLDR+  + +P H +  +D+ER MR RN++L EG  D +W
Sbjct: 118 VWLVPVMDRLWVDGAEGRRRFLDRLSMSFEPSHAQYTLDYERAMRERNKMLKEGINDPAW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGKFDQSF 240
            S++E+QMAE G KI   R+  I+     IME     + +FP  +L L G      +++ 
Sbjct: 178 YSAVESQMAESGRKIEQNRLYTIDR----IMEAQTNVQTSFPTAQLGLVG----ANNEAI 229

Query: 241 CA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
               LK+ +A    + R+ D  + RTL+GPHR DL   Y  K       STGEQK +LV 
Sbjct: 230 IVDDLKDAFA----NNRRADLFAGRTLVGPHRDDLTAMYSAKETAAKLCSTGEQKALLVS 285

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + LA+ R +S   G APILLLDE+SAHLD +++NAL+  +  +G+Q +MTGT K +F++ 
Sbjct: 286 LILANGRALSQDFGSAPILLLDEVSAHLDIERQNALYEEIISLGAQAWMTGTGKELFEAF 345

Query: 359 NETAKFMRIS 368
            + A+F+ ++
Sbjct: 346 GDRAQFLEVN 355


>gi|149186139|ref|ZP_01864453.1| recombinational DNA repair ATPase [Erythrobacter sp. SD-21]
 gi|148830170|gb|EDL48607.1| recombinational DNA repair ATPase [Erythrobacter sp. SD-21]
          Length = 359

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 214/364 (58%), Gaps = 19/364 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++++ FRN+ +  L   A+  + VG+NG GKTN+LEA+S L+PGRG RRA+ AD+ + G 
Sbjct: 5   ISLTRFRNHEATELGATARFNLLVGENGAGKTNVLEALSLLAPGRGLRRANLADIVQHGV 64

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDR---SVRCLQINDVVIRVVDELNKHLRISWLV 126
              F   A +   EG     ++L T  +    S R ++IN         L + + ++WL 
Sbjct: 65  DEGFGVGASLLVDEGE---PVRLATYSESAQPSRRRVRINGADASAA-ALGEWIALTWLT 120

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P+MD +F+G + +RRRF+DRM  A+DP H +    +E  +R RNRLL++    +S+W  +
Sbjct: 121 PAMDGLFTGPAADRRRFIDRMALALDPAHAQHAARYEGALRERNRLLSDDRPPESAWLDA 180

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           IEAQM E G ++   R  +++ L + I     K   P  + +LT +  G  D +     E
Sbjct: 181 IEAQMVEHGGRLIAGRAALVDTLMARIAHMPSK---PFARPALT-YAPGGADSA-----E 231

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
             ++ LF+GR+ D  ++RTL GPHR +L V +  K +  A  STGEQK +LV I LAHA 
Sbjct: 232 ALSQALFEGRQRDRAAQRTLAGPHRDELEVIHASKRVPAAQSSTGEQKAMLVAITLAHAG 291

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L +   G A ILLLDE++AHLD  +R ALF  +   G+Q++MTGT+ + FDS+ + A   
Sbjct: 292 LAAQ--GRAGILLLDEVAAHLDPVRRAALFDQLAASGAQVWMTGTEIAPFDSIADQAAVW 349

Query: 366 RISN 369
           +++ 
Sbjct: 350 KVAG 353


>gi|260574427|ref|ZP_05842431.1| DNA replication and repair protein RecF [Rhodobacter sp. SW2]
 gi|259023323|gb|EEW26615.1| DNA replication and repair protein RecF [Rhodobacter sp. SW2]
          Length = 366

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 202/366 (55%), Gaps = 14/366 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I  L++S FR++ + RL FD +    VG NG GKTN+LEA+S LSPGRG RRA   ++
Sbjct: 4   LAITSLSLSHFRSHRAARLHFDGRPVALVGPNGAGKTNVLEAVSLLSPGRGLRRAGVDEI 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A + G+    ++    E    R VR     D        L +  R+ W
Sbjct: 64  ARRPEAMGWKVGADLRGIGAAHEVETWAEAGQARQVRI----DGKHATQAMLGRIARMLW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR++   +  RRRFLDRM  +  P H   ++ +E+ MR RNRLL +   D+ W  
Sbjct: 120 LVPAMDRLWIEAAEGRRRFLDRMTLSFAPDHAEAVLAYEKAMRDRNRLLKDQVTDAHWYG 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCAL 243
            +EAQMA  G  I   R     A++ L+   V  E  FP   L++    +G   ++  AL
Sbjct: 180 VLEAQMAASGAAIMAHRR---LAVARLLAAQVGAETAFPQADLAIVA--EGDLPETTDAL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            + +A    +GR+ D  + RTLIGPHR+DL   +  K +     STGEQK +L+ + LA+
Sbjct: 235 AQAFA----EGRRRDLAAGRTLIGPHRADLAARFAAKDVAADQCSTGEQKALLISLILAN 290

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           AR ++   G APILLLDE++AHLD D+R AL+  +  +G+Q  MTGT   +FD+L    +
Sbjct: 291 ARALAADLGVAPILLLDEVAAHLDADRRAALYDEICALGAQALMTGTGAELFDTLGARGQ 350

Query: 364 FMRISN 369
              +++
Sbjct: 351 TFAVAD 356


>gi|83309737|ref|YP_420001.1| recombination protein F [Magnetospirillum magneticum AMB-1]
 gi|82944578|dbj|BAE49442.1| Recombinational DNA repair ATPase [Magnetospirillum magneticum
           AMB-1]
          Length = 394

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/375 (37%), Positives = 205/375 (54%), Gaps = 14/375 (3%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R  ++ L +++FR Y +LRL  D++  +  G NG GKTNILEA+SFL PGRG RRA  AD
Sbjct: 14  RPAVRRLTLADFRCYRTLRLETDSRPVVLTGANGAGKTNILEALSFLVPGRGLRRAGAAD 73

Query: 64  VTRIG--SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           +TR G  + S ++  A ++G  G  +I    E   +R  R ++I+    +  D L   + 
Sbjct: 74  ITRHGLAAGSPWAVAATLDGPAGRVEIGTGREAGHER--RSVRIDGKPAKPGD-LAGLVS 130

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY---- 177
             WL P+MDR+F   +  RRRFLDR+VF + P H      +E  MR R RLL        
Sbjct: 131 ALWLTPAMDRLFIEGASGRRRFLDRLVFGLVPGHGAEAGAYEHAMRERTRLLRAARDGGP 190

Query: 178 -FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF 236
             D +W +++E  MA  G ++ +ARVE I  L       +    FP   L++ G ++G  
Sbjct: 191 RVDPAWMAALEEGMARHGTRVALARVESIRRLDEACRAGLGP--FPAAGLAVEGEIEGWL 248

Query: 237 DQSFCA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
                    +E +   L   R  D  +    +GPHRSDL+V +  K +     STGEQK 
Sbjct: 249 AGGLSPDEAEERFRGALRVARARDEAAGAATMGPHRSDLMVRHVPKDLPAGQCSTGEQKA 308

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           VLV I LA  R+   + G AP+LLLDE++AHLDE +R ALF  +  + +Q +MTGTD  +
Sbjct: 309 VLVSIVLAQGRVQDQSGGRAPLLLLDEVAAHLDEVRRAALFDELCALKAQSWMTGTDAML 368

Query: 355 FDSLNETAKFMRISN 369
           F    E A+F R+++
Sbjct: 369 FAGFGERAQFFRVTD 383


>gi|298290589|ref|YP_003692528.1| DNA replication and repair protein RecF [Starkeya novella DSM 506]
 gi|296927100|gb|ADH87909.1| DNA replication and repair protein RecF [Starkeya novella DSM 506]
          Length = 385

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 205/369 (55%), Gaps = 9/369 (2%)

Query: 14  EFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS---- 69
           +FR+Y    +       + VG NG GKTN+LEAIS L+PGRG RRAS       G     
Sbjct: 13  DFRSYHHADIRAGDGPVVLVGPNGAGKTNLLEAISLLAPGRGLRRASLDQFAARGPEGTQ 72

Query: 70  PSFFSTFARVEGMEGLADISIKLET--RDDRSVRCLQINDVVIRVVDELNKHLRISWLVP 127
            + ++  A VEG  G   +   LE    + RS RC +I+   +        H+R+ WL P
Sbjct: 73  AAGWAVSAVVEGAYGEVTLGTGLEADAGEARSRRC-RIDGEPVGSAAAFADHVRVVWLTP 131

Query: 128 SMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIE 187
            MD +F+G   ERRRFLDR+V A+D  H  R+   ER +R RNRLL E   D  +  ++E
Sbjct: 132 DMDGLFTGPPSERRRFLDRLVLAVDAEHGARVNALERALRSRNRLLEEPSTDPRYLDAVE 191

Query: 188 AQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFD-QSFCALKE 245
            ++A L V +  AR+E +  L++ I +     + FP   ++L G ++     +    +++
Sbjct: 192 HELAALAVAVAAARLETVRRLAANIAQSRDDTSLFPWASVALEGEVERALAREPATVVED 251

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           +Y   L   R  D  + RTL GPH +DL+V +  KAI  A GSTGEQK +L+G+ LAHAR
Sbjct: 252 QYRLALRASRPRDRAAGRTLEGPHLTDLLVGHGPKAIPAAQGSTGEQKALLIGLALAHAR 311

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+    G AP++LLD++ A+LD  +R ALF  +  +GSQ++MTG D S F +L   A+  
Sbjct: 312 LVGEMAGMAPVMLLDDVVAYLDPARRAALFEALEALGSQVWMTGADPSAFVALGARAERF 371

Query: 366 RISNHQALC 374
            +   Q L 
Sbjct: 372 EVRPGQVLS 380


>gi|254477354|ref|ZP_05090740.1| DNA replication and repair protein RecF [Ruegeria sp. R11]
 gi|214031597|gb|EEB72432.1| DNA replication and repair protein RecF [Ruegeria sp. R11]
          Length = 365

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 206/365 (56%), Gaps = 11/365 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L  D +     G NG GKTNILEA+S  SPGRG RRAS AD+
Sbjct: 2   LALTALTLSHFRSHLRADLHLDGRPVAIHGANGAGKTNILEAVSLFSPGRGLRRASAADM 61

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R   P       R E   G     ++  +   ++ R ++I++     +D L +  R+ W
Sbjct: 62  AR--RPEELGWKLRAELRAGRQTYEVETWSEAGKA-RQVKIDNKSASQID-LGEICRVVW 117

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L+P+MDR++   +  RRRFLDR+V + DP H    + +E+ MR RNRLL E   D++W  
Sbjct: 118 LIPAMDRLWIEGAEGRRRFLDRIVLSFDPGHAEATLAYEKAMRERNRLLKEQVRDAAWYR 177

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
            +E+QMA+ G +I+ AR   ++ L   + +   +  FP  +L L    DG    +   L+
Sbjct: 178 VLESQMAQAGHRIHAARTAAVDRLR--LAQEAAETAFPAAELELIQS-DGGLPDNAADLQ 234

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E +A    +GR  D  + RTL+GPHR+DL+  Y  K +     STGEQK +LV + LA+A
Sbjct: 235 ESFA----EGRFRDLAAGRTLLGPHRTDLLGTYAAKGLPARDCSTGEQKALLVSLILANA 290

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R +    G APILLLDE+SAHLD ++R AL++ +  +G+Q +MTGT    F   +  A+ 
Sbjct: 291 RALIAAGGAAPILLLDEVSAHLDVNRRAALYQEILGLGAQAWMTGTGPEQFAEFDGQAQM 350

Query: 365 MRISN 369
           + + +
Sbjct: 351 LCVQD 355


>gi|86139415|ref|ZP_01057984.1| recombination protein F [Roseobacter sp. MED193]
 gi|85823918|gb|EAQ44124.1| recombination protein F [Roseobacter sp. MED193]
          Length = 365

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 138/371 (37%), Positives = 208/371 (56%), Gaps = 15/371 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L  D +     G NG GKTNILEA+S  SPGRG RRAS AD+
Sbjct: 2   LALTELTLSHFRSHLRAELHLDGRPVAIHGKNGAGKTNILEAVSLFSPGRGLRRASAADM 61

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLET-RDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R   P       +++ +    D + ++ET  ++ + R ++I++     +  L +  R+ 
Sbjct: 62  VR--RPEGLGW--KLKAVLQAPDQAYEIETWSEEGAARQVRIDNKASNQI-ALGQICRVV 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WLVP MDR++   +  RRRFLDR+  + DP H    + +E+ MR RNRLL E   D++W 
Sbjct: 117 WLVPVMDRLWVEAAEGRRRFLDRIALSFDPSHAEATLTYEKAMRERNRLLKEQVRDAAWY 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCA 242
             +EAQM   G +I+ AR    +A+  LI    + E  FP   L L    +G+  QS   
Sbjct: 177 RVVEAQMGTAGHRIHTARC---SAVQRLIEAQDKAETAFPTAHLDLVQS-EGEMPQS--- 229

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
            + +  + L +GR  D    R+L+GPHRSDLI  Y  K I     STGEQK +LV + LA
Sbjct: 230 -EADLVQALAEGRMRDMKVGRSLVGPHRSDLIGTYVHKGIAAKECSTGEQKALLVSLILA 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           +AR ++ + G  PILLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L   A
Sbjct: 289 NARALTASEGAPPILLLDEVAAHLDAGRRAALYDEICALGAQAWMTGTGAELFAELGTRA 348

Query: 363 KFMRISNHQAL 373
           + + + + + +
Sbjct: 349 QVLEVGDMEGI 359


>gi|163743746|ref|ZP_02151120.1| recombination protein F [Phaeobacter gallaeciensis 2.10]
 gi|161383007|gb|EDQ07402.1| recombination protein F [Phaeobacter gallaeciensis 2.10]
          Length = 365

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 205/366 (56%), Gaps = 13/366 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L  D +     G NG GKTNILEA+S  SPGRG RRAS AD+
Sbjct: 2   LALTTLTLSHFRSHLRADLHLDGRPVAIHGANGAGKTNILEAVSLFSPGRGLRRASAADM 61

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRIS 123
            R   P       +++G   +A  S ++ET  +    R ++I++     +D L +  R+ 
Sbjct: 62  AR--RPEALGW--KLKGQLTVARQSYEVETWSEAGKARQVKIDNKAASQID-LGQICRVV 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P+MDR++   +  RRRFLDR+V + DP H    + +E+ MR RNRLL E   D+ W 
Sbjct: 117 WLIPAMDRLWIEAAEGRRRFLDRIVLSFDPGHAEATLLYEKAMRERNRLLKEQIRDAGWY 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
             +E QMAE G +I+ AR   ++ L   + +   +  FP  +L L    DG    +   L
Sbjct: 177 RVLETQMAESGHRIHAARTAAVDRLR--MAQEAAETAFPAAELELIQS-DGGLPDTAADL 233

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E +     +GR  D  + RTL+GPHR+DL+  Y  K +     STGEQK +LV + LA+
Sbjct: 234 QEAFE----EGRFRDLAAGRTLLGPHRTDLLGTYAAKGVPARDCSTGEQKALLVSLILAN 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           AR +    G  PILLLDE+SAHLD  +R AL++ +  +G+Q +MTGT   +FD     A+
Sbjct: 290 ARALIAEGGAPPILLLDEVSAHLDVIRRAALYQEIVTLGAQAWMTGTGPELFDEFEGRAQ 349

Query: 364 FMRISN 369
              + +
Sbjct: 350 MFTVED 355


>gi|163738136|ref|ZP_02145552.1| DNA replication and repair protein RecF [Phaeobacter gallaeciensis
           BS107]
 gi|161388752|gb|EDQ13105.1| DNA replication and repair protein RecF [Phaeobacter gallaeciensis
           BS107]
          Length = 365

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 205/366 (56%), Gaps = 13/366 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L  D +     G NG GKTNILEA+S  SPGRG RRAS AD+
Sbjct: 2   LALTTLTLSHFRSHLRADLHLDGRPVAIHGANGAGKTNILEAVSLFSPGRGLRRASAADM 61

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRIS 123
            R   P       +++G    A  S ++ET  +    R ++I++     +D L +  R+ 
Sbjct: 62  AR--RPEALGW--KLKGQLTAARQSYEVETWSEAGKARQVKIDNKAASQID-LGQICRVV 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P+MDR++   +  RRRFLDR+V + DP H    + +E+ MR RNRLL E   D++W 
Sbjct: 117 WLIPAMDRLWIEAAEGRRRFLDRIVLSFDPGHAEATLLYEKAMRERNRLLKEQIRDAAWY 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
             +E QMAE G +I+ AR   ++ L   + +   +  FP  +L L    DG    +   L
Sbjct: 177 RVLETQMAESGHRIHAARTAAVDRLR--MAQEAAETAFPAAELELIQS-DGGLPDTAADL 233

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E +     +GR  D  + RTL+GPHR+DL+  Y  K +     STGEQK +LV + LA+
Sbjct: 234 QEAFE----EGRFRDLAAGRTLLGPHRTDLLGTYAAKGVPARDCSTGEQKALLVSLILAN 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           AR +    G  PILLLDE+SAHLD  +R AL++ +  +G+Q +MTGT   +FD     A+
Sbjct: 290 ARALIAEGGAPPILLLDEVSAHLDVIRRAALYQEIVTLGAQAWMTGTGPELFDEFEGRAQ 349

Query: 364 FMRISN 369
              + +
Sbjct: 350 MFTVED 355


>gi|259418051|ref|ZP_05741970.1| recombination protein F [Silicibacter sp. TrichCH4B]
 gi|259346957|gb|EEW58771.1| recombination protein F [Silicibacter sp. TrichCH4B]
          Length = 365

 Score =  235 bits (600), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 212/374 (56%), Gaps = 19/374 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L  DA+     G+NG GKTNILEA+S  SPGRG RRAS AD+
Sbjct: 2   LALTSLFMSHFRSHLRADLHLDARPVAIHGNNGAGKTNILEAVSLFSPGRGIRRASAADM 61

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDR-SVRCLQINDVVIRVVDELNKHLRIS 123
            R   P       +++G+      + ++ET  +  + R ++I++     V  L +  R+ 
Sbjct: 62  AR--RPEALGW--KLKGLLQTTGPTFEVETSSEGGNARQVKIDNKAASQV-ALGRIARVV 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P+MDR++   +  RRRFLDR+  + DP H    + +E+ MR RNRLL +   D++W 
Sbjct: 117 WLIPAMDRLWIEGAEGRRRFLDRIALSFDPDHAEATLAYEKAMRERNRLLKDNVRDAAWY 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN---FPHIKLSLTGFLDGKFDQSF 240
             +E QMAE G +I+  RV+ ++ L++      QKE    FP  +L L    +G+  +S 
Sbjct: 177 RVLEGQMAEAGFRIHQTRVDAVSRLTA-----AQKEAETAFPVAELQLIQA-EGEMPESV 230

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+      L  GR  D    RTL+GPHRSDL+  Y  K +     STGEQK +LV + 
Sbjct: 231 DDLR----AALDAGRARDLAVGRTLVGPHRSDLMGAYAAKGLPAKDCSTGEQKALLVSLI 286

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA+AR +    G APILLLDE++AHLD ++R AL+  +  +G+Q +MTGT   +F  L +
Sbjct: 287 LANARALQAEEGSAPILLLDEVAAHLDGNRRAALYDEICALGTQAWMTGTGPELFQELGD 346

Query: 361 TAKFMRISNHQALC 374
            A+ + + +   + 
Sbjct: 347 RAQHLEVVDQNGVS 360


>gi|126738625|ref|ZP_01754330.1| recombination protein F [Roseobacter sp. SK209-2-6]
 gi|126720424|gb|EBA17130.1| recombination protein F [Roseobacter sp. SK209-2-6]
          Length = 375

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 137/361 (37%), Positives = 203/361 (56%), Gaps = 13/361 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FR++    +  D +     G NG GKTNILEA+S  SPGRG RRAS A++TR   
Sbjct: 17  LTLSHFRSHLRAEMHLDGRPVALFGANGAGKTNILEAVSLFSPGRGIRRASAAEMTR--R 74

Query: 70  PSFFSTFARVEGMEGLADISIKLET-RDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
           P       +++G+   +    ++ET  D+ + R ++I+      +  L +  R+ WLVP 
Sbjct: 75  PEGLGW--KLKGVLQTSAQPYEIETWSDEGAARQVRIDGKPANQI-ALGQICRVVWLVPV 131

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
           MDR++   +  RRRFLDR+  + DP H    + +E+ MR RN+LL E   D  W   +EA
Sbjct: 132 MDRLWVEAAEGRRRFLDRIALSFDPAHAEASLTYEKSMRERNKLLKEQVRDPVWYRVLEA 191

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           QMA  G +I++AR   I  L  L  +   +  FP  +L L    +G+  QS    + E+ 
Sbjct: 192 QMAASGHRIHMARTHAIEKL--LDAQRKAETAFPVAELQLLQS-EGEMPQS----EAEFV 244

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
             L + R  D    RTLIGPHRSDL+  Y  K +     STGEQK +LV + LA+AR + 
Sbjct: 245 DALAENRSRDLSVGRTLIGPHRSDLLGHYAAKGVAAKDCSTGEQKALLVSLILANARALM 304

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
             TG  P++LLDE++AHLD ++R AL+  +  +G+Q +MTGT   +F  L + A+ + +S
Sbjct: 305 QETGAPPLVLLDEVAAHLDANRRQALYDEICALGAQAWMTGTGSELFAELKDRAQMLEVS 364

Query: 369 N 369
            
Sbjct: 365 E 365


>gi|89069839|ref|ZP_01157174.1| recombination protein F [Oceanicola granulosus HTCC2516]
 gi|89044640|gb|EAR50756.1| recombination protein F [Oceanicola granulosus HTCC2516]
          Length = 366

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 202/365 (55%), Gaps = 11/365 (3%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R+ I  L +S FR++    +  DA+     G NG GKTN+LEA+S LSPGRG RRA  A
Sbjct: 2   SRLAITRLTLSHFRSHKRAAVEVDARPVAIYGANGAGKTNLLEAVSILSPGRGLRRAGAA 61

Query: 63  DVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           ++TR      +   A V   +   +I    E    R VR     D        L + +R+
Sbjct: 62  EMTRRPETVGWKVTAEVAAPDRPHEIETWSEASAARQVRI----DGKAAAQVALGRVVRV 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL+PSMDR++   +  RRRFLDR V + D  H    + +E+ MR RNRLL +   D SW
Sbjct: 118 LWLIPSMDRLWIEGADGRRRFLDRAVLSFDADHAAETLAYEKAMRERNRLLKDEVRDPSW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
             ++EAQMA  G +I+  RVE++ AL+    +   +  FP   L+L    +G+      A
Sbjct: 178 YGALEAQMARAGARIHAGRVEVLAALAE--AQEGAETAFPVATLALEQS-EGELPGDEAA 234

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           L+E +A     GR  D  + RTL GPHR+DL   Y  K +     STGEQK +L+ + LA
Sbjct: 235 LRETFAA----GRGRDMAAGRTLAGPHRTDLAATYAAKDVPARDCSTGEQKALLISLILA 290

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           +AR ++  TG  P+LLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L + A
Sbjct: 291 NARALAARTGMPPLLLLDEVAAHLDAARRAALYEEIVALGAQAWMTGTGPELFAELGDRA 350

Query: 363 KFMRI 367
           + + +
Sbjct: 351 QRLEV 355


>gi|126730158|ref|ZP_01745970.1| recombination protein F [Sagittula stellata E-37]
 gi|126709538|gb|EBA08592.1| recombination protein F [Sagittula stellata E-37]
          Length = 364

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/363 (36%), Positives = 205/363 (56%), Gaps = 11/363 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +  L +S FR++  + +  D +     G NG GKTN++EA+S  SPGRG RRAS  D+ R
Sbjct: 3   LSHLTLSHFRSHKRVAIDVDLRPVAIWGPNGSGKTNLIEAVSLFSPGRGLRRASAQDMAR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 +     +EG +G  +I+   E    R+VR   I+D     V  L +  R  WL+
Sbjct: 63  RPESLGWKITGALEGPQGAHEIAFTSEGGGARAVR---IDDKPASQV-ALGRIARAVWLI 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P+MDR++   +  RRRFLDR+  +  P H +  +D+E+ MR RNRLL +   D  W +++
Sbjct: 119 PAMDRLWIEGAEGRRRFLDRIALSFFPDHAQAALDYEKAMRERNRLLKDMVRDPHWYTAL 178

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           E QMAE G  +++ R+  ++ ++    +   +  FP   L L    DG+   S   L+  
Sbjct: 179 ERQMAEAGAALHVNRLAALDRIAE--AQDGAETRFPAATLDLV-HGDGEMPGSAAELR-- 233

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
               L + RK D  + RTL+GPHR+DLI  + +K +  A  STGEQK +L+ + L++AR 
Sbjct: 234 --IALEESRKRDLAAGRTLVGPHRADLIGTFAEKGVLAADCSTGEQKALLISLILSNARA 291

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
           ++   G  PILLLDE++AHLD  +R ALF  +  +G+Q +MTGT   +F  L + A+ + 
Sbjct: 292 LAADEGHPPILLLDEVAAHLDAGRRAALFDEICALGAQAWMTGTGPELFAELGDRAQALE 351

Query: 367 ISN 369
           +S+
Sbjct: 352 VSD 354


>gi|296447171|ref|ZP_06889102.1| DNA replication and repair protein RecF [Methylosinus trichosporium
           OB3b]
 gi|296255336|gb|EFH02432.1| DNA replication and repair protein RecF [Methylosinus trichosporium
           OB3b]
          Length = 382

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 148/381 (38%), Positives = 211/381 (55%), Gaps = 32/381 (8%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +++ L +++FR+YA+L +   +      G+NG GKTNILEA+S  SPGRG R A  A+  
Sbjct: 11  RVRRLRLADFRSYAALDIAILSPLVALTGENGAGKTNILEALSLFSPGRGLRGAEIAEC- 69

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDR----------------SVRCLQINDVV 109
                      AR +G  G A +SI L++ DDR                  R  +I+ V 
Sbjct: 70  -----------ARRQGAGGFA-VSIDLDS-DDRLMQLGHGFEIGAPGETPARRFRIDRVP 116

Query: 110 IRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGR 169
           +        HLR  WL P+MD +F+G + +RRRFLDR+  ++D  H  R    ER +R R
Sbjct: 117 VSSARAFADHLRPLWLTPAMDGLFAGSAGDRRRFLDRLTMSVDAEHGARAARLERALRNR 176

Query: 170 NRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIM-EYVQKENFPHIKLSL 228
           NRLL E   DS W ++ E ++A L V +  AR + +  L +LI  E      FP  +LS+
Sbjct: 177 NRLLAEEQADSRWLTAAEREIAALAVAVAAARRDTVERLRALIAAERDDASPFPFAELSI 236

Query: 229 TGFLDGKF-DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
            G L+    ++    +++ Y   L   R+ D+ + RTL GP  SDL+V +  K       
Sbjct: 237 DGELERLVGEEPALRVEDHYRSVLAAMRRRDAAAGRTLSGPQASDLLVRHGPKDEAARAC 296

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           STGEQK +L G+ LAHARL++ TTG AP+LLLDEI+AH D  +R ALF  +  IG Q++M
Sbjct: 297 STGEQKALLTGLVLAHARLVAATTGTAPLLLLDEIAAHFDALRREALFEALARIGGQVWM 356

Query: 348 TGTDKSVFDSLNETAKFMRIS 368
           TG D  VFDSL   A  +R++
Sbjct: 357 TGADPRVFDSLTGRADLLRVT 377


>gi|148555709|ref|YP_001263291.1| recombination protein F [Sphingomonas wittichii RW1]
 gi|259563672|sp|A5VA37|RECF_SPHWW RecName: Full=DNA replication and repair protein recF
 gi|148500899|gb|ABQ69153.1| DNA replication and repair protein RecF [Sphingomonas wittichii
           RW1]
          Length = 356

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 137/361 (37%), Positives = 203/361 (56%), Gaps = 22/361 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +++FR+YAS  +       +  G+NG GKTNILEA+S L PGRG R A+ A++
Sbjct: 1   MTVARLMLTDFRSYASATIAAGPGFVVLTGENGAGKTNILEAVSMLGPGRGLRGAALAEM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV---RCLQINDVVIRVVDELNKHLR 121
            R G    F+  A       L+D  ++L T    +    R ++IN         L + L 
Sbjct: 61  AREGGAGGFAVAAE------LSD-EVRLGTGTTPAAPERRQVRINGAPASAT-ALGEWLS 112

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYFDS 180
           + WL P+MDR+F+  +  RRRFLDR+V AI+P H R +  ++  MR RN+LL  EG  D+
Sbjct: 113 LLWLTPAMDRLFTEGAEGRRRFLDRLVLAIEPGHARHVSRYDAAMRARNKLLAAEGPPDA 172

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +W  ++EAQ+ + G  I  AR   + AL+ L +       F    L++ G++  +     
Sbjct: 173 AWLDALEAQLGQHGQAIAEARARTVTALA-LRIAAEPDAPFARAALAIEGWVPSR----- 226

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
                  A++L  GR  D  + RTL GPHR DL V +  K    A  STGEQK +L+GI 
Sbjct: 227 ----RPLAEELRHGRARDVAAGRTLSGPHRQDLAVSHAAKQQPAARASTGEQKALLLGIV 282

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LAHA L++   G  PILL+DE++AHLD  +R ALF  +   G QI++TGT++++FD + E
Sbjct: 283 LAHADLVAERRGRRPILLMDEVAAHLDPVRRAALFERLGRSGGQIWLTGTERALFDGIGE 342

Query: 361 T 361
            
Sbjct: 343 A 343


>gi|254511198|ref|ZP_05123265.1| DNA replication and repair protein RecF [Rhodobacteraceae bacterium
           KLH11]
 gi|221534909|gb|EEE37897.1| DNA replication and repair protein RecF [Rhodobacteraceae bacterium
           KLH11]
          Length = 365

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 136/371 (36%), Positives = 208/371 (56%), Gaps = 23/371 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++   RL  D +     G NG GKTNILEA+S  SPGRG RRAS A++
Sbjct: 3   LALTELTVSHFRSHKLARLFLDGRPVALHGPNGAGKTNILEAVSLFSPGRGIRRASAAEM 62

Query: 65  TRIGSPSFF----STFARVEGMEGLADISIKLET-RDDRSVRCLQINDVVIRVVDELNKH 119
           TR   P       S   R +G       S ++ET  +  + R +++++     +D L + 
Sbjct: 63  TR--RPEALGWKLSGVLRAQGQ------SFEVETWSEGGAARQVRVDEKAASQID-LGRL 113

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
            R+ WL+PSMDR++   +  RRRFLDR+  + +P H +  + +E+ MR RNRLL E   D
Sbjct: 114 TRVVWLIPSMDRLWIEGAEGRRRFLDRIALSFEPSHAQASLTYEKAMRERNRLLKEQVRD 173

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQ 238
           + W +++E QMAE+G +I+  R   + AL  L     Q E  FP   L L      + + 
Sbjct: 174 AHWYAALEGQMAEMGHRIHSTR---LTALEHLRAAQDQAETAFPSADLELV-----QTEG 225

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +     E+  + L + R  D  + RTL+GPHRSDL   +  K +     STGEQK +LV 
Sbjct: 226 AMPETAEDLHEALNESRFRDLAAGRTLVGPHRSDLYGVFAAKGVPAKDCSTGEQKALLVS 285

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + L++AR ++   G  PI+LLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L
Sbjct: 286 LILSNARALAAMVGAPPIVLLDEVAAHLDAGRRAALYDEICALGAQAWMTGTGPELFAEL 345

Query: 359 NETAKFMRISN 369
            + A+ + +S+
Sbjct: 346 GDRAQTLIVSD 356


>gi|254295378|ref|YP_003061401.1| DNA replication and repair protein RecF [Hirschia baltica ATCC
           49814]
 gi|254043909|gb|ACT60704.1| DNA replication and repair protein RecF [Hirschia baltica ATCC
           49814]
          Length = 396

 Score =  232 bits (592), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 137/379 (36%), Positives = 213/379 (56%), Gaps = 10/379 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I+ L +  FRN+AS  L  DA+     G NG GKTN+LEA+S L PG+G R AS   +
Sbjct: 20  LTIQRLALHNFRNHASTVLEMDARPVCLFGANGAGKTNLLEAVSMLGPGKGLRAASLPSL 79

Query: 65  TRI-GSPSFFSTFARVEGMEGLA---DISIKLE-TRDDRSVRCLQINDVVIRVVDELNKH 119
            R+    S    +A    M+       IS+ L+ + D R+ R  +++D  +   + L + 
Sbjct: 80  VRVEAGESVVGGWAISARMDDAGLDRQISVGLDVSPDGRTRRVAKLDDAPVSQTN-LAEL 138

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           +R+ WL P+MDR+F+G + +RR+F DR V A  P H      +E+ MR RN L  +G  D
Sbjct: 139 VRVVWLTPAMDRVFAGPAGDRRKFYDRQVLAHVPAHGSASAAYEKAMRERNALFEQGRMD 198

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ- 238
           +SW  ++EA++AE G  I + R   +  + + I +   + +FP   LS+ G  +    Q 
Sbjct: 199 ASWLDALEARLAEAGAAIAVNRATALKRIQAAI-DARPEGHFPKADLSIAGKFEAMALQG 257

Query: 239 -SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            S  A++   +  L  GR  DS++ RTL G HRSDL V +  K +  A  STGEQK +L+
Sbjct: 258 DSQAAIEGAISDSLKVGRARDSVAGRTLAGVHRSDLQVVHRPKQLPAAQCSTGEQKALLM 317

Query: 298 GIFLAHAR-LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           G+ LA+A+ L+       P+LLLDE +AHLD  +R AL+  +  +G Q ++TGTD ++FD
Sbjct: 318 GMILANAKALLEGDFAPNPLLLLDEAAAHLDSVRRAALYDELAALGGQAWLTGTDAALFD 377

Query: 357 SLNETAKFMRISNHQALCI 375
           +  + A+   + N Q + +
Sbjct: 378 AFGDRAQRFCVENGQVIKV 396


>gi|323137241|ref|ZP_08072320.1| DNA replication and repair protein RecF [Methylocystis sp. ATCC
           49242]
 gi|322397599|gb|EFY00122.1| DNA replication and repair protein RecF [Methylocystis sp. ATCC
           49242]
          Length = 391

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 209/366 (57%), Gaps = 11/366 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L +S+FR+YA  R   +A+     G+NG GKTN+LEA+S  SPGRG RRA  A+  R
Sbjct: 26  VRRLTLSDFRSYAQARCDIEARLVALSGENGAGKTNVLEALSMFSPGRGLRRAELAECAR 85

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLE---TRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
                 F+    +E    +  ++ +L    T D    R  +I+   I        H+R+ 
Sbjct: 86  RDGAGGFAVSIEIE----IGGVTTQLGHGLTEDGE--RRFRIDRAPIGSARAFADHIRVL 139

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P+MD +F+G + ERRRFLDR+   +D  H  R+   ER +R RNRLL EG  D  W 
Sbjct: 140 WLTPAMDGLFAGPAGERRRFLDRLALGVDADHGARVNRLERALRNRNRLLEEGVSDRRWL 199

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC-A 242
            + E ++A +GV    AR E ++ LS+LI    +   FP  ++++ G ++    ++   A
Sbjct: 200 DAAEQEIASIGVAAAAARRETVSRLSALIASGGESP-FPWAEIAIQGEIETMLAEAPALA 258

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++ + + L   R+ D+ + RTL GP  SDL V +  K       STGEQK +L+G+ LA
Sbjct: 259 VEDRFREMLAATRRRDAAAGRTLTGPQTSDLAVRHGPKNEAARDCSTGEQKALLMGLTLA 318

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HARL++  T  AP+LLLDE++AH D  +R ALF  +  +G Q++MTG D  +F SL   A
Sbjct: 319 HARLVTAMTRKAPLLLLDEVAAHFDVKRREALFDELESLGGQVWMTGADPLLFASLQGRA 378

Query: 363 KFMRIS 368
           + ++++
Sbjct: 379 EMLQVT 384


>gi|56695076|ref|YP_165423.1| recombination protein F [Ruegeria pomeroyi DSS-3]
 gi|56676813|gb|AAV93479.1| DNA replication and repair protein RecF [Ruegeria pomeroyi DSS-3]
          Length = 366

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 143/370 (38%), Positives = 206/370 (55%), Gaps = 17/370 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  + IS FR++  LRL  D +     G NG GKTNILEA+S  SPGRG RRAS A++
Sbjct: 3   LALTAITISHFRSHRLLRLSLDERPVAIHGPNGAGKTNILEAVSMFSPGRGMRRASAAEM 62

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           TR   P         E + G     I+  + +  + R ++I+D     V  L + +R+ W
Sbjct: 63  TR--RPEVLGWKLSAELVAGHQRHEIETWS-EGGAARQVRIDDKAASQV-ALGRLVRMVW 118

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVPSMDR++      RRRFLDRM  + +P H   ++ +E+ MR RNRLL E   D+ W  
Sbjct: 119 LVPSMDRLWIEGPEGRRRFLDRMTMSFEPDHAEAVLVYEKAMRERNRLLREQVRDAHWYL 178

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E QMA  G +I+ AR   + AL++       + +FP  +L L    +G   +S   L+
Sbjct: 179 ALETQMAAAGHRIHAARQSTLTALAAAQT--QAETSFPTAELELIQ-TEGALPESEGDLR 235

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E  A+  F     D  + RTL+GPHRSDL   Y  K +  +  STGEQK +LV + LA+A
Sbjct: 236 EALAESRF----RDLAAGRTLVGPHRSDLYGVYAAKGVPASDCSTGEQKALLVSLILANA 291

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G  P+LLLDEI+AHLD  +R AL+  +  +G+Q +MTGT   +F  L   A+ 
Sbjct: 292 RALARQVGAPPVLLLDEIAAHLDAGRRAALYDEICALGAQAWMTGTGPELFSELGARAQT 351

Query: 365 MRISNHQALC 374
           +      ALC
Sbjct: 352 I------ALC 355


>gi|56552480|ref|YP_163319.1| recombination protein F [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762427|ref|ZP_04760505.1| DNA replication and repair protein RecF [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|56544054|gb|AAV90208.1| DNA replication and repair protein RecF [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373021|gb|EER62679.1| DNA replication and repair protein RecF [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 376

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 208/372 (55%), Gaps = 18/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L++ +FR++  +RL  +A   I  G+NGVGKTNILEAIS LSPGRGFR +   D+ R
Sbjct: 3   ISGLSLHDFRSHQQIRLQAEAGLVILTGENGVGKTNILEAISLLSPGRGFRGSPLPDLVR 62

Query: 67  IGSPSFFSTFARVEGMEG---LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
                 F+  A++  +E    +  ++I +      S R +++N V     + L++ L I 
Sbjct: 63  REGEGGFAISAKLHPLESSGRIDPVTIGIGLAPRASSRQVRVNGVTTSA-NALSEWLAIL 121

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYFDSSW 182
           WL P+MDR+F   +  RRRFLDR+   I P H R    +E  MR RN+LL+ E  +D  W
Sbjct: 122 WLTPAMDRLFQEGASSRRRFLDRLTLTIFPSHARHYSRYEAAMRQRNKLLSDEKGYDPLW 181

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN--FPHIKLSLTGFLDGK----- 235
              +E  MAE    I +AR ++++ LS    E  ++E+  F    L+L   +D +     
Sbjct: 182 LDGLEQIMAEQATHILLARRQLVDLLSE---EIAKQEDGLFAKADLALEEGVDSRDLVTH 238

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
             +    L +   +K    R  D+   RTL G HR+DL V +  KA+  A  STGEQK +
Sbjct: 239 NSEEIMPLLQNIWQK---SRTSDAAIGRTLQGVHRADLKVTHHAKAMPAAQSSTGEQKAL 295

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+G+ LA   LI+   G  P+LLLDE++AHLD  +R  LF I+   G Q++MTGT+ S+F
Sbjct: 296 LLGLVLAQVNLITEKNGQPPVLLLDEVAAHLDPSRRAILFDILRSKGGQVWMTGTEPSLF 355

Query: 356 DSLNETAKFMRI 367
           ++  E A + ++
Sbjct: 356 ETAGEAACYFQL 367


>gi|197106846|ref|YP_002132223.1| recombinational DNA repair ATPase [Phenylobacterium zucineum HLK1]
 gi|196480266|gb|ACG79794.1| recombinational DNA repair ATPase [Phenylobacterium zucineum HLK1]
          Length = 377

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 140/373 (37%), Positives = 206/373 (55%), Gaps = 14/373 (3%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R  +  L++++FR+YAS  L  D +     G NG GKTN+LEA+SFL PGRG R AS A+
Sbjct: 2   RTALTRLSLTDFRSYASAELALDGRPVWLAGPNGSGKTNLLEAVSFLIPGRGLRGASIAE 61

Query: 64  VTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDE------LN 117
           V R            V      A   ++L T     V     +  V+RV  E      L 
Sbjct: 62  VGRRLPGETVGRAWAVSATVAAAGDEVRLGT----GVEQPGASRRVVRVDGEPAPPGRLA 117

Query: 118 KHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY 177
           +H+R  WL P+ DR+F   + ERRRFLDR+VFA +P H   +  +E+ MR R RLLTEG 
Sbjct: 118 EHMRQVWLTPAQDRLFLEGAGERRRFLDRLVFAAEPGHAAHVQAYEKAMRERMRLLTEGP 177

Query: 178 FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD--GK 235
            D +W  ++EA++AE G  +  +R   + AL++ I    ++  FP  +LSLTG  +    
Sbjct: 178 ADPTWLDALEARLAEAGALMADSRSRTLAALAAEIGARGER-PFPQARLSLTGAWEQMAA 236

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
                  ++   A+ L + R  D+ + R L GPHR DL V + +K    A  STGEQK +
Sbjct: 237 EGAGIADVEARLARALREARDRDAAAGRALTGPHRGDLAVVHAEKDRAAAECSTGEQKAL 296

Query: 296 LVGIFLAHARLISNT-TGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           ++ + LA A  ++   +  AP+LLLDE++AHLD  +R ALF  +  +G Q F+TGTD+ +
Sbjct: 297 ILNLVLAQAARLARADSAPAPVLLLDEVAAHLDRVRRAALFDEIEALGLQAFLTGTDEHL 356

Query: 355 FDSLNETAKFMRI 367
           F++L    +  R+
Sbjct: 357 FEALAGRGQGWRM 369


>gi|310816809|ref|YP_003964773.1| recombination protein F [Ketogulonicigenium vulgare Y25]
 gi|308755544|gb|ADO43473.1| recombination protein F [Ketogulonicigenium vulgare Y25]
          Length = 370

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 135/368 (36%), Positives = 197/368 (53%), Gaps = 12/368 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L FD +   FVG NG GKTN++EAIS LSPGRG RRA   D+
Sbjct: 4   LALNALKLSHFRSHKRAELAFDGRPVAFVGSNGAGKTNLIEAISLLSPGRGLRRAVTEDL 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +   A +  +    ++       + R+VR   I+D     V  L   + I W
Sbjct: 64  ARRPESVGWKVQASLTRLHESHEVETAAAPGESRTVR---IDDKPAPQV-ALAAIMPIVW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP+MDR++   +  RRRFLDRMV +  P H    +++E+ MR RNRLL +G  D+ W +
Sbjct: 120 LVPAMDRLWIEAAEGRRRFLDRMVMSFAPDHAALALEYEKAMRQRNRLLKDGVRDAHWYA 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           +IE  MA+ G ++   R+ +I  L     +      FP   L+LT       D++     
Sbjct: 180 AIERIMAKSGAEMTRNRLALIERLRD--AQASADTAFPAADLTLTSEGPSPVDEA----- 232

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
              A  L   R  D ++ R+L+GPHR+DL   +  K +  A  STGEQK +L+ + LA+ 
Sbjct: 233 -ALADALEGSRPRDLLAGRSLVGPHRADLSAIWQAKGMIAADCSTGEQKALLISLVLANG 291

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G APILLLDE+SAHLD  +R AL+  +T +  Q FMTGT+  +F  L   A+ 
Sbjct: 292 RALAEDRGVAPILLLDEVSAHLDAARRAALYDEITAMAGQTFMTGTEVQLFAGLGPRAQG 351

Query: 365 MRISNHQA 372
             +    A
Sbjct: 352 FAVEEGPA 359


>gi|149202935|ref|ZP_01879906.1| recombination protein F [Roseovarius sp. TM1035]
 gi|149143481|gb|EDM31517.1| recombination protein F [Roseovarius sp. TM1035]
          Length = 369

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 203/361 (56%), Gaps = 13/361 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FR++ S RL+ DA+     G NG GKTN++EAIS LSPGRG RRA+  D+ R   
Sbjct: 9   LTLSHFRSHKSGRLLLDARPVAIHGPNGAGKTNLIEAISLLSPGRGLRRAAAQDMARRPE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              +   A +  +  + ++    E    R VR     D        L +  R+ WLVP+M
Sbjct: 69  ALGWKITAILNSLHQVHEVETFAEGTAARQVRI----DSKTATQLALGRIARLLWLVPAM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR++   +  RRRFLDRM  +  P H    + +++ MR RNRLL +   D+ W  ++E Q
Sbjct: 125 DRLWIEGADGRRRFLDRMTMSFIPAHAEVTLAYDKAMRERNRLLKDQVRDAQWYLALERQ 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           MA+ G +I+  R    +AL+ ++   +Q E  FP  +L LT   +G+   S   L++  A
Sbjct: 185 MADAGAEIHANRQ---HALALIMGAQMQAETAFPTAELELTQT-EGEMPDSADDLRQALA 240

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           +  F     D M+ RTLIGPHR+DL   Y  K +  A  STGEQK +LV + LA+AR ++
Sbjct: 241 ESRF----RDLMAGRTLIGPHRADLYGVYAAKGVPAADCSTGEQKALLVSLILANARALA 296

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
              G  P+LLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L   A+ + ++
Sbjct: 297 RDFGAPPLLLLDEVAAHLDATRRAALYDEICALGAQAWMTGTGPELFSELGNRAQHIHVT 356

Query: 369 N 369
           +
Sbjct: 357 D 357


>gi|99079844|ref|YP_611998.1| recombination protein F [Ruegeria sp. TM1040]
 gi|99036124|gb|ABF62736.1| DNA replication and repair protein RecF [Ruegeria sp. TM1040]
          Length = 357

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 138/359 (38%), Positives = 205/359 (57%), Gaps = 13/359 (3%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +S FR++    L  D +     G+NG GKTNILEA+S  SPGRG RRAS AD+ R   P 
Sbjct: 1   MSHFRSHLRADLHLDTRPVAIHGNNGAGKTNILEAVSLFSPGRGLRRASAADMAR--QPE 58

Query: 72  FFSTFARVEGMEGLADISIKLETRDD-RSVRCLQINDVVIRVVDELNKHLRISWLVPSMD 130
                 ++ G+   +  + ++ET  +  + R ++I++     V  L +  R+ WLVP+MD
Sbjct: 59  ALGW--KLRGVLQSSGQAYEVETSSEVGNARQVKIDNKSASQV-ALGRIARVVWLVPAMD 115

Query: 131 RIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQM 190
           R++   +  RRRFLDR+  + DP H    + +E+ MR RNRLL +   D++W   +E QM
Sbjct: 116 RLWIEGAEGRRRFLDRIALSFDPDHAEASLSYEKAMRERNRLLKDNVRDAAWYRVLEGQM 175

Query: 191 AELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKK 250
           AE G +I+ AR++ +  L++   +   +  FP  +L L    +G    S  AL+E     
Sbjct: 176 AETGFRIHQARMDAVARLTA--AQAEAETAFPVAQLQLV-QAEGDMPASAEALRE----M 228

Query: 251 LFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNT 310
           L  GR  D    RTL+GPHRSDLI  +  K +     STGEQK +LV + LA+AR +   
Sbjct: 229 LDAGRMRDLTVGRTLVGPHRSDLIGTFLAKGLPAKDCSTGEQKALLVSLILANARALQAQ 288

Query: 311 TGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
            G APILLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L   A+ + +S+
Sbjct: 289 EGAAPILLLDEVAAHLDAGRRAALYDEICALGTQAWMTGTGPELFQELGSRAQHLTVSD 347


>gi|83855144|ref|ZP_00948674.1| recombination protein F [Sulfitobacter sp. NAS-14.1]
 gi|83842987|gb|EAP82154.1| recombination protein F [Sulfitobacter sp. NAS-14.1]
          Length = 365

 Score =  229 bits (584), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 139/361 (38%), Positives = 199/361 (55%), Gaps = 16/361 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FR++    +  DA+     G NG GKTNILEA+S LSPGRG RR+S +D+TR   
Sbjct: 9   LTLSHFRSHKRAVIHCDARPVSIFGPNGAGKTNILEAVSLLSPGRGLRRSSASDMTRRPE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              +   A +  +  + ++ I  E    R VR     D        L +  R+ WL+PSM
Sbjct: 69  ALGWKITAHLHSLGQIHEVEIWSEAGAARQVRI----DGKATAQTGLGRIARVLWLIPSM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR++   +  RRRFLDRM  +  P H  + + +E+ MR RNRLL +   + SW  ++E Q
Sbjct: 125 DRLWIEGAEGRRRFLDRMTLSFLPDHADQSLAYEKAMRERNRLLKDMVREPSWYVALEQQ 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           MAE G  I+  RV  + A++       Q E  FP      T  LD   D    A  E   
Sbjct: 185 MAEAGSAIHANRVAALQAITE---AQAQAETAFP------TATLDLICDMPPTA--EGLR 233

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           + L D R  D  + RTLIGPHR+DL   Y  K +     STGEQK +LV + LA+AR ++
Sbjct: 234 QALADNRMRDLSAGRTLIGPHRADLEGVYAAKDVPARDCSTGEQKALLVSLILANARALA 293

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
              G  P+LLLDE++AHLD D+R AL+  ++ +G+Q +MTGT + +FD+L   A+ + ++
Sbjct: 294 ADFGAPPLLLLDEVAAHLDADRRAALYDELSALGAQAWMTGTGEELFDTLGPRAQRLEVT 353

Query: 369 N 369
            
Sbjct: 354 E 354


>gi|254467269|ref|ZP_05080680.1| DNA replication and repair protein RecF [Rhodobacterales bacterium
           Y4I]
 gi|206688177|gb|EDZ48659.1| DNA replication and repair protein RecF [Rhodobacterales bacterium
           Y4I]
          Length = 365

 Score =  228 bits (582), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 202/377 (53%), Gaps = 35/377 (9%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    L FD +     G+NG GKTNILEA+S  SPGRG RRAS A++
Sbjct: 2   LALTALTLSHFRSHLRAELRFDGRPVAIYGNNGAGKTNILEAVSLFSPGRGLRRASAAEM 61

Query: 65  TRIGSPSFFSTFARVE------------GMEGLADISIKLETRDDRSVRCLQINDVVIRV 112
            R   P       + E              EG A   +K+   D++S   L +  V    
Sbjct: 62  AR--QPEALGWKLKGELRAPRQAYEVETWSEGGAARQVKI---DNKSASQLALGQVA--- 113

Query: 113 VDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRL 172
                   R+ WL+P+MDR++   +  RRRFLDR+  + +P H    + +E+ MR RNRL
Sbjct: 114 --------RVVWLIPAMDRLWIEAAEGRRRFLDRIALSFEPGHAEASLVYEKAMRERNRL 165

Query: 173 LTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFL 232
           L E   D++W   +E +MA  G +I+ ARV+ +  L     E   +  FP  +L L    
Sbjct: 166 LKEQVRDAAWYRVLEDRMAAAGHRIHAARVQAVELLQQAQAEA--ETAFPAAELELL--- 220

Query: 233 DGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
             + + S  + + ++ + L + R  D  + RTL+GPHR+DL+  Y  K I     STGEQ
Sbjct: 221 --QSEGSMPSSETDFKEALEESRFRDLAAGRTLVGPHRTDLLGTYRAKGIPAKDCSTGEQ 278

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           K +LV + LA+AR ++   G  PILLLDE++AHLD  +R AL+  +  +G+Q +MTGT  
Sbjct: 279 KALLVSLILANARALAQREGAPPILLLDEVAAHLDAGRRAALYDEICALGTQAWMTGTGP 338

Query: 353 SVFDSLNETAKFMRISN 369
            +F  L   A+ + +S+
Sbjct: 339 ELFAELEGRAQVLEVSD 355


>gi|260753853|ref|YP_003226746.1| recombination protein F [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258553216|gb|ACV76162.1| DNA replication and repair protein RecF [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 376

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/372 (37%), Positives = 208/372 (55%), Gaps = 18/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L++ +FR++  +RL  +A   I  G+NGVGKTNILEAIS LSPGRGFR +   D+ R
Sbjct: 3   ISGLSLHDFRSHQQIRLQAEAGLVILTGENGVGKTNILEAISLLSPGRGFRGSPLPDLVR 62

Query: 67  IGSPSFFSTFARVEGMEG---LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
                 F+  A++  +E    +  ++I +      S R +++N V     + L++ L I 
Sbjct: 63  REGEGGFAISAKLHPLESSGRIDPVTIGIGLAPRASSRQVRVNGVTTSA-NALSEWLAIL 121

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYFDSSW 182
           WL P+MDR+F   +  RRRFLDR+   I P H R    +E  MR RN+LL+ E  +D  W
Sbjct: 122 WLTPAMDRLFQEGASSRRRFLDRLTLTIFPSHARHYSRYEAAMRQRNKLLSDEKGYDPLW 181

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN--FPHIKLSLTGFLDGK----- 235
              +E  MAE    I +AR ++++ LS    E  ++E+  F    L+L   +D +     
Sbjct: 182 LDGLEQIMAEQATHILLARRQLVDLLSE---EIAKQEDGLFAKADLALEEGVDSRDLVTH 238

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
             +    L +   +K    R  D+   RTL G HR+DL V +  KA+  A  STGEQK +
Sbjct: 239 NSEEIMPLLQNIWQK---SRTSDAAIGRTLQGVHRADLKVTHHAKAMPAAQSSTGEQKAL 295

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+G+ LA   LI+   G  P+LLLDE++AHLD  +R  LF I+   G Q++MTGT+ S+F
Sbjct: 296 LLGLVLAQVNLITEKNGQPPVLLLDEVAAHLDPSRRAILFDILRSKGGQVWMTGTEPSLF 355

Query: 356 DSLNETAKFMRI 367
           ++  + A + ++
Sbjct: 356 ETAEDAACYFQL 367


>gi|84684519|ref|ZP_01012420.1| recombination protein F [Maritimibacter alkaliphilus HTCC2654]
 gi|84667498|gb|EAQ13967.1| recombination protein F [Rhodobacterales bacterium HTCC2654]
          Length = 371

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 130/365 (35%), Positives = 198/365 (54%), Gaps = 9/365 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ L +S FR++    L  DA+     G NG GKTNILEA+S +SPGRG R AS  D+
Sbjct: 4   LYLRELTLSHFRSHRRAVLSLDARPIAIFGRNGAGKTNILEAVSLMSPGRGLRGASAEDM 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +     ++ +  + ++    E    R+V      D        L +  R++W
Sbjct: 64  ARRPESVGWKLTGVLQSLHQVHEVETWAEPGGSRNVTI----DGKTAAQVALGRISRVTW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVP MDR++   +  RR+FLDRM  + +P H   ++ +E+ MR RNRLL +G+ D+ W  
Sbjct: 120 LVPVMDRLWMEGADGRRKFLDRMAMSFEPGHGEAVLTYEKAMRDRNRLLKDGHRDAHWYG 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++EAQMA+ G  I   R   +  +    M    +  FP  +L L   L  +  ++    +
Sbjct: 180 ALEAQMAKAGAAIQENRRRTVALIVGAQMS--AQTAFPAAELQL---LHAEGAETGPEGE 234

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
            E A+   + R  D M+ RTL+GPHR+DL   Y +KA+     STGEQK +LV + LAH 
Sbjct: 235 AELAEAYAESRPRDLMAGRTLVGPHRADLAATYAEKAMPARECSTGEQKALLVSLILAHG 294

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G  P+LLLDE+SAHLD D+R AL+  +  +G+Q F+TGT   +F  L   A  
Sbjct: 295 RALAQDFGAPPMLLLDEVSAHLDADRRAALYDEIVALGAQAFLTGTGPELFTELGARAMH 354

Query: 365 MRISN 369
           + + +
Sbjct: 355 IEVRD 359


>gi|258542324|ref|YP_003187757.1| recombination protein F [Acetobacter pasteurianus IFO 3283-01]
 gi|256633402|dbj|BAH99377.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636461|dbj|BAI02430.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639514|dbj|BAI05476.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256642570|dbj|BAI08525.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256645625|dbj|BAI11573.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256648678|dbj|BAI14619.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256651731|dbj|BAI17665.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256654722|dbj|BAI20649.1| DNA replication and repair protein RecF [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 382

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 194/363 (53%), Gaps = 8/363 (2%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FRNY  L    DA   +  G+NG GKTN+LEA+S LSPGRG R A      R+G+
Sbjct: 17  LTLSNFRNYERLAWSPDASLLVLTGENGSGKTNLLEAVSLLSPGRGLRAAPLTQFGRMGA 76

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
            + +   AR+E  +   ++    +   +R  R   +N   IR  +     L   W+ P M
Sbjct: 77  -TNWGVSARIETEDEFLELGTGTQGGQERPRRVFLLNGRQIRGQEAWEDTLATVWITPQM 135

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR+FS  +  RRRFLDR+V A+ P H R +  ++R M  RNRLL   + + SW S +EA 
Sbjct: 136 DRLFSEGASGRRRFLDRLVMAVTPHHARELAAYDRAMTQRNRLLQTRFSEHSWLSGLEAS 195

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKE--NFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           MA   V +  AR E +      I  Y Q     FP    +L   +  K + S     E++
Sbjct: 196 MARHAVAVAAARQETVRQ----ICHYAQNGLGAFPAAIATLECAVAQKLETSPALAVEDW 251

Query: 248 AK-KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
            + KL D R+ D+   R   G HRSD +++        A  STG+QK +L+G+ LAHARL
Sbjct: 252 LREKLADLREDDAARGRATFGTHRSDFLLEDLTSRQPAALASTGQQKSLLIGVVLAHARL 311

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
           +++  G  PILLLDE   HLD  +R +L  IV D  + + +TGTD++ F  L +TA+F  
Sbjct: 312 VTDYRGQPPILLLDEPLVHLDAARRASLLEIVQDFRTTVLLTGTDQAPFAPLKQTAQFET 371

Query: 367 ISN 369
           + N
Sbjct: 372 LKN 374


>gi|23428630|gb|AAM12398.1| recombinase F [Zymomonas mobilis subsp. mobilis CP4]
          Length = 376

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/372 (37%), Positives = 208/372 (55%), Gaps = 18/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L++ +FR++  +RL  +A   I  G+NGVGKTNILEAIS LSPGRGFR +   D+ R
Sbjct: 3   ISGLSLHDFRSHQQIRLQAEAGLVILTGENGVGKTNILEAISLLSPGRGFRGSPLPDLVR 62

Query: 67  IGSPSFFSTFARVEGMEG---LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
                 F+  A++  +E    +  ++I +      S R +++N V     + L++ L I 
Sbjct: 63  REGDGGFAISAKLHPLESSGRIDPVTIGIGLAPRASSRQVRVNGVTTSA-NALSEWLAIL 121

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYFDSSW 182
           WL P+MDR+F   +  RRRFLDR+   I P H R    +E  +R RN+LL+ E  +D  W
Sbjct: 122 WLTPAMDRLFQEGASSRRRFLDRLTLTIFPSHARHYSRYEAAIRQRNKLLSDEKGYDPLW 181

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN--FPHIKLSLTGFLDGK----- 235
              +E  MAE    I +AR ++++ LS    E  ++E+  F    L+L   +D +     
Sbjct: 182 LDGLEQIMAEQATHILLARRQLVDLLSE---EIAKQEDGLFAKADLALEEGVDSRDLVTH 238

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
             +    L +   +K    R  D+   RTL G HR+DL V +  KA+  A  STGEQK +
Sbjct: 239 NSEEIMPLLQNIWQK---SRTSDAAIGRTLQGVHRTDLKVTHHAKAMPAAQSSTGEQKAL 295

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+G+ LA   LI+   G  P+LLLDE++AHLD  +R  LF I+   G Q++MTGT+ S+F
Sbjct: 296 LLGLVLAQVNLITEKNGQPPVLLLDEVAAHLDPSRRAILFDILRSKGGQVWMTGTEPSLF 355

Query: 356 DSLNETAKFMRI 367
           ++  E A + ++
Sbjct: 356 ETAGEAACYFQL 367


>gi|126734080|ref|ZP_01749827.1| DNA replication and repair protein RecF, putative [Roseobacter sp.
           CCS2]
 gi|126716946|gb|EBA13810.1| DNA replication and repair protein RecF, putative [Roseobacter sp.
           CCS2]
          Length = 366

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 191/365 (52%), Gaps = 15/365 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    +  DA+     G NG GKTN+LEA S LSPGRG RRA   D+
Sbjct: 4   LALTELTLSHFRSHKRAAITLDARPLAIFGPNGAGKTNVLEAASLLSPGRGLRRAGADDL 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           TR      +   A ++ +    +I    E  + R +R     D        L +  RI W
Sbjct: 64  TRRPEALGWKITAILQSLHQTHEIETWAEAGNPRQLRI----DGKAAPQTALGRIARILW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVPSMDR++   +  RRRFLDR   + +P H   ++ +++ MR RNRLL +   D  W +
Sbjct: 120 LVPSMDRLWIEGAEGRRRFLDRATLSFEPTHAEAVLTYDKAMRERNRLLKDMVRDPHWYT 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           +IE QMAE G  I   R   I  L++   +      FP   L+LT         S   + 
Sbjct: 180 AIEGQMAEAGAAIQKNRHRAIAELTT--AQEAATTAFPTAMLTLT---------SAEPIP 228

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           +     L D R  D  + RTLIGPHR+DL   + DK +     STGEQK +L+ + LA+ 
Sbjct: 229 DNLQTALADNRNRDMAAGRTLIGPHRADLDAVFADKGVPAKDCSTGEQKALLISLILANG 288

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G  PILLLDE++AHLD  +R AL+  +  +G+Q FMTGT   +F  L   A++
Sbjct: 289 RALARDFGAPPILLLDEVAAHLDAARRAALYDEICSLGAQAFMTGTGAELFAELGRRAQY 348

Query: 365 MRISN 369
           + ++ 
Sbjct: 349 VEVTE 353


>gi|332188891|ref|ZP_08390596.1| DNA replication and repair RecF family protein [Sphingomonas sp.
           S17]
 gi|332011073|gb|EGI53173.1| DNA replication and repair RecF family protein [Sphingomonas sp.
           S17]
          Length = 347

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 200/350 (57%), Gaps = 23/350 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRN+A L L   A   +  G+NG GKTN+LEA+S L+PGRG RRA+ + + R G 
Sbjct: 5   LVLTDFRNHADLALNPGAGFVVLTGENGAGKTNVLEAVSLLAPGRGLRRAALSAMARQGG 64

Query: 70  PSFFSTFARVEGMEGLADISIK---LETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
              F   A + G     D+ I    L +  +R V  +Q         + L   L + WL 
Sbjct: 65  KGGFGVAATLNG-----DVEIATGALPSAPERRVVRVQGAGAS---ANALADWLSVLWLT 116

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P+MDR+F   + ERRRFLDR+V A+ P H      ++  MR RNRLL ++G  D  W S+
Sbjct: 117 PAMDRLFVEPASERRRFLDRLVLALAPAHGMHATRYDAAMRERNRLLASDGPVDPDWLSA 176

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +EA+M E G  ++ ARV  + AL    +E V    F    L+L G      D +      
Sbjct: 177 LEARMVEHGAALDAARVAAVAALDQR-LEEVPDSVFARASLALEGE---AVDPA------ 226

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
            +A  L  GR+ D+ + RTL+GPHR+DL+V +  K    A  STGEQK +L+GI LAHA 
Sbjct: 227 AFAHALAMGRRRDAAAGRTLVGPHRADLLVTHVAKGQAAALCSTGEQKALLLGIVLAHAD 286

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L++   G AP+LLLDE++AHLD  +R ALF  +   G Q++MTGT+ ++F
Sbjct: 287 LVTERRGAAPVLLLDEVAAHLDPSRRAALFERLAGRG-QVWMTGTEPALF 335


>gi|85705683|ref|ZP_01036780.1| recombination protein F [Roseovarius sp. 217]
 gi|85669673|gb|EAQ24537.1| recombination protein F [Roseovarius sp. 217]
          Length = 369

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 133/372 (35%), Positives = 209/372 (56%), Gaps = 25/372 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++ + RL  DA+     G NG GKTN++EA+S LSPGRG RRA+  D+
Sbjct: 4   LSLSELTLSHFRSHKAARLSLDARPVAIHGPNGAGKTNLIEAVSLLSPGRGLRRAAAQDM 63

Query: 65  TRIGSP------SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
            R          +   +  +V  +E  A+ S         + R L+I+      +  L +
Sbjct: 64  ARRPEALGWKITTILHSLHQVHEVETFAEGS---------AARQLRIDGKTATQI-ALGR 113

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
             R+ WLVP+MDR++   +  RRRFLDRM  +  P H    + +E+ MR RNRLL +   
Sbjct: 114 IARVLWLVPAMDRLWIEGAEGRRRFLDRMTMSFVPSHAEATLAYEKAMRERNRLLKDQVR 173

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFD 237
           D+ W  ++E Q+A+ G +I+  R    +AL+ +    +Q E  FP  +L LT   +G+  
Sbjct: 174 DAQWYLALERQLADAGAEIHANRQ---HALALIAGAQMQAETAFPTAELELTQ-TEGEMP 229

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
           ++     E+  + L + R  D ++ RTLIGPHR+DL   Y  K +  A  STGEQK +LV
Sbjct: 230 ET----AEDLRQALAESRFRDLVAGRTLIGPHRADLYGVYAAKGVPAADCSTGEQKALLV 285

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
            + LA+AR ++   G  P+LLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  
Sbjct: 286 SLILANARALARDFGAPPLLLLDEVAAHLDATRRAALYDEICALGAQAWMTGTGPELFSE 345

Query: 358 LNETAKFMRISN 369
           L + A+ + +++
Sbjct: 346 LGDRAQHIHVTD 357


>gi|254437923|ref|ZP_05051417.1| hypothetical protein OA307_2793 [Octadecabacter antarcticus 307]
 gi|198253369|gb|EDY77683.1| hypothetical protein OA307_2793 [Octadecabacter antarcticus 307]
          Length = 369

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/370 (35%), Positives = 200/370 (54%), Gaps = 13/370 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +  L +S FR++    L  D +     G NG GKTNILEA+S LSPGRG RRAS  D+TR
Sbjct: 6   LSHLTLSHFRSHKRATLDLDGRTVAIYGPNGAGKTNILEAVSILSPGRGLRRASSEDMTR 65

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 +   A +  +    +I    E    R  +     D        L +  R+ WL+
Sbjct: 66  RPEALGWKVTADLTSLNQRHEIESWSENGGSRQTKI----DGKAAAQTALGRIGRVLWLI 121

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P+MDR++   +  RRRFLDR   + +P H    + +E+ MR RNRLL +   D+ W S++
Sbjct: 122 PAMDRLWIEGAEGRRRFLDRATLSFEPGHADAALKYEKAMRERNRLLKDMVRDAHWYSAL 181

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           E QMA+ G +I+  R+E ++ L++   +   +  FP   L+LT       D +  A  + 
Sbjct: 182 ERQMADAGAQIHRNRLETLDLLTN--AQQAAQTAFPTAWLTLT-----HSDPACDAPDDP 234

Query: 247 YA--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
            A      + R  D  + RTLIGPHR+DL   +  K +     STGEQK +L+ + LA+A
Sbjct: 235 IALLAAFANNRPRDMAAGRTLIGPHRADLDAIFAAKDVPAKDCSTGEQKALLISLILANA 294

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R +++  G  PILLLDE++AHLD  +R AL+  ++ +G+Q FMTGT   +FD L   A++
Sbjct: 295 RALADDFGAPPILLLDEVAAHLDATRRAALYSEISALGAQAFMTGTGLELFDELGAAAQY 354

Query: 365 MRISNHQALC 374
           + +++   + 
Sbjct: 355 VHVTDENGVS 364


>gi|114798067|ref|YP_759290.1| DNA replication and repair protein RecF [Hyphomonas neptunium ATCC
           15444]
 gi|114738241|gb|ABI76366.1| DNA replication and repair protein RecF [Hyphomonas neptunium ATCC
           15444]
          Length = 370

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 135/370 (36%), Positives = 212/370 (57%), Gaps = 17/370 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++++FRNYA L L  DA+     G NG GKTN+LEA+S   PGRG R A  +++TR  +
Sbjct: 7   LSLTDFRNYAGLTLRLDARPVCLYGSNGAGKTNLLEAVSQFGPGRGLRSAQLSEMTRRDA 66

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
           P  ++  A ++  +    ISI L+T    + R ++I+       D L + +RI WL P+M
Sbjct: 67  PGGWALAATLDDEQ---KISITLDTAGT-AKRTVRIDGAPASPGD-LAERIRIVWLTPAM 121

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           D +F G + +RRRF DR+V A  P H +    +++ +  RN L+  G+ D +W  +IEA+
Sbjct: 122 DGVFRGGASDRRRFFDRLVMAHLPAHGKAAARYDKALAERNALIERGHVDPAWADAIEAR 181

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK------FDQSFCAL 243
           +AE G ++ I R  ++ AL  + ++   + +FP   L+L G  +        F   F  L
Sbjct: 182 LAEAGTEMAINRAIVLEAL-QIAIDARPEGHFPKADLTLEGAAEAAALKGEDFRTIFDLL 240

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            + Y      GR+ D  + RTL GPHR+DL V +   A      STG+QK +L+G+ LA 
Sbjct: 241 VDAY----HSGRRRDIGAGRTLSGPHRTDLAVIHRPTAAPAGEASTGQQKALLIGLVLAS 296

Query: 304 ARLIS-NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           A  +S   +G +P+LLLDE +AHLD D+R ALF  +T +G Q ++TGT+  +F++  + A
Sbjct: 297 ATALSAGGSGPSPLLLLDEAAAHLDPDRRAALFDELTVLGGQAWLTGTEAFLFEAFGDRA 356

Query: 363 KFMRISNHQA 372
           + +R+    A
Sbjct: 357 QRIRVDEGSA 366


>gi|85374625|ref|YP_458687.1| recombination protein F [Erythrobacter litoralis HTCC2594]
 gi|84787708|gb|ABC63890.1| recombinational DNA repair ATPase [Erythrobacter litoralis
           HTCC2594]
          Length = 361

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 194/362 (53%), Gaps = 14/362 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           + +S  RN+A  RL   A+  + VG+NG GKTN+LEAIS L+PGRG RRA+  D+ R G 
Sbjct: 6   ITLSNLRNHAETRLQGTARFNLLVGENGAGKTNVLEAISLLAPGRGLRRAALPDIARAGG 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNKHLRISWLVPS 128
              F+  A +   +G   + +       R   R +++N      V  L + L I WL P+
Sbjct: 66  GGGFTVGASLTPGDGGEPVQLGTMVDPARPGRRRVRVNGAEASAVS-LGEWLAIGWLTPA 124

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYFDSSWCSSIE 187
           MD IF G + +RRRF+DRM  A+DP H R    +E ++R RNRLL  E   D +W   IE
Sbjct: 125 MDGIFMGPAGDRRRFVDRMALALDPLHARHASRYENVLRERNRLLGDEREPDPTWLDGIE 184

Query: 188 AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           AQMA+ G  +  +R  ++  L   +  +  +   P  +  L    +  F++      E  
Sbjct: 185 AQMAKHGSALAQSRARLVGVLVETLASHPDE---PFARPLLAILTESPFEE------EAL 235

Query: 248 AKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLI 307
              L   R  D  + RTLIGPHR DL V    K    A  STGEQK +L+ I LAH  L 
Sbjct: 236 RVALRANRGRDRRAGRTLIGPHRDDLTVTMAGKDTPAASCSTGEQKAMLIAITLAHGELA 295

Query: 308 SNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
           +   G   ++LLDE++AH+D  +R ALF  + + G+Q++MTGT+ + F ++   A   R+
Sbjct: 296 AR--GRPGVMLLDEVAAHIDPVRREALFERLRETGAQVWMTGTELAPFAAIEAEAAVWRV 353

Query: 368 SN 369
           S 
Sbjct: 354 SG 355


>gi|254486983|ref|ZP_05100188.1| DNA replication and repair protein RecF [Roseobacter sp. GAI101]
 gi|214043852|gb|EEB84490.1| DNA replication and repair protein RecF [Roseobacter sp. GAI101]
          Length = 365

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 195/364 (53%), Gaps = 16/364 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +S FR++    +  D +     G NG GKTNILEA+S LSPGRG RR+S  D+TR
Sbjct: 6   ISHLTLSHFRSHKRAIVDSDTRPVAIHGPNGAGKTNILEAVSLLSPGRGLRRSSALDMTR 65

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 +   A +  +    +I I  E    R VR     D        L +  R+ WL+
Sbjct: 66  RPEALGWKVTALLHSLGSAHEIEIWSEAGAARQVRI----DGKATPQTALGRIARVLWLI 121

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           PSMDR++   +  RRRFLDRM  +  P H  + + +E+ MR RNRLL +   + SW  ++
Sbjct: 122 PSMDRLWIEGAEGRRRFLDRMTLSFLPDHAEQSLAYEKAMRERNRLLKDMVREPSWYLAL 181

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCALKE 245
           E Q+AE G  I+  R    +AL ++     Q E  FP   LSL        D    A  +
Sbjct: 182 EQQLAEAGAAIHANRQ---SALQAITEAQSQAETAFPTATLSLI------CDMPTTA--Q 230

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           +    L D R  D  + RTLIGPHR+DL   Y  K +     STGEQK +LV + LA+AR
Sbjct: 231 DLRAALADNRMRDLAAGRTLIGPHRADLEGVYAAKDVPARDCSTGEQKALLVSLILANAR 290

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
            ++   G  P+LLLDE++AHLD  +R AL+  +T +G+Q +MTGT   +FDSL   A+ +
Sbjct: 291 ALAADFGAPPLLLLDEVAAHLDASRRAALYDEITALGAQAWMTGTGAELFDSLGPRAQML 350

Query: 366 RISN 369
            ++ 
Sbjct: 351 EVTE 354


>gi|83941667|ref|ZP_00954129.1| recombination protein F [Sulfitobacter sp. EE-36]
 gi|83847487|gb|EAP85362.1| recombination protein F [Sulfitobacter sp. EE-36]
          Length = 365

 Score =  226 bits (575), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 137/361 (37%), Positives = 198/361 (54%), Gaps = 16/361 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FR++    +  D +     G NG GKTNILEA+S LSPGRG RR+S +D+TR   
Sbjct: 9   LTLSHFRSHKRAVIDCDTRPVSIFGPNGAGKTNILEAVSLLSPGRGLRRSSASDMTRRPE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              +   A +  +  + ++ I  E    R VR     D        L +  R+ WL+PSM
Sbjct: 69  ALGWKITAHLRSLGQIHEVEIWSEAGAARQVRI----DGKATAQTGLGRIARVLWLIPSM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR++   +  RRRFLDRM  +  P H  + + +E+ MR RNRLL +   + SW  ++E Q
Sbjct: 125 DRLWIEGAEGRRRFLDRMTLSFLPDHADQSLAYEKAMRERNRLLKDMVREPSWYVALEQQ 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           MAE G  I+  RV  + A++       Q E  FP      T  LD   D    A  E   
Sbjct: 185 MAEAGSAIHANRVAALQAITE---AQAQAETAFP------TATLDLICDMPTTA--EGLR 233

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           + L D R  D  + RTLIGPHR+DL   Y  K +     STGEQK +LV + LA+AR ++
Sbjct: 234 QALADNRMRDLSAGRTLIGPHRADLEGVYAAKDVPARDCSTGEQKALLVSLILANARALA 293

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
              G  P+LLLDE++AHLD ++R AL+  ++ +G+Q +MTGT + +FD+L   A+ + ++
Sbjct: 294 ADFGAPPLLLLDEVAAHLDANRRAALYDELSALGAQAWMTGTGEELFDTLGPRAQRLEVT 353

Query: 369 N 369
            
Sbjct: 354 E 354


>gi|89052494|ref|YP_507945.1| recombination protein F [Jannaschia sp. CCS1]
 gi|88862043|gb|ABD52920.1| DNA replication and repair protein RecF [Jannaschia sp. CCS1]
          Length = 375

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 199/367 (54%), Gaps = 13/367 (3%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +++ +  L +S FR++   R+  D +     G NG GKTN++EA+S LSPGRG RRA+  
Sbjct: 12  SKVFVSSLALSHFRSHRRARMELDGRPVALFGPNGAGKTNLMEAVSLLSPGRGLRRAAAE 71

Query: 63  DVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           ++ R      +   A + G     DI++  E    R+    Q++      +  L + LRI
Sbjct: 72  EIIRRPEAIGWKVSAEISGPSINHDITLTAEPGQPRTT---QVDGKTAPQI-ALARLLRI 127

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WLVPS DR++S  +  RRRFLDR+  +  P H   ++ +E+ MR RNRLL +   D +W
Sbjct: 128 VWLVPSQDRLWSEGAEGRRRFLDRITLSFLPDHADAVLTYEKAMRERNRLLRDDARDPAW 187

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
             ++EAQMA+  V+I   R + +  +S+   +      FP   L +         +  C 
Sbjct: 188 YRALEAQMADAAVRIVNGRDDALTRISA--AQNGAATAFPAADLGIE-------TEHPCQ 238

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             +++ +     R  D  + RTLIGPHR+D+   Y DK +     STGEQK +L+ + L+
Sbjct: 239 TVDDFIQAFEGSRPRDLAAGRTLIGPHRADMSAIYRDKGVPAKQCSTGEQKALLISLILS 298

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           +AR +   TG AP++LLDE++AHLD  +R ALF  +  + +Q +MTGT   +F  L + A
Sbjct: 299 NARALKAETGTAPLVLLDEVAAHLDAGRRAALFDEICALEAQAWMTGTGPELFAELGDRA 358

Query: 363 KFMRISN 369
           +   I+ 
Sbjct: 359 QHFEITE 365


>gi|114762140|ref|ZP_01441608.1| recombination protein F [Pelagibaca bermudensis HTCC2601]
 gi|114545164|gb|EAU48167.1| recombination protein F [Roseovarius sp. HTCC2601]
          Length = 369

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 197/371 (53%), Gaps = 11/371 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L +S FR++    +  DA+     G NG GKTN++EA+S LSPGRG RRAS  ++
Sbjct: 4   LHLSSLTLSHFRSHKRAAVEVDARPVAIFGPNGAGKTNLIEAVSLLSPGRGMRRASAQEM 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           TR      +   A + G EG ++IS++ E+   R V      D        L +  R+ W
Sbjct: 64  TRRPEALGWKIGAVLHGPEGASEISVRSESGGSRQVEI----DGKPAPQTALGRIARVLW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L+PSMDR++      RRRFLDRM  +  P H    + +E+ MR RNRLL E   D+ W +
Sbjct: 120 LIPSMDRLWIEAPEGRRRFLDRMTLSFFPDHADASLTYEKAMRERNRLLKEQIRDAHWYA 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E QMA+ G  I   +            +   + +FP   L+L        +      +
Sbjct: 180 ALETQMAQSGALIQ--QNRQAALARLARAQDGAETSFPAADLALV-----STEADIPETE 232

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+      +GR  D  + RTL+GPHRSDL   +  K +  +  STGEQK +L+ + LA+A
Sbjct: 233 EDLRAVFAEGRFRDMAAGRTLVGPHRSDLYGVFAAKGVPASDCSTGEQKALLISLILANA 292

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           R ++   G  P+LLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L + A+ 
Sbjct: 293 RALAAEIGAPPLLLLDEVAAHLDAGRRAALYDEICALGAQAWMTGTGPELFAELGDRAQR 352

Query: 365 MRISNHQALCI 375
           ++++      +
Sbjct: 353 LQVTEEAGQSV 363


>gi|149912810|ref|ZP_01901344.1| recombination protein F [Roseobacter sp. AzwK-3b]
 gi|149813216|gb|EDM73042.1| recombination protein F [Roseobacter sp. AzwK-3b]
          Length = 370

 Score =  223 bits (567), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 191/366 (52%), Gaps = 13/366 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I  L +S FR++   RL  DA+     G NG GKTNILEA+S  SPGRG RRA+  D+
Sbjct: 4   LHISRLTLSHFRSHKGARLDVDARPVAIYGPNGAGKTNILEAVSLFSPGRGLRRAAAQDM 63

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R      +     +  +  L ++ +  E    R  R     D        L +  R+ W
Sbjct: 64  ARRPEALGWKVTGILHSLHQLHEVELWSEEGAARQTRI----DGKPAAQTALGRIARVLW 119

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           LVPSMDR++   +  RRRFLDRM  +  P H    + +E+ MR RNRLL +   D+ W  
Sbjct: 120 LVPSMDRLWIEGTEGRRRFLDRMTLSFRPDHADISLTYEKAMRERNRLLKDQVRDAHWYV 179

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCAL 243
           ++E Q+AE G  I+  R   + AL  L     Q E  FP   L L        +      
Sbjct: 180 ALERQLAETGAAIHANR---LYALDQLREAQAQAETAFPAADLDLI-----STEADMPDT 231

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
             + A+ L + R  D  + RTLIGPHR+DL   Y  K +     STGEQK +LV + LA+
Sbjct: 232 PADLAEALAESRFRDLAAGRTLIGPHRADLYGVYAAKGVPARDCSTGEQKALLVSLILAN 291

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           AR ++   G  P+LLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L + A+
Sbjct: 292 ARALARDFGAPPLLLLDEVAAHLDAGRRAALYDEICALGAQAWMTGTGPELFSDLGDRAQ 351

Query: 364 FMRISN 369
           ++ ++ 
Sbjct: 352 YIEVTE 357


>gi|119385560|ref|YP_916615.1| recombination protein F [Paracoccus denitrificans PD1222]
 gi|119376155|gb|ABL70919.1| DNA replication and repair protein RecF [Paracoccus denitrificans
           PD1222]
          Length = 358

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 200/370 (54%), Gaps = 31/370 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR++A L +  D +     G NG GKTNILEA+S LSPGRG R A+  D 
Sbjct: 1   MTLSLLHLTQFRSWARLEIEADHRPVAIHGPNGAGKTNILEAVSMLSPGRGMRGAAPGDQ 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDE-------LN 117
            R G    +   A +    G   +  +      R V           V+DE       L 
Sbjct: 61  ARKGPEVGWQIRAEI----GTHQVLTRALPGQPREV-----------VIDEKPSTQIALG 105

Query: 118 KHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY 177
           + +R+ WL P+MDR+++    +RRRFLDR+  +  P H    + +E+ MR RNRLL +  
Sbjct: 106 RLMRVIWLTPAMDRLWTDAPEQRRRFLDRVTLSFTPGHAEDALGYEKAMRERNRLLRDEV 165

Query: 178 FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD 237
            D+ W  ++EAQMAE G  +   R++ I  +  +  +      FP   L+L    +G  D
Sbjct: 166 RDAGWYRALEAQMAETGAALTRNRLDAIARI--MAAQEGAGTAFPSASLTLLPG-EGSAD 222

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
                  E  A +L +GR  D  + RTL GPHR+DL   +  +A+  A  STGEQK +L+
Sbjct: 223 DPDA---ESIAARLAEGRGRDMAAGRTLTGPHRADLGAHWGPQAMPAALSSTGEQKALLL 279

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
            + LA+AR ++  +   P+LLLDE++AHLD D+R AL+  +  + +Q ++TGT   +F++
Sbjct: 280 SLILANARALAEES---PVLLLDEVAAHLDADRRAALYDEICALRAQAWLTGTGPELFEA 336

Query: 358 LNETAKFMRI 367
           L   A+F+ +
Sbjct: 337 LRGRAQFLAV 346


>gi|94495802|ref|ZP_01302381.1| DNA replication and repair protein RecF [Sphingomonas sp. SKA58]
 gi|94424494|gb|EAT09516.1| DNA replication and repair protein RecF [Sphingomonas sp. SKA58]
          Length = 357

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 200/365 (54%), Gaps = 16/365 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +S+FRN+A   ++ D    +  GDNG GKTNILEA+S L+PGRG R A+   + R
Sbjct: 2   IGRLTLSDFRNHADALILPDHAFVLLTGDNGAGKTNILEAVSMLAPGRGLRGAALGAMAR 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 F   A V+G+  +    +     + R VR   +        + L  HL I+WL 
Sbjct: 62  QEGAGGFGIAAEVDGV--VLGTGVAASAPERRQVRIGGVGSSA----NALADHLAITWLT 115

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWCSS 185
           P+MDR+F      RRRFLDR+  A+ P H      ++  MR RNRLL +    D +W S+
Sbjct: 116 PAMDRLFLDSPGGRRRFLDRLTLALHPGHAAHSARYDAAMRARNRLLGDLRTADPAWLSA 175

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +EAQM + G+ ++ AR +++  L+ ++    ++ + P  +  +        +++    +E
Sbjct: 176 LEAQMDDHGLVLSAARADLVARLNDIL---ARQPDAPFARPMIA------IEEAEPQGEE 226

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
             A +L   R+ D+ + R+L GPHR DL V +  K    A  STGEQK +L+ I LAHA 
Sbjct: 227 PLAMRLARQRRRDAAAGRSLSGPHRHDLAVTHVAKGQAAALCSTGEQKALLLSILLAHAA 286

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+++  G  P+LLLDE++AHLD  +R ALF  + + G QI+MTGT+ S+F  L    +  
Sbjct: 287 LVADERGQPPVLLLDEVAAHLDPLRRAALFDRLAETGGQIWMTGTEPSLFSDLTAATRLT 346

Query: 366 RISNH 370
             + H
Sbjct: 347 VTAGH 351


>gi|329113487|ref|ZP_08242268.1| DNA replication and repair protein RecF [Acetobacter pomorum DM001]
 gi|326697312|gb|EGE48972.1| DNA replication and repair protein RecF [Acetobacter pomorum DM001]
          Length = 382

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 134/363 (36%), Positives = 192/363 (52%), Gaps = 8/363 (2%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FRNY  L    +A   +  G+NG GKTN+LEA+S LSPGRG R A      R+G+
Sbjct: 17  LTLSNFRNYERLVWSPNASLLVLTGENGSGKTNLLEAVSLLSPGRGLRAAPLTQFGRMGA 76

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
            ++    AR+E  +   ++    +   +R  R   +N   IR  +     L   W+ P M
Sbjct: 77  INW-GVSARIETKDEFLELGTGTQGGQERPRRVFLLNGRQIRGQEAWEDTLATVWITPQM 135

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR+FS  +  RRRFLDR+V A+ P H R +  ++R M  RNRLL   + + SW S +EA 
Sbjct: 136 DRLFSEGASGRRRFLDRLVMAVTPHHARELAAYDRAMTQRNRLLQTRFSEHSWLSGLEAS 195

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKE--NFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           MA   V +  AR E +      I  Y Q     FP    +L   +  K + S     E++
Sbjct: 196 MARHAVAVAAARQETVRQ----ICHYAQNGLGAFPAAIATLQCAIAQKLETSPALTVEDW 251

Query: 248 -AKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
              KL + R+ D+   R   G HRSD +++        A  STG+QK +L+GI LAHARL
Sbjct: 252 LCAKLAELREDDAARGRATFGTHRSDFLLEDLSSRQPAALASTGQQKSLLIGIVLAHARL 311

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
           +++  G  PILLLDE   HLD  +R +L  IV D  + + +TGTD++ F  L  +A+F  
Sbjct: 312 VTDYRGQPPILLLDEPLVHLDAARRASLLEIVQDFRTTVLLTGTDQAPFAPLKHSAQFET 371

Query: 367 ISN 369
           + N
Sbjct: 372 LKN 374


>gi|87199175|ref|YP_496432.1| recombination protein F [Novosphingobium aromaticivorans DSM 12444]
 gi|87134856|gb|ABD25598.1| DNA replication and repair protein RecF [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 357

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 143/353 (40%), Positives = 191/353 (54%), Gaps = 18/353 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L + +FRN+A+ RL       + VG+NG GKTN+LEAIS L+PGRG RRA  A++
Sbjct: 1   MSLTRLTLRDFRNHAATRLEGMRAFNVLVGENGAGKTNVLEAISLLAPGRGLRRAQPAEM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                P  F+  A +E  +G   I     + D    R ++IN V       L + L I+W
Sbjct: 61  AGREGPGGFAIAAEME--DGAVQIGTAT-SPDAPGRRSVRINGVEGPAA-RLAEWLSITW 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWC 183
           L P+MDRIF+  +  RRRFLDR+V A DP H R    +E  +R RNRLL E    D  W 
Sbjct: 117 LTPAMDRIFAESAGSRRRFLDRLVLARDPGHARNATRYETALRERNRLLGEVAEPDPLWL 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
             IEAQMAE G  +  AR E++  LS  ++E V  + F    L     +    D     L
Sbjct: 177 DGIEAQMAETGAAMAAARTELVADLSR-VLETVPDQPFARPSLRYASEVPPDADGLRAML 235

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E   +           + R+LIGPHR DL V    K    A  STGEQK +L+ I LAH
Sbjct: 236 REGRRRD--------RAAGRSLIGPHRDDLAVLLAAKNAPAADCSTGEQKAMLIAIVLAH 287

Query: 304 ARLISNTTGFAP-ILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           A L   T G  P +LLLDEI+AHLD  +R ALF  +   G+Q++MTGT+ + F
Sbjct: 288 AGL---TAGERPRLLLLDEIAAHLDPVRRGALFERLATSGAQVWMTGTEMAPF 337


>gi|154243961|ref|YP_001414919.1| recombination protein F [Xanthobacter autotrophicus Py2]
 gi|154158046|gb|ABS65262.1| DNA replication and repair protein RecF [Xanthobacter autotrophicus
           Py2]
          Length = 378

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/366 (37%), Positives = 208/366 (56%), Gaps = 11/366 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L ++ FR+Y S ++  +    +  G NG GKTNILEA+SFLSPGRG RRA   ++  
Sbjct: 6   IRKLTLTAFRSYPSAQVSVEDGPVVLTGPNGAGKTNILEALSFLSPGRGLRRAQLGEIGH 65

Query: 67  -----IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
                 G P + +  A VEG  G   +    +   +  VR  +I+       +    HL+
Sbjct: 66  RAPGAAGEPPW-AVSALVEGALGEVRLGTGYDPVQEGGVRRCRIDGEPAPSANAFLDHLK 124

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WL P MD +F G   +RRR+LDR+V A+D  H  R+   ER +R RNRLL E    + 
Sbjct: 125 VLWLTPEMDGLFLGPPGDRRRYLDRLVLAVDGAHGTRVNGLERALRSRNRLLEE-NGSAR 183

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFLDGKFDQSF 240
           +  ++E ++AEL V +  AR+E +  L + I  +    + FP  +L+L G ++ +     
Sbjct: 184 FLDAVEHEVAELAVAVAAARLETVARLGAEIAAHRDDASLFPFAELALDGAVE-RLIAVH 242

Query: 241 CALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
            AL+ E  Y   L D R  D  + RTL GPH +DL V + +K +  A  STGEQK +L+G
Sbjct: 243 PALEVEDRYRALLRDNRPRDRAAGRTLEGPHLTDLSVSHGEKQLPAARCSTGEQKSLLIG 302

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + L+HARL+++  GF+PILLLD++ A+LD  +R  LF  +  +G+Q +MTG D + F +L
Sbjct: 303 LTLSHARLVASMQGFSPILLLDDVVAYLDAARRTGLFEALARLGAQAWMTGADPTAFSAL 362

Query: 359 NETAKF 364
           +   +F
Sbjct: 363 DGAERF 368


>gi|326388134|ref|ZP_08209737.1| recombination protein F [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207300|gb|EGD58114.1| recombination protein F [Novosphingobium nitrogenifigens DSM 19370]
          Length = 395

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 143/375 (38%), Positives = 202/375 (53%), Gaps = 36/375 (9%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++ +FRN+A+ RL   A   + VG+NG GKTN+LEAIS  SPGRG RRA  AD+
Sbjct: 37  MALTRLSLRDFRNHAATRLDGMATFNVLVGENGAGKTNVLEAISLFSPGRGMRRAHPADM 96

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV---RCLQINDVVIRVVDELNKHLR 121
                   F+  A +E      D +++L T    +    R ++IN         L + L 
Sbjct: 97  ASNKGAGDFAVAAELE------DGAVQLNTATTPATPGRRTVRINGAETPAT-RLAEWLA 149

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDS 180
           ++WL P+MDR+F+  +  RRRFLDR+V A +P H R    +E  +R RNRLL E    D 
Sbjct: 150 MTWLTPAMDRLFAEGATARRRFLDRLVLAGEPGHARIATRYEGALRERNRLLGEADEPDP 209

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            W  ++E QMAE G ++  +R  ++  L++                +L    DG F +  
Sbjct: 210 VWLDALETQMAETGAQLAASRRALVERLNT----------------ALAAQDDGPFARPI 253

Query: 241 CALKEE-------YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
            A   E       +A  L +GR+ D  + RTL GPHR DL V    K    AH STGEQK
Sbjct: 254 LAYNGETPVDASAFAAALRNGRRRDRAAGRTLTGPHRDDLDVVMAAKNAPAAHCSTGEQK 313

Query: 294 VVLVGIFLAHARLISNTTGFAP-ILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            +L+ I LAHA L  +  G  P +LLLDEI+AHLD  +R+AL+  +   G+Q++MTGT+ 
Sbjct: 314 ALLISIVLAHAAL-PDAGGERPRLLLLDEIAAHLDPLRRSALYERLAASGAQVWMTGTEP 372

Query: 353 SVFDSLNETAKFMRI 367
           S F  L   A F R+
Sbjct: 373 SPFADLPAPAAFWRV 387


>gi|126724508|ref|ZP_01740351.1| recombination protein F [Rhodobacterales bacterium HTCC2150]
 gi|126705672|gb|EBA04762.1| recombination protein F [Rhodobacterales bacterium HTCC2150]
          Length = 371

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 206/365 (56%), Gaps = 15/365 (4%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +S FR++  L    D +     G NG GKTNILEA+S LSPGRG RRA+  D++R     
Sbjct: 13  LSHFRSHKLLNQPLDGRPVAIFGPNGAGKTNILEAVSLLSPGRGLRRATADDLSRKPEAL 72

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
            +   A +       +I+++ E     + R + I++     V  L +  +I WLVP+MDR
Sbjct: 73  GWKVSATLNSPHRTHEIAMRAEAG---ASRVVTIDEKTAPQV-ALGRIAQILWLVPAMDR 128

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           ++   + ERRRFLDR+  +  P H   ++ +++ MR RNRLL +   D+ W  ++E QMA
Sbjct: 129 LWIEGAGERRRFLDRITLSFQPNHAEAVLSYDKAMRERNRLLKDHVRDAHWYLALEGQMA 188

Query: 192 ELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF--CALKEEYAK 249
           + G +I+  R++ ++ L+    +   K  FP   L+L   ++G+ +  F   +L+E    
Sbjct: 189 KSGAEIHRNRIDALSLLAK--AQSNAKTAFPAADLTL---IEGEENIGFDEASLRE---- 239

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
            L + R  D  + RTL+GPHRSD+   +  K I     STGEQK +L+ + L++AR ++ 
Sbjct: 240 VLANNRPNDLRAGRTLVGPHRSDVAALFAAKGIDARQCSTGEQKALLISLILSNARALAT 299

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
                PI+LLDE++AHLD+++R AL+  +T IG+Q FMTGT   +F  +   A+ + +S 
Sbjct: 300 LNDAPPIILLDEVAAHLDDNRRAALYDEITAIGAQAFMTGTGVELFAEMKGRAQALYVSE 359

Query: 370 HQALC 374
              L 
Sbjct: 360 SGGLS 364


>gi|159045915|ref|YP_001534709.1| recombination protein F [Dinoroseobacter shibae DFL 12]
 gi|157913675|gb|ABV95108.1| DNA replication and repair protein RecF [Dinoroseobacter shibae DFL
           12]
          Length = 361

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/367 (35%), Positives = 199/367 (54%), Gaps = 16/367 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++S FR++  L L  D +  +  G NG+GKTN+LEA+SFLSPGRG RRA    V
Sbjct: 4   VAVTSLSLSHFRSHTHLTLSLDERPVVLHGPNGIGKTNVLEALSFLSPGRGLRRAKTEAV 63

Query: 65  --TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNKHLR 121
             +  G     S   +  G E       ++ TR D    R +Q++   +  +  L + + 
Sbjct: 64  GQSEAGLGWRVSALVKSGGRE------REVMTRSDAGASRTVQLDGKPVPQM-ALAELVP 116

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + WLVP+MDR++   +  RR+FLDRM       H R ++ +ER MR RNRLL +G  D  
Sbjct: 117 MVWLVPAMDRLWIEAAEGRRKFLDRMTLNFVTTHGRDVLAYERAMRDRNRLLKDGVRDPH 176

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
           W  ++EAQMAE G +I   R   ++ + +   +      FP   L +    DG+   +  
Sbjct: 177 WYHALEAQMAEAGARITQNRQRCLSEIEAAQADATTA--FPFAGLQIEAH-DGR---APL 230

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
             K E    L   R MD  + RTL GPHR DL   Y  K       STGEQK +L+ + L
Sbjct: 231 RTKGEIENTLRCNRYMDQTAGRTLDGPHRDDLAAVYVSKGTPARDCSTGEQKALLISLIL 290

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           + +R + +  G AP++LLDE++AHLD++++ AL+  +  +G+Q +MTGT   +F  L E 
Sbjct: 291 SMSRAVKSLVGQAPLVLLDEVAAHLDQERQRALYDEICALGAQAWMTGTGAELFQPLGER 350

Query: 362 AKFMRIS 368
           A+F+ + 
Sbjct: 351 AQFIALP 357


>gi|84501258|ref|ZP_00999463.1| recombination protein F [Oceanicola batsensis HTCC2597]
 gi|84390549|gb|EAQ03037.1| recombination protein F [Oceanicola batsensis HTCC2597]
          Length = 367

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/367 (36%), Positives = 192/367 (52%), Gaps = 11/367 (2%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
            R+ +  L +S FR+Y    L  D +     G NG GKT++LEA+S  SPGRG RRA+  
Sbjct: 2   GRLCLTRLTLSHFRSYRHAALAPDGRPVAIHGANGAGKTSLLEAVSMFSPGRGLRRAAAE 61

Query: 63  DVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           D+ R      +     +  +  + ++    E    RSVR     D        L +  R+
Sbjct: 62  DLIRRPEALGWKLTGVLTSLRQVHELESTAEPGAARSVRI----DGKAAAQAALGRVARV 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WLVPSMDR++   +  RRRFLDRM  +  P H    + +E+ MR RNRLL +   D  W
Sbjct: 118 LWLVPSMDRLWIEGAEGRRRFLDRMTLSFLPGHAEAALAYEKAMRERNRLLKDMVRDEHW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
             ++EAQMAE G +I   R   ++ ++            P + LS     +G+      A
Sbjct: 178 YVALEAQMAEAGARITANRTRALSLIAGATAGAATAFPAPELSLS---HAEGELPDDAAA 234

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           L+      L +GR+ D  + RTLIGPHR DL   +  K I     STGEQK +L+ + LA
Sbjct: 235 LR----LALAEGRRRDLQAGRTLIGPHRVDLGARWAAKGIAARDASTGEQKALLISLILA 290

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           +AR ++   G  PILLLDE++AHLD  +R AL+  V  +G+Q +MTGT   +F  L + A
Sbjct: 291 NARALAGDFGAPPILLLDEVAAHLDAARRAALYDEVCALGAQAWMTGTGPELFADLGDRA 350

Query: 363 KFMRISN 369
           + MR++ 
Sbjct: 351 QVMRVTE 357


>gi|296282365|ref|ZP_06860363.1| recombination protein F [Citromicrobium bathyomarinum JL354]
          Length = 361

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 133/367 (36%), Positives = 194/367 (52%), Gaps = 24/367 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++I +FRN+    L   A+  + VG NG GKTN+LEA+S L+PGRG RRA   ++ RI  
Sbjct: 6   ISILDFRNHRQTALEDTARFNLLVGANGAGKTNVLEALSLLAPGRGLRRAKLPEMARIDG 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDE------LNKHLRIS 123
           P  F+  AR++  +G   + +         V   Q N   +RV         L++ L + 
Sbjct: 66  PGGFTVAARLQPADGAEPVQLGT------VVDAAQPNRRRVRVNGAERSALGLSEWLSVR 119

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYFDSSW 182
           WL P+MD +F+  +  RRR+LDR+  A  P H      +E  +R RNRLL+ +   D  W
Sbjct: 120 WLTPAMDGLFTDSAGARRRYLDRLALATAPGHAALSNRYETALRNRNRLLSDDAPPDPQW 179

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
             ++EAQ+AE G  I   R  ++  L+   +E      FP   L+    ++    +   A
Sbjct: 180 LDALEAQLAEHGAAIAANRRALVEELNR-ELEAQADALFPRPLLA----IEPTGPEEHTA 234

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           L    A  L   R+ +  + RTLIGPHR++L V   DK +  A  STGEQK +L+ I LA
Sbjct: 235 L----ADALRGNRRTERRAGRTLIGPHRAELAVTLADKGVPAARASTGEQKAMLIAITLA 290

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           H  L   T G A +LLLDE++AHLD  +R ALF  +   G Q++MTGT++  FD +   A
Sbjct: 291 HGALA--TRGRAGLLLLDEVAAHLDPQRREALFARLAANGEQVWMTGTERMPFDPILPDA 348

Query: 363 KFMRISN 369
               +S 
Sbjct: 349 AVWDVSG 355


>gi|83950588|ref|ZP_00959321.1| recombination protein F [Roseovarius nubinhibens ISM]
 gi|83838487|gb|EAP77783.1| recombination protein F [Roseovarius nubinhibens ISM]
          Length = 369

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 130/358 (36%), Positives = 188/358 (52%), Gaps = 11/358 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S FR++    L  D +     GDNG GKTN++EA+S +SPGRG RRA+  D+ R   
Sbjct: 9   LKLSHFRSHLGSALQLDPRPVAIHGDNGSGKTNLIEAVSLISPGRGLRRAAAQDMGRQPE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              +     +  +  + ++ I  E    R  R     D        L +  R+ WL+PSM
Sbjct: 69  ALGWKLRGVLHSLHQVHELEIWSEGGAARQTRI----DGKPAAQVALARIARVLWLIPSM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR++   +  RRRFLDRMV +  P H    + +E+ MR RNRLL +   D  W  ++E Q
Sbjct: 125 DRLWIEGAEGRRRFLDRMVMSFVPDHADVTLAYEKAMRERNRLLKDQVRDGHWYVALERQ 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MAE G+ I   R  +I+ L+    +      FP   L+L    +G         + EY  
Sbjct: 185 MAEAGLAIQANRQRVIDRLAQ--AQEGAATAFPAADLTLE-MAEGALPDG----EAEYRD 237

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
            L +GR+ D  + RTL+GPHR+DL   Y  K +     STGEQK +LV + LA+ R +  
Sbjct: 238 ALSEGRRRDLAAGRTLLGPHRADLQGVYAAKGVAAKDCSTGEQKALLVSLILANGRALRE 297

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
             G  PILLLDE++AHLD  +R AL+  +  +GSQ +MTGT   +F  L   A+ + +
Sbjct: 298 DFGAPPILLLDEVAAHLDAGRRAALYDEICALGSQAWMTGTGPELFAELGARAQHVEV 355


>gi|294085123|ref|YP_003551883.1| RecF protein [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664698|gb|ADE39799.1| RecF protein [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 418

 Score =  219 bits (557), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 135/368 (36%), Positives = 203/368 (55%), Gaps = 8/368 (2%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           ++ +  L ++ FRNY ++RL F     + VG NG GKTN+LEAIS LSPG+G RRA  A 
Sbjct: 35  QLWLSGLLLNNFRNYETVRLEFGQAPVVLVGANGAGKTNLLEAISLLSPGKGMRRAKTAH 94

Query: 64  VTRIGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           + RIG+    +S  A +E  +G+  I   +        R ++   + +   D +   L +
Sbjct: 95  LARIGAAMPDWSVSAALETEDGVMQIGTGVPADSQTGRRIMRREGMTVSQAD-IATQLSV 153

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
           SWL P MD +F      RRRFLDR+V A D  H  R   +E+LMR R  L++EG  D+ W
Sbjct: 154 SWLTPQMDGVFIDSPGARRRFLDRLVIAFDAAHIGRTNRYEKLMRERTLLISEGRGDAGW 213

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            +++EA +AE  + I  AR  +I+ L+           FP ++L L G ++   D+    
Sbjct: 214 FNALEASLAETAIAITAARRALIHDLNEEARHGWH--GFPGVRLELQGDIENWLDEMPAL 271

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVGIFL 301
             E+         + D  S   L GPH S+ +  Y     T A+  STG+QK +L+ + L
Sbjct: 272 AVEDRHMAAAANLRTDGTS--ALPGPHASE-VNAYDVAGDTPAYLASTGQQKALLIAVVL 328

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           AHARL     G  PI+LLD+++AHLD  +R+ALF  + D+G Q + +G+D S+FD L + 
Sbjct: 329 AHARLQERRLGRPPIMLLDDVAAHLDAKRRSALFEALFDLGGQSWFSGSDASLFDGLGKA 388

Query: 362 AKFMRISN 369
           A+FM+I +
Sbjct: 389 AQFMKIHD 396


>gi|103487192|ref|YP_616753.1| recombination protein F [Sphingopyxis alaskensis RB2256]
 gi|98977269|gb|ABF53420.1| DNA replication and repair protein RecF [Sphingopyxis alaskensis
           RB2256]
          Length = 369

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 200/362 (55%), Gaps = 10/362 (2%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++++FRN+A   L          GDNG GKTNILEAIS L+PGRG RRA  +D+ R G+
Sbjct: 6   LSLTDFRNHAGADLAAAPGLVALHGDNGAGKTNILEAISLLAPGRGLRRAPLSDMVRDGA 65

Query: 70  PSFFSTFARVEGMEGLADISIK--LETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVP 127
              F+ FA V   EGL  +++   +E    R  R ++IN         L + L I WL P
Sbjct: 66  HGGFAVFAEVAAAEGLPPVALGTGIEPAQPRR-RIVRINGAPA-AATALGEWLAILWLTP 123

Query: 128 SMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWCSSI 186
           +MDR+F   +  RRRFLDR+V A+DPRH +    +E  +R R +LL +    D +W +S+
Sbjct: 124 AMDRLFVETAGNRRRFLDRLVLALDPRHAQHGNRYEAALRARGKLLADLAAADETWLTSL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           EAQ+AE G  ++ AR++ + ALS+   E   + + P  +  LT  +D +  +       E
Sbjct: 184 EAQLAEHGAAMDAARLDTLAALSA---ELAGQPDAPFARPLLT-LVDSEGAERSAPHSAE 239

Query: 247 YAKKLFDGRKMDSMSRRTLI-GPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
             K LF  R+    +      GPHR DL+  +       A  STGEQK +L+ + LAH  
Sbjct: 240 ALKALFAARRRIDAAAGRATAGPHRDDLVAVHAVTGRAAARCSTGEQKAMLLSLVLAHGD 299

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
            ++   G  P+LLLDE++AHLD  +R AL+  +   G Q ++TGT+ ++FD++       
Sbjct: 300 CVARRRGQRPVLLLDEVAAHLDPLRRAALYERLAGQGGQAWLTGTEAALFDAMPGPVTRY 359

Query: 366 RI 367
           RI
Sbjct: 360 RI 361


>gi|254462172|ref|ZP_05075588.1| DNA replication and repair protein RecF [Rhodobacterales bacterium
           HTCC2083]
 gi|206678761|gb|EDZ43248.1| DNA replication and repair protein RecF [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 368

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/371 (35%), Positives = 199/371 (53%), Gaps = 13/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I  L +S FR++   R+          G NG GKTNILEA+S  SPGRG RRAS  D+
Sbjct: 2   LAITELTLSHFRSHKLARISCGPLPVAIYGPNGAGKTNILEAVSLFSPGRGMRRASAEDM 61

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLET-RDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           TR   P       +V G+    D + ++E   ++ S R  + N   +   + L +  R+ 
Sbjct: 62  TR--RPEALGW--KVTGLLQTQDQTHEIEMWSENGSARSTKANSKPV-PQNRLAELSRVL 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P+MDR++   +  RRRFLDRM  +  P H    + +E+ MR RN+LL E   D  W 
Sbjct: 117 WLIPAMDRLWIEGAEGRRRFLDRMALSFFPNHAEASLTYEKTMRERNKLLKENVRDPMWY 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
             +E ++AE G  I+  RV  +  LS+   +   K  FP   L LT   D     S   L
Sbjct: 177 GVLETRLAETGAVIHENRVRTLTFLSN--AQAQAKTPFPTADLELTHAEDAMPVDS-VDL 233

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           K+ +    F     D  + RTL+GPHR+DL   +  K +     STGEQK +L+ + LA+
Sbjct: 234 KDAFEASRF----RDLAAGRTLVGPHRADLYGVFTAKGVPAKDCSTGEQKALLISLILAN 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           AR ++   G  PILLLDE++AHLD  +R AL+  ++ +G+Q +MTGT   +FDSL+  + 
Sbjct: 290 ARALAGQIGAPPILLLDEVAAHLDATRRAALYAEISALGAQAWMTGTGAELFDSLSSQSV 349

Query: 364 FMRISNHQALC 374
            + ++ +  + 
Sbjct: 350 HLEVTENDGIS 360


>gi|312112798|ref|YP_004010394.1| DNA replication and repair protein RecF [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311217927|gb|ADP69295.1| DNA replication and repair protein RecF [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 400

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 217/386 (56%), Gaps = 22/386 (5%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
           T+RI I  L +++FRNY ++ LV      +  G NG GKTN LEA+S L+ GRG R   +
Sbjct: 4   TDRIAIAKLTLTDFRNYRAVTLVTGLGPVVLAGANGAGKTNCLEAVSLLTAGRGLRSLPF 63

Query: 62  ADVTRIGSPSFFSTFAR--VEGMEGLADISIKLETRD---DRSVRCLQINDVVIRVVDEL 116
            ++ R G    ++  A   V G +      I+L        R+ R ++I+  + +    L
Sbjct: 64  PELARSGGSGGWAVAAELGVAGEDMHIGTGIQLPPDGMLTPRAARTVKIDHALAKGSGAL 123

Query: 117 NKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG 176
            + +R+ WL PSMD +F+G + ERRRFLDR+V ++DP +      FER MR RN+ L E 
Sbjct: 124 VR-IRMLWLTPSMDGLFTGPAAERRRFLDRLVLSLDPGYGAAASAFERAMRQRNKALEE- 181

Query: 177 YFDSS-WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN---FPHIKLSLTGFL 232
            FDS    ++IEAQMA   V + +AR   I ALS  I     ++    FP   L+L G L
Sbjct: 182 -FDSPPMLTAIEAQMAAAAVAMAVARARAIAALSGEIEAERNRDPDSLFPWAALTLNGTL 240

Query: 233 DGKF-----DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
           + +      D     L++ YA+ L  GR  D  + RTL GPHRSDL V +  KA+     
Sbjct: 241 EEQAAALSEDTMRDELRDGYARALAQGRDRDRAAGRTLSGPHRSDLDVAHGPKAMPARMC 300

Query: 288 STGEQKVVLVGIFLAHARLISNTT-GFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIF 346
           STGEQK +LVG+ LA ARLI     G AP++LLDEI+AHLD  +R ALF  +  + +Q++
Sbjct: 301 STGEQKALLVGLVLAQARLIKRAADGIAPLILLDEIAAHLDIGRREALFSSIVALNAQVW 360

Query: 347 MTGTDKSVFDSL---NETAKFMRISN 369
           MTGTD + F  L    ET  F+ +SN
Sbjct: 361 MTGTDLATFTPLRNATETQLFV-VSN 385


>gi|83591343|ref|YP_425095.1| recombination protein F [Rhodospirillum rubrum ATCC 11170]
 gi|83574257|gb|ABC20808.1| RecF protein [Rhodospirillum rubrum ATCC 11170]
          Length = 375

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 131/379 (34%), Positives = 182/379 (48%), Gaps = 18/379 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L ++ FR Y  LRL    +  +  G NG GKTN+LEA+SFL+PGRG RRA+ AD  R
Sbjct: 2   VERLTLTAFRCYDRLRLDVGPRPLVLTGPNGAGKTNLLEALSFLAPGRGLRRAALADPCR 61

Query: 67  --------IGSPSFFSTFARVEGMEGL----ADISIKLETRDDRSVRCLQINDVVIRVVD 114
                    G P   +   R+    G      D+   LE       R ++I+        
Sbjct: 62  RVGGDAATAGPPWAVAAHLRLPAGPGTLGRGVDVGTGLERATAGERRLVRIDGATAGQA- 120

Query: 115 ELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT 174
            L     + WL P MD +F G + ERRRFLDR+V  +DP H  R   + +  R R RLL 
Sbjct: 121 ALGDLFSVLWLTPEMDGLFRGGASERRRFLDRLVNGLDPDHAGRTAAYAQAQRERARLLR 180

Query: 175 EGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG 234
           EG     W   +E  MA  GV I  AR ++++ L + +        FP  ++ L   +DG
Sbjct: 181 EGRASRGWLDGLEDVMARHGVAIVAARRDLVDRLGAAVRAATGP--FPGARIDLVSEVDG 238

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
                     E+  +       M         GPHR DL V +  K I     STGEQK 
Sbjct: 239 WLAAGPALAAEDRLRAAL---AMARGPEAPAPGPHRDDLAVRHGPKDIPAVQASTGEQKA 295

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           VL+ + LA AR+       AP+LLLDE  AHLD  +R AL   ++  G Q +++GT+   
Sbjct: 296 VLIALILAQARVQEAARAVAPLLLLDEGVAHLDAPRRAALGEALSGQGLQAWVSGTEAQA 355

Query: 355 FDSLNETAKFMRISNHQAL 373
           FDS  + A+F+RI+    L
Sbjct: 356 FDSWAKNAQFLRIAEGAVL 374


>gi|163745037|ref|ZP_02152397.1| recombination protein F [Oceanibulbus indolifex HEL-45]
 gi|161381855|gb|EDQ06264.1| recombination protein F [Oceanibulbus indolifex HEL-45]
          Length = 365

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 132/374 (35%), Positives = 200/374 (53%), Gaps = 20/374 (5%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
            ++ +  L++S FR++    +  D +     G NG GKTNI+EAIS LSPGRG RR S  
Sbjct: 2   TQLYLSNLSLSHFRSHRRAVIDVDVRPVALYGPNGAGKTNIIEAISLLSPGRGLRRTSAQ 61

Query: 63  DVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           D+ R      +     + G   L +I +  E    R  +     D        L +  R+
Sbjct: 62  DMARRPEALGWKMSGLLHGPSVLHEIEVWSEAGAARQTKI----DGKAAAQTALGRVARV 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL+P+MDR++   +  RRRFLDR+  ++ P H    + +E+ MR RNRLL +   + +W
Sbjct: 118 LWLIPAMDRLWIEGAEGRRRFLDRVTLSMLPDHAELSLSYEKAMRERNRLLKDMVREPAW 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            +++EA+MAE G +I+  R++ + AL +   E      FP   L L            CA
Sbjct: 178 YAALEARMAETGAQIHANRLQALAALEAAQEEAQTA--FPVATLELQ-----------CA 224

Query: 243 LK---EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           +    E   + L D R  D  + RTLIGPHR+DL   Y  K +     STGEQK +LV +
Sbjct: 225 MPSDVEALRRALSDNRMRDLSAGRTLIGPHRADLEGTYAAKGVAARDCSTGEQKALLVSL 284

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA+AR I+   G  P+LLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F+SL 
Sbjct: 285 ILANARAIAADFGAPPLLLLDEVAAHLDATRRAALYDEICALGAQAWMTGTGPELFESLG 344

Query: 360 ETAKFMRISNHQAL 373
           + A+++ ++    L
Sbjct: 345 DRAQYVEVTEEDGL 358


>gi|182680050|ref|YP_001834196.1| DNA replication and repair protein RecF [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182635933|gb|ACB96707.1| DNA replication and repair protein RecF [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 403

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 196/364 (53%), Gaps = 3/364 (0%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L +S+FR+Y +L L   A+  +  G+NG GKTN++EA+S  +PGRG RR   A   R
Sbjct: 15  VRRLILSDFRSYPALDLSLGAKMIVVTGENGAGKTNLIEALSLFTPGRGLRRVELASCAR 74

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRISWL 125
              P  F+    +E       +   L  R +    R  +I    +        HLRI WL
Sbjct: 75  AEGPGGFAVSIEIETGAERVQLGTGLVPRSEGGFARQYRIERAPVGSARSFADHLRIVWL 134

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P+ D +F+    ERRRFLDR+V  +D  H  R+   ER +R RNR L + Y DS W  +
Sbjct: 135 TPAQDGLFAASPGERRRFLDRLVLCVDAEHGARVTVLERALRNRNRQLEDHYADSRWLDA 194

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQK-ENFPHIKLSLTGFLDGKFDQSFCALK 244
            E ++AE+ V +  ARVE +  L  LI E       FP   L + G L+    +      
Sbjct: 195 TEKEIAEIAVAVAAARVETVARLRRLIDESRDTITPFPWADLEIRGDLERLVGERPALEA 254

Query: 245 EE-YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           EE Y   L D R+ D+ + R L+GP  SDL+V +  K    A  STGEQK +LVG+ LAH
Sbjct: 255 EELYRGILRDNRRRDAAAGRALVGPQNSDLLVRHGPKQADAARSSTGEQKALLVGLVLAH 314

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           ARL++  T  AP++LLDEI+AH D  +R AL+  +  +  QI+MTG + S F  L + A 
Sbjct: 315 ARLVARATQTAPMILLDEIAAHFDASRRVALYEELAALPGQIWMTGAEASAFSGLADHAD 374

Query: 364 FMRI 367
            +++
Sbjct: 375 LLQV 378


>gi|307295030|ref|ZP_07574872.1| DNA replication and repair protein RecF [Sphingobium
           chlorophenolicum L-1]
 gi|306879504|gb|EFN10722.1| DNA replication and repair protein RecF [Sphingobium
           chlorophenolicum L-1]
          Length = 354

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 199/365 (54%), Gaps = 19/365 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +S+FRN+A   +V D    +  GDNG GKTNILEA+S L+PGRG R A+  D+ R
Sbjct: 2   IGRLTLSDFRNHADALIVPDHSFIVLTGDNGAGKTNILEAVSMLAPGRGLRGAALRDMAR 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 F   A V+G   +    +     D R VR   ++       + L  HL I WL 
Sbjct: 62  QDGTGGFGIAAEVDG--AMLGTGVLASAPDRRQVRIGGVSSSA----NALADHLSIVWLT 115

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWCSS 185
           P+MDR+F      RRRFLDR+  A+ P H      +E  MR RNRLL +    D SW S+
Sbjct: 116 PAMDRLFMDSPGGRRRFLDRLTLALHPAHAVHSARYEAAMRARNRLLGDLSAADPSWLSA 175

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +EAQM E G  ++ AR +++  LS+  +E      F    L+L G  D           E
Sbjct: 176 LEAQMDEHGAALSAARTDLVARLSA-ALEDQPDHPFARPLLALEGDSD-----------E 223

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
             A +L   R+ D+ + R+L GPHR DL V +  KA   A  STGEQK +L+ I LAHA 
Sbjct: 224 PLALRLARERRRDAAAGRSLSGPHRRDLAVTHAAKAQAAALCSTGEQKALLLSILLAHAA 283

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L++   G  P+LLLDE++AHLD  +R ALF  + + G Q++MTGT+ S+F+ L   ++F 
Sbjct: 284 LVAAHRGQPPVLLLDEVAAHLDPSRRAALFDRLRETGGQVWMTGTEDSLFNELPVASRFS 343

Query: 366 RISNH 370
             + H
Sbjct: 344 VTAGH 348


>gi|296115231|ref|ZP_06833872.1| recombination protein F [Gluconacetobacter hansenii ATCC 23769]
 gi|295978332|gb|EFG85069.1| recombination protein F [Gluconacetobacter hansenii ATCC 23769]
          Length = 374

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 200/362 (55%), Gaps = 11/362 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRNY  L     +  T+ VG+NG GKTN+LE++S L PGRG R A  AD+ R G 
Sbjct: 7   LVLTDFRNYRHLSWTPTSPVTVIVGENGSGKTNLLESVSLLLPGRGLRGARVADLPRHGG 66

Query: 70  PSFFSTFARVE---GME-GLADISIKLE-TRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            + +   AR++   G+E G+ D+++  +  R DR  R ++++   +R    ++  L   W
Sbjct: 67  -TRWGIAARIDVPDGVEAGIRDLAVGSDPARPDR--RVVRLDGEALRNRTRVSDFLSAVW 123

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L P MDR+F   +  RRRFLDR+V A++P H R +   +  M  RNRLL  G  D +W S
Sbjct: 124 LTPQMDRLFQEGAAGRRRFLDRLVLAMEPGHARELAAHDHAMMQRNRLLLSGGGDGAWLS 183

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-SFCAL 243
           ++E  MA  GV    AR  ++  L+    +    + FP   L+L   +          A+
Sbjct: 184 ALEDAMARHGVAATAARAGLVALLNG--DDAALCDGFPATALTLESEIAQHLRHMPALAV 241

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           ++   ++L   R+ D       +G HR+DL +         A  STG+QK +LVG+ L+H
Sbjct: 242 EDWLREQLAASRQRDRARGSAFLGAHRTDLHMHDRATRRGAAQSSTGQQKAMLVGVVLSH 301

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           ARLI+   G AP++LLDE   HLDE +RNALFR +  + + + ++GTD + F  L + A 
Sbjct: 302 ARLIARARGQAPLILLDEPLVHLDEVRRNALFRAIGRLDTTVMLSGTDAAQFGPLRDQAA 361

Query: 364 FM 365
           F+
Sbjct: 362 FV 363


>gi|84514652|ref|ZP_01002016.1| recombination protein F [Loktanella vestfoldensis SKA53]
 gi|84511703|gb|EAQ08156.1| recombination protein F [Loktanella vestfoldensis SKA53]
          Length = 366

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/360 (35%), Positives = 190/360 (52%), Gaps = 15/360 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +S  R++    L  D +     G NG GKTNILEA+S LSPGRG RRA   D+ R   
Sbjct: 9   LTLSHLRSHKRAVLDLDPRPLAIFGPNGAGKTNILEAVSLLSPGRGLRRAGADDLARRPE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
              +     ++ +  + +I    E    R +R   I+      V  L +  R+ WLVP+M
Sbjct: 69  ALGWKITGVLQSLYQVHEIETWAEAGQPRQLR---IDGKTAPQV-ALGRIARVLWLVPAM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           DR+++  +  RRRFLDR   + +P H   ++ +E+ MR RNRLL +   D  W ++IE Q
Sbjct: 125 DRLWTEGADGRRRFLDRATLSFEPGHADVVLTYEKAMRERNRLLKDMVRDPHWYAAIEGQ 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA    +I   R + I   + +  +      FP  +L+LT + D         L  +   
Sbjct: 185 MAAAATQITANRTKAIA--ALMAAQAAAVSAFPTAQLTLT-YSD--------PLPTDLQS 233

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
            L D R  D  + RTL+GPHR+DL   + DK +     STGEQK +L+ + LA+AR ++ 
Sbjct: 234 ALADHRSRDMAAGRTLLGPHRADLDAVFADKHVPARDCSTGEQKALLISLILANARALAQ 293

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
             G  PILLLDE++AHLD  +R AL+  +  +G+Q FMTGT   +F  L   A++  ++ 
Sbjct: 294 DFGAPPILLLDEVAAHLDATRRAALYDEICALGAQAFMTGTGPELFAELGSRAQYAEVTE 353


>gi|260428922|ref|ZP_05782899.1| DNA replication and repair protein RecF [Citreicella sp. SE45]
 gi|260419545|gb|EEX12798.1| DNA replication and repair protein RecF [Citreicella sp. SE45]
          Length = 368

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 187/353 (52%), Gaps = 11/353 (3%)

Query: 15  FRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFS 74
           FR++    +  DA+     G NG GKTN++EA+S LSPGRG RRA+  ++ R      + 
Sbjct: 13  FRSHRRAEIAVDARPVAIYGPNGAGKTNLIEAVSLLSPGRGMRRAAAQEIARRPEALGWR 72

Query: 75  TFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFS 134
             A +   +G+ +I I+ E    R V      D        L +  R+ WLVPSMDR++ 
Sbjct: 73  IGAELHAPDGVHEIDIRAEAGAARQVSI----DGKPAPQTALARITRVLWLVPSMDRLWI 128

Query: 135 GLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELG 194
                RRRFLDRM  +  P H    + +E+ MR RNRLL +   D+ W +++E QMA+ G
Sbjct: 129 EAPEGRRRFLDRMTLSFFPDHADASLTYEKAMRERNRLLKDQVRDAHWYAALEGQMAQAG 188

Query: 195 VKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDG 254
            ++  +  +   A  +   E  + + FP  +L L        +       E     L + 
Sbjct: 189 AQLQ-SNRQAALARLAQAQEGAETQ-FPAAELELV-----STEADIPETAEGLRAALSES 241

Query: 255 RKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFA 314
           R  D  + RTLIGPHR+DL   +  K ++ +  STGEQK +L+ + LA+AR ++   G  
Sbjct: 242 RFRDMAAGRTLIGPHRADLHGVFAAKGVSASDCSTGEQKALLISLILANARALAADLGAP 301

Query: 315 PILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
           PILLLDE++AHLD  +R AL+  +  +G+Q +MTGT   +F  L   A+ + +
Sbjct: 302 PILLLDEVAAHLDAGRRAALYDEICALGAQAWMTGTGPELFGELGARAQRLEV 354


>gi|162147557|ref|YP_001602018.1| recombination protein F [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786134|emb|CAP55716.1| putative DNA replication and repair protein recF [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 373

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 135/367 (36%), Positives = 195/367 (53%), Gaps = 7/367 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L +++FRNY  L    +A  T+  G+NG GKTN+LEA+S L PGRG R A  A++ 
Sbjct: 3   RLDRLALTDFRNYRHLAWRPEAPVTVVTGENGSGKTNLLEALSLLVPGRGLRGARSAEMA 62

Query: 66  RIGSPSFFSTFARVEGMEGLA-DISIKLE-TRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           R G+ + +   AR  G +G   DI+   +  R +R  R  + +   +R    L  HL   
Sbjct: 63  RHGT-TIWGVAARFTGPDGAPFDIATGSDPARPER--RVFRRDGETLRSRAALADHLSAV 119

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P MDR+F      RRRFLDR+V A++P H R +   ++ M  RNRLL  G  D  W 
Sbjct: 120 WLTPQMDRLFQDGLPGRRRFLDRLVLALEPGHARELAAHDQAMGQRNRLLAAGRADPGWL 179

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCA 242
           S++E  MA   V  + AR+ ++  L+      V  + FP  +L  L   +    D+   A
Sbjct: 180 SALEDSMARHAVAASAARLALVTQLNGEAAHTV-PDGFPPARLDILCPIVQQLRDRPALA 238

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++    +L  GR  DS      IG HR+D+ +         A  STG+QK +L+G+ LA
Sbjct: 239 VEDWLRGRLAAGRACDSARGGAGIGAHRADMALSDQASGRPAAQASTGQQKALLLGVVLA 298

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA L++ + G AP++LLDE   HLDE +R ALFR V    + + MTGTD   F  L   A
Sbjct: 299 HAALMTRSRGEAPMILLDEPLVHLDEARRAALFRSVGAFDATVLMTGTDADQFAPLRGRA 358

Query: 363 KFMRISN 369
            F+   N
Sbjct: 359 GFVSPRN 365


>gi|254449439|ref|ZP_05062876.1| DNA replication and repair protein RecF [Octadecabacter antarcticus
           238]
 gi|198263845|gb|EDY88115.1| DNA replication and repair protein RecF [Octadecabacter antarcticus
           238]
          Length = 341

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 184/344 (53%), Gaps = 15/344 (4%)

Query: 34  GDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIKLE 93
           G NG GKTNILEA+S LSPGRG RRAS  ++TR      +   A +  +    ++    E
Sbjct: 5   GPNGAGKTNILEAVSILSPGRGLRRASSEEMTRRPEALGWKVTADLTSLNKRHEVEAWSE 64

Query: 94  TRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDP 153
               R  +     D        L +  R+ WL+P+MDR++   +  RRRFLDR   + +P
Sbjct: 65  NGASRQTKI----DGKAAAQTALGRIGRVLWLIPAMDRLWIEAAEGRRRFLDRATLSFEP 120

Query: 154 RHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIM 213
            H    + +E+ MR RNRLL +   D+ W +++E QMA+ G +I+  R++ I+ L+    
Sbjct: 121 MHADAALTYEKAMRERNRLLKDMVRDAHWYTALERQMADAGAQIHRNRMQAIDLLTD--A 178

Query: 214 EYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLF---DGRKMDSMSRRTLIGPHR 270
           +   +  FP   L+LT           C   ++ A  L      R  D  + RTLIGPHR
Sbjct: 179 QQAAQTAFPIALLTLT------HSDPVCDAPDDPAALLAALAGNRPRDMAAGRTLIGPHR 232

Query: 271 SDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDK 330
           +DL   +  K +     STGEQK +L+ + LA+AR +++  G  PILLLDE++AHLD  +
Sbjct: 233 ADLGAIFAAKDVPAKDCSTGEQKALLISLILANARALADDFGAPPILLLDEVAAHLDATR 292

Query: 331 RNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQALC 374
           R AL+  +T +G+Q FMTGT   +F  L   A++  ++    + 
Sbjct: 293 RAALYSEITALGAQAFMTGTGPELFGELGTAAQYAYVTEENGVS 336


>gi|16124414|ref|NP_418978.1| recombination protein F [Caulobacter crescentus CB15]
 gi|221233097|ref|YP_002515533.1| recombination protein F [Caulobacter crescentus NA1000]
 gi|239977550|sp|B8GXP9|RECF_CAUCN RecName: Full=DNA replication and repair protein recF
 gi|239977551|sp|P0CAW1|RECF_CAUCR RecName: Full=DNA replication and repair protein recF
 gi|13421272|gb|AAK22146.1| recF protein [Caulobacter crescentus CB15]
 gi|220962269|gb|ACL93625.1| DNA replication and repair protein recF [Caulobacter crescentus
           NA1000]
          Length = 387

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/375 (34%), Positives = 200/375 (53%), Gaps = 20/375 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT-RIG 68
           L +++FR+Y   RL    +     G NG GKTN+LEAIS LSPG+G R  S A+V  R+ 
Sbjct: 9   LTLADFRSYERARLETGGRSVYLFGANGAGKTNLLEAISLLSPGKGLRGVSLAEVGRRLP 68

Query: 69  SPSFFSTFARVEGMEGLADISIKLET---RDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
             +    +A    ++   D  +++ T   +   + R +++    +     L  H+R  WL
Sbjct: 69  GEAVGRAWAVAAEVQSGEDAPVRIGTGVEQGGAARRTVRLEGETV-PPGRLADHVRPIWL 127

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-----TEGYFDS 180
            P+ DR+F   + ERRRF DR+VFA +P H      +++  R R RLL     T    D+
Sbjct: 128 TPAQDRLFLEAASERRRFFDRLVFAGEPAHAANANGYDKAQRERMRLLVDAAETGAPADA 187

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG-----FLDGK 235
           +W +++EA++AE G  +  AR   + AL + I +      FP  +L LTG      L+G 
Sbjct: 188 AWLTALEARLAEFGALLAQARARTLLALQAEI-DGRGDRPFPLARLGLTGEWERMALEGA 246

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
               F  ++ + A+ L   R  D  + R L GPHR DL + + +K    A  STGEQK +
Sbjct: 247 ---PFAEIELKLAQALASARARDGAAGRALTGPHRGDLAIFHVEKDRPAAECSTGEQKAL 303

Query: 296 LVGIFLAH-ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           ++ + LA  ARL    +   P++LLDE++AHLD  +R AL   +T +  Q F+TGTD+S+
Sbjct: 304 ILNLVLAQAARLSRAESAPNPVILLDEVAAHLDLTRRAALADELTALKLQAFLTGTDESL 363

Query: 355 FDSLNETAKFMRISN 369
           FD L   A  +R+ +
Sbjct: 364 FDHLKGRALGVRVGD 378


>gi|295691339|ref|YP_003595032.1| DNA replication and repair protein RecF [Caulobacter segnis ATCC
           21756]
 gi|295433242|gb|ADG12414.1| DNA replication and repair protein RecF [Caulobacter segnis ATCC
           21756]
          Length = 387

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 204/375 (54%), Gaps = 20/375 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT-RIG 68
           L +++FR+Y   RL    +     G NG GKTN+LEAIS L+PG+G R A+ A+V  R+ 
Sbjct: 9   LTLTDFRSYERARLETSGRSVYLFGPNGAGKTNLLEAISLLTPGKGLRGANLAEVGRRLP 68

Query: 69  SPSFFSTFARVEGMEGLADISIKLET---RDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
             +    +A    +E   D  +++ T   +   S R ++++   +     L  H+R  WL
Sbjct: 69  GEATGRPWAVAAEVESGPDAPVRIGTGVEQGGASRRTVRLDGETV-SPGRLADHVRPIWL 127

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-----FDS 180
            P+ DR+F   + ERRRF DR+VFA +P+H      +++  R R RLL E        D+
Sbjct: 128 TPAQDRLFLEAASERRRFFDRLVFAGEPQHAANANAYDKAQRERMRLLIEAVERGAPPDA 187

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG-----FLDGK 235
           +W +++EA++AE G  +  AR   + AL + I +      FP  +L+LTG      L+G 
Sbjct: 188 TWLNALEARLAESGALMAQARARTLQALQAEI-DGRGDRPFPQARLTLTGDWEKLALEGV 246

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
               F  ++E+ A  L   R  D  + R L GPHR DL + + +K    A  STGEQK +
Sbjct: 247 ---PFAEIEEKLAAALLSARARDGAAGRALTGPHRGDLAIFHVEKDRPAAECSTGEQKAL 303

Query: 296 LVGIFLAH-ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           ++ + LA  ARL    +   P++LLDE++AHLD  +R AL   +T +  Q F+TGTD+S+
Sbjct: 304 ILNLVLAQAARLSRAESAPNPVILLDEVAAHLDLARRAALADELTALKLQAFLTGTDESL 363

Query: 355 FDSLNETAKFMRISN 369
           FD L   A  +R+ +
Sbjct: 364 FDHLKGRALGVRVCD 378


>gi|15891955|ref|NP_359669.1| recombination protein F [Rickettsia conorii str. Malish 7]
 gi|20978615|sp|Q92JN5|RECF_RICCN RecName: Full=DNA replication and repair protein recF
 gi|15619066|gb|AAL02570.1| RecF protein [Rickettsia conorii str. Malish 7]
          Length = 360

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 120/358 (33%), Positives = 187/358 (52%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           LN+  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  A+V +   
Sbjct: 9   LNLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 69  DHCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPHM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSSDRRKFLDRIVYNFDPKHAELVSKYEYYMHERNKILVEDRRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I +   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQQAIDDL--ENEFPKADLSIDGIVEQKILNGKKNIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L   +T +  Q+++T T+    D+    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFLTGLNMQLWVTTTNLEGIDNFATKAQLIKL 360


>gi|157803214|ref|YP_001491763.1| recombination protein F [Rickettsia canadensis str. McKiel]
 gi|226737825|sp|A8EX95|RECF_RICCK RecName: Full=DNA replication and repair protein recF
 gi|157784477|gb|ABV72978.1| recombination protein F [Rickettsia canadensis str. McKiel]
          Length = 360

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 187/356 (52%), Gaps = 6/356 (1%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  AD+ +  S  
Sbjct: 11  LENYRNFKNLELKIDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKT-SED 69

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
             S  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M+ 
Sbjct: 70  HCSIKALLQSKLGLAEFTTQFKLSSNR--RITEYNESKI-ANNELSKFTSMVWLTPQMEG 126

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           IF+   +ERR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +MA
Sbjct: 127 IFTSGKVERRKFLDRIVYNFDPKHAELVGKYEYYMHERNKILAEEIQDDNWLKIIEEKMA 186

Query: 192 ELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKL 251
           ++   I + R++ +  +   I     +  FP   LS+ G ++ K       +      +L
Sbjct: 187 DISNHIAVNRLKTLEFMQQTINNL--ENEFPKADLSIDGIVEQKILDGEENIVSVITAEL 244

Query: 252 FDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTT 311
           +  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA        T
Sbjct: 245 YKTRNKDKLIGRTSFGVHKSDFLVKHKKKNILAKLCSTGEQKAILIAIILAEMNYAIKLT 304

Query: 312 GFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
             AP+LLLDE+  HLD+ +R+ L    T +  Q+++T T+    ++    A+ +++
Sbjct: 305 KIAPVLLLDEVFVHLDDKRRDYLTEFFTYLNLQLWITTTNLESIENFASKAQLIKL 360


>gi|294010882|ref|YP_003544342.1| DNA replication and repair protein RecF [Sphingobium japonicum
           UT26S]
 gi|292674212|dbj|BAI95730.1| DNA replication and repair protein RecF [Sphingobium japonicum
           UT26S]
          Length = 356

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 142/365 (38%), Positives = 199/365 (54%), Gaps = 17/365 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +S+FRN+A   ++ D    +  GDNG GKTNILEA+S L+PGRG R A+  D+ R
Sbjct: 2   IGRLTLSDFRNHADALIMPDHSFIVLTGDNGAGKTNILEAVSMLAPGRGLRGAALRDMAR 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 F   A V+G+  +    +     D R VR       V    + L  HL I WL 
Sbjct: 62  QDGAGGFGIAAEVDGV--MLGTGVLASAPDRRQVRI----GGVASSANALADHLSIVWLT 115

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWCSS 185
           P+MDR+F      RRRFLDR+  A+ P H      +E  MR RNRLL +    D SW S+
Sbjct: 116 PAMDRLFMDSPGGRRRFLDRLTLALHPAHAAHSARYEAAMRARNRLLNDLSAADPSWLSA 175

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +E QM E G  +  AR +++  L +  +E      F    L++ G  +G+ D       E
Sbjct: 176 LETQMDEHGAALAAARADLVGRLQA-ALEDQPDHPFARPLLAIEG--EGEGD-------E 225

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
               +L   R+ D+ + RTL GPHR DL V +  KA   A  STGEQK +L+ I LAHA 
Sbjct: 226 PLGLRLARERRRDAAAGRTLSGPHRQDLAVVHAAKAQAAALCSTGEQKALLLSILLAHAA 285

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L++   G  P+LLLDE++AHLD  +R ALF  + + GSQ++MTGT+ ++F+ L   ++F 
Sbjct: 286 LVAAHRGQPPVLLLDEVAAHLDPSRRAALFDRLRETGSQVWMTGTESALFNGLPVASRFC 345

Query: 366 RISNH 370
             + H
Sbjct: 346 VTAGH 350


>gi|91204849|ref|YP_537204.1| recombination protein F [Rickettsia bellii RML369-C]
 gi|122426139|sp|Q1RKJ9|RECF_RICBR RecName: Full=DNA replication and repair protein recF
 gi|91068393|gb|ABE04115.1| DNA replication and repair protein RecF [Rickettsia bellii
           RML369-C]
          Length = 360

 Score =  202 bits (513), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 120/356 (33%), Positives = 189/356 (53%), Gaps = 6/356 (1%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +  +RN+ +L L  D      +G+NG GKTNILEAIS   PGRG R A  AD+ R  S  
Sbjct: 11  VENYRNFKNLELKTDNIPITIIGENGSGKTNILEAISLFYPGRGLRSARLADICR-ESED 69

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
             S  A ++   GLA+ S +++   +R  R  + N+  I   +EL+K   + WL P M+ 
Sbjct: 70  HCSVRALLQSKLGLAEFSTQIKRISNR--RTTEYNNSKI-ANNELSKFTSMVWLTPQMEG 126

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           IF+  + +RR+F DR+V+  DP+H   +  +E  M+ RN++L E  +D++W  +IE +MA
Sbjct: 127 IFTSGTSDRRKFFDRIVYNFDPKHAELVSKYEHYMQERNKILAEDMWDNNWLKTIEEKMA 186

Query: 192 ELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKL 251
           +  + I   R++ +  +   I +   +  FP  +LS+ G ++ K       +    A +L
Sbjct: 187 DTSIYIANNRLKTLEFMQQAIDDL--ENEFPKAELSIDGMVEQKILNGEEDVVGFIAAEL 244

Query: 252 FDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTT 311
              R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA        T
Sbjct: 245 HKTRDKDKLLGRTSFGVHKSDFLVKHKHKNILAKFCSTGEQKAILIAIILAEMNYAIKLT 304

Query: 312 GFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
             APILLLDE+  HLD+ +RN L      I  Q+++T TD    +     ++ +++
Sbjct: 305 KTAPILLLDEVFVHLDDRRRNYLTEFFISINLQLWVTATDLKGIEEFGNKSQLIKL 360


>gi|157825165|ref|YP_001492885.1| recombination protein F [Rickettsia akari str. Hartford]
 gi|166221858|sp|A8GLV2|RECF_RICAH RecName: Full=DNA replication and repair protein recF
 gi|157799123|gb|ABV74377.1| recombination protein F [Rickettsia akari str. Hartford]
          Length = 360

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 188/358 (52%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L+++ +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A   D+ +  S
Sbjct: 9   LSLANYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLDDICK-AS 67

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             +    A ++   GLA+ S  ++   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 68  EDYCIVKALLQSQLGLAEFSTHIKRNSNR--RITEYNESKI-ANNELSKFTSMVWLTPQM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+   P+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSSDRRKFLDRIVYNFYPKHAELVSKYEYYMHERNKILAEDIRDDNWLKIIEGK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I E   +  FP   LS+ G ++ +       L      
Sbjct: 185 MADMSSHIANNRLKTLEFMQQAIDEL--ENEFPKADLSIDGIVEQRILDGEENLVNFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA    +  
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYVIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L    T +  Q+++T T+    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDTRRQYLIEFFTTLSMQLWVTDTNLEGIENFASKAQLIKL 360


>gi|34581007|ref|ZP_00142487.1| RecF protein [Rickettsia sibirica 246]
 gi|28262392|gb|EAA25896.1| RecF protein [Rickettsia sibirica 246]
          Length = 360

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 187/358 (52%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  A+V +   
Sbjct: 9   LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +ELNK   + WL P M
Sbjct: 69  DHCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELNKFTSMVWLTPHM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSSDRRKFLDRIVYNFDPKHAELVSKYEYYMHERNKILVEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I +   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQQAIDDL--ENEFPKADLSIDGIVEQKILNGKKNIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L   +T +  Q+++T T+    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFLTGLNMQLWVTTTNLEGIENFATKAQLIKL 360


>gi|157826419|ref|YP_001495483.1| recombination protein F [Rickettsia bellii OSU 85-389]
 gi|226737824|sp|A8GUF0|RECF_RICB8 RecName: Full=DNA replication and repair protein recF
 gi|157801723|gb|ABV78446.1| recombination protein F [Rickettsia bellii OSU 85-389]
          Length = 360

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 120/356 (33%), Positives = 188/356 (52%), Gaps = 6/356 (1%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +  +RN+ +L L  D      +G+NG GKTNILEAIS   PGRG R A  AD+ R  S  
Sbjct: 11  VENYRNFKNLELKTDNIPITIIGENGSGKTNILEAISLFYPGRGLRSARLADICR-ESED 69

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
             S  A ++   GLA+ S +++   +R  R  + N+  I   +EL+K   + WL P M+ 
Sbjct: 70  HCSVRALLQSKLGLAEFSTQIKRISNR--RTTEYNNSKI-ANNELSKFTSMVWLTPQMEG 126

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           IF   + +RR+F DR+V+  DP+H   +  +E  M+ RN++L E  +D++W  +IE +MA
Sbjct: 127 IFMSGTSDRRKFFDRIVYNFDPKHAELVSKYEHYMQERNKILAEDMWDNNWLKTIEEKMA 186

Query: 192 ELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKL 251
           +  + I   R++ +  +   I +   +  FP  +LS+ G ++ K       +    A +L
Sbjct: 187 DTSIYIANNRLKTLEFMQQAIDDL--ENEFPKAELSIDGMVEQKILNGEEDVVGFIAAEL 244

Query: 252 FDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTT 311
              R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA        T
Sbjct: 245 HKTRDKDKLLGRTSFGVHKSDFLVKHKHKNILAKFCSTGEQKAILIAIILAEMNYAIKLT 304

Query: 312 GFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
             APILLLDE+  HLD+ +RN L      I  Q+++T TD    +     ++ +++
Sbjct: 305 KTAPILLLDEVFVHLDDRRRNYLTEFFISINLQLWVTATDLKGIEEFGNKSQLIKL 360


>gi|97180901|sp|Q4UNG8|RECF_RICFE RecName: Full=DNA replication and repair protein recF
          Length = 364

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 184/358 (51%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  AD+ +   
Sbjct: 9   LTLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKASE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 69  DQCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPQM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  D +H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSSDRRKFLDRIVYNFDSKHAELVSKYEYYMYERNKILAEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I E   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADMSSHIANNRLKTLEFMQQAIDEL--ENEFPKADLSIDGIVEQKILDGKENIVNFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L    T +  Q+++T TD    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRGYLIEFFTGLNMQLWVTATDLEGIENFANKAQLIKL 360


>gi|67458427|ref|YP_246051.1| recombination protein F [Rickettsia felis URRWXCal2]
 gi|67003960|gb|AAY60886.1| DNA replication and repair protein RecF [Rickettsia felis
           URRWXCal2]
          Length = 420

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 119/358 (33%), Positives = 184/358 (51%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  AD+ +   
Sbjct: 65  LTLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKASE 124

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 125 DQCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPQM 180

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  D +H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 181 EGIFTSGSSDRRKFLDRIVYNFDSKHAELVSKYEYYMYERNKILAEDIRDDNWLKIIEEK 240

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I E   +  FP   LS+ G ++ K       +      
Sbjct: 241 MADMSSHIANNRLKTLEFMQQAIDEL--ENEFPKADLSIDGIVEQKILDGKENIVNFITA 298

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 299 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 358

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L    T +  Q+++T TD    ++    A+ +++
Sbjct: 359 LTKIAPILLLDEVFVHLDDKRRGYLIEFFTGLNMQLWVTATDLEGIENFANKAQLIKL 416


>gi|157964093|ref|YP_001498917.1| recombination protein F [Rickettsia massiliae MTU5]
 gi|166918725|sp|A8F0D4|RECF_RICM5 RecName: Full=DNA replication and repair protein recF
 gi|157843869|gb|ABV84370.1| DNA replication and repair protein RecF [Rickettsia massiliae MTU5]
          Length = 360

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 186/358 (51%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  AD+ +   
Sbjct: 9   LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLADICKTSE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 69  DHCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPHM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSSSSDRRKFLDRIVYNFDPKHTELVSKYEYYMHERNKILVEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I +   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQHAIDDL--ENEFPKADLSIDGIVEQKILNGEENIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRNNDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L    T +  Q+++T T+    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFFTGLNMQLWVTTTNLEGIENFATKAQLIKL 360


>gi|157827903|ref|YP_001494145.1| recombination protein F [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932591|ref|YP_001649380.1| recombination protein F [Rickettsia rickettsii str. Iowa]
 gi|166221859|sp|A8GQG2|RECF_RICRS RecName: Full=DNA replication and repair protein recF
 gi|189039635|sp|B0BVU8|RECF_RICRO RecName: Full=DNA replication and repair protein recF
 gi|157800384|gb|ABV75637.1| recombination protein F [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907678|gb|ABY71974.1| DNA replication and repair protein [Rickettsia rickettsii str.
           Iowa]
          Length = 360

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 187/358 (52%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  A+V +   
Sbjct: 9   LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 69  DHCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPHM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSNDRRKFLDRIVYNFDPKHAELVSKYEYYMHERNKILVEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I +   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQQAIDDL--ENEFPKADLSIDGIVEQKILNGKENIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L   +T +  Q+++T T+    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFLTGLNMQLWVTTTNLEGIENFANKAQLIKL 360


>gi|114568557|ref|YP_755237.1| DNA replication and repair protein RecF [Maricaulis maris MCS10]
 gi|114339019|gb|ABI64299.1| DNA replication and repair protein RecF [Maricaulis maris MCS10]
          Length = 384

 Score =  199 bits (505), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 191/366 (52%), Gaps = 15/366 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV-TRIG 68
           L ++ FR+Y  L L          G+NG GKTN+LEAISFL+PGRG R A    V TR G
Sbjct: 17  LRLTNFRSYPDLDLELSPAPVALFGENGAGKTNLLEAISFLAPGRGMRSAGADGVATRSG 76

Query: 69  S--PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           +     ++ FA  +  EG   + +       R  R     D      + L + + + WL 
Sbjct: 77  ADIAPEWAVFAEADTREGGFRLGVGARGSARRETRI----DGEPAAQNALARLMPMIWLT 132

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P+ DR+F+G   +R +F DR+V A DP H      +E+    R RLL EG  D SW  +I
Sbjct: 133 PAQDRLFAGPRADRLKFFDRLVHAADPAHADAASAYEKSRTRRQRLLDEGGQDPSWLGAI 192

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKEN--FPHIKLSLTGFLDGKFDQSFCALK 244
           E +MA  GV +  AR   ++AL  L  E  Q+    FP   L+L G ++    +   A +
Sbjct: 193 EVEMAGHGVAMAAAR---LDALIRLQGEIDQRPEGVFPQADLALDGAVEADLAEGLTAGE 249

Query: 245 EE--YAKKLFDGRKMDSMSRRTLI-GPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            E  +   L DGR+ D+ + RTL  GPHR++L+  +  K       STGEQK +++ + L
Sbjct: 250 AEDRFLAALRDGRRRDAAAGRTLTRGPHRTELLARHRAKDQPAGDCSTGEQKALILTLAL 309

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           A AR +    G AP+LLLDE  AHLD  +R+ L R +   GSQ ++TG +K +F+   + 
Sbjct: 310 AQARALGQQWGVAPLLLLDEACAHLDALRRDGLAREILASGSQAWLTGVEKVLFEPFGDA 369

Query: 362 AKFMRI 367
            ++  +
Sbjct: 370 IQYREV 375


>gi|238650345|ref|YP_002916197.1| recombination protein F [Rickettsia peacockii str. Rustic]
 gi|259563671|sp|C4K0P8|RECF_RICPU RecName: Full=DNA replication and repair protein recF
 gi|238624443|gb|ACR47149.1| recombination protein F [Rickettsia peacockii str. Rustic]
          Length = 360

 Score =  199 bits (505), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 187/358 (52%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  A+V +   
Sbjct: 9   LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 69  DHCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPHM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSNDRRKFLDRIVYNFDPKHAELVSKYEYYMHERNKILVEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I +   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQQAIDDL--ENEFPKADLSIDGIVEQKILNGKENIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L   +T +  Q+++T T+    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFLTGLNMQLWVTTTNLEGIENFATKAQLIKL 360


>gi|294675560|ref|YP_003576175.1| DNA replication and repair protein RecF [Rhodobacter capsulatus SB
           1003]
 gi|294474380|gb|ADE83768.1| DNA replication and repair protein RecF [Rhodobacter capsulatus SB
           1003]
          Length = 352

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/363 (33%), Positives = 187/363 (51%), Gaps = 24/363 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L + +FR++    L  DA+     G NG GKT++LEA+S LSPGRG RRAS  ++ R
Sbjct: 2   LRDLTLLQFRSHRRAVLALDARPVALYGPNGAGKTSVLEAVSLLSPGRGLRRASAEELIR 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 +   A       L D  ++       S   L       +V   L + LR+ WLV
Sbjct: 62  RQEQVGWKIRAT------LTDYEVETSALPGASREVLIDGKAAAQVA--LGRLLRVLWLV 113

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P+MDR++   +  RRRFLDRM  +  P H   ++ +E+ MR RNRLL +   D++W  ++
Sbjct: 114 PAMDRLWIEAAEGRRRFLDRMTLSFFPTHAEAVLAYEKAMRERNRLLKDEIRDAAWYGAL 173

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           E +MAE G  +   R + +  L++             + L+  G              E+
Sbjct: 174 ETRMAEAGALMTAHRRQALAQLATAQAGAATAFPAADLGLTAEG-------------PED 220

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
            A  L +GR+ D  + RTL GPHR DL   Y +KAI     STGEQK +L+ + LA+   
Sbjct: 221 LATALAEGRRRDMAAGRTLEGPHRVDLTAVYAEKAIPADQCSTGEQKALLISLLLAN--- 277

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
                G   +LLLDE++AHLD  +R AL+  +  + +Q+ MTGT   +FDSL E  ++ +
Sbjct: 278 ARALAGENTVLLLDEVAAHLDAGRRAALYDEICALPAQVLMTGTGAELFDSLGERGRYWQ 337

Query: 367 ISN 369
           ++ 
Sbjct: 338 VTE 340


>gi|85710419|ref|ZP_01041483.1| recombinational DNA repair ATPase [Erythrobacter sp. NAP1]
 gi|85687597|gb|EAQ27602.1| recombinational DNA repair ATPase [Erythrobacter sp. NAP1]
          Length = 362

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 191/373 (51%), Gaps = 25/373 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  + +  FRN+A   L   A   + VG+NG GKTN+LEAIS LSPGRG RRA+  D+
Sbjct: 1   MALAKITLQNFRNHARSELAETAHFNLLVGENGAGKTNVLEAISLLSPGRGLRRANLTDL 60

Query: 65  TRIGS----PSFFSTFAR-VEGMEGLADISIKLETRDDRSVRCL-QIN--DVVIRVVDEL 116
            R       P  F+  A  +E  +G     I   T  +R  R L +IN  D     + E 
Sbjct: 61  ARKAPGDAQPGAFAIGASLIE--QGQVSARIGTYTEAERPTRRLVRINGADASASALSEW 118

Query: 117 NKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG 176
           +    +SWL P+MD +F+  +  RRRF+DRM  AI+P H + +   E  +R RNRLL E 
Sbjct: 119 HA---VSWLTPAMDGLFTDSAGARRRFVDRMALAIEPGHAKAVNQLEIALRERNRLLEE- 174

Query: 177 YFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF 236
           + D+ W  +IEAQ A+ G  +   R  +I  LS  +  +  +   P  +  LT    G  
Sbjct: 175 HGDARWLDAIEAQAAQHGSVVAANRSRLIAMLSDELSAFPPE---PFARPILTYRPGGPL 231

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
                   EE   +    R  D  + R L GPHR +L V         A  STGEQK +L
Sbjct: 232 ------APEELLAEFARARPRDRAAGRALTGPHRDELEVVMMGTGQPAASSSTGEQKAML 285

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + I LAH  L S  +G   +LLLDE++AHLD  +R ALF  +    +Q++MTGT+ + F 
Sbjct: 286 IAITLAHGVLAS--SGRPSVLLLDEVAAHLDPVRRKALFDRLRAGKAQVWMTGTELAPFA 343

Query: 357 SLNETAKFMRISN 369
            + E A   R+S 
Sbjct: 344 EIEEEAAVWRVSG 356


>gi|1049325|gb|AAB51449.1| RecF [Caulobacter crescentus CB15]
          Length = 388

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/373 (33%), Positives = 195/373 (52%), Gaps = 15/373 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT-RIG 68
           L +++FR+Y   RL    +     G NG GKTN+LEAIS LSPG+G R  S A+V  R+ 
Sbjct: 9   LTLADFRSYERARLETGGRSVYLFGANGAGKTNLLEAISLLSPGKGLRGVSLAEVGRRLP 68

Query: 69  SPSFFSTFARVEGMEGLADISIKLET---RDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
             +    +A    ++   D  +++ T   +   + R +++    +     L  H+R  WL
Sbjct: 69  GEAVGRAWAVAAEVQSGEDAPVRIGTGVEQGGAARRTVRLEGETV-PPGRLADHVRPIWL 127

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMR------GRNRLLTEGYFD 179
            P+ DR+F   + ERRRF DR+VFA +P H      +++  R       R R       D
Sbjct: 128 TPAQDRLFLEAASERRRFFDRLVFAGEPAHAANANGYDKAQRRAYAPACRRRRNGRAPAD 187

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD--GKFD 237
           ++W +++EA++AE G  +  AR   + AL + I +      FP  +L LTG  +      
Sbjct: 188 AAWLTALEARLAEFGALLAQARARTLLALQAEI-DGRGDRPFPLARLGLTGEWERMAVEG 246

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
             F  ++ + A+ L   R  D  + R L GPHR DL + + +K    A  STGEQK +++
Sbjct: 247 APFAEIELKLAQALASARARDGAAGRALTGPHRGDLAIFHVEKDRPAAECSTGEQKALIL 306

Query: 298 GIFLAH-ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
            + LA  ARL    +   P++LLDE++AHLD  +R AL   +T +  Q F+TGTD+S+FD
Sbjct: 307 NLVLAQAARLSRAESAPNPVILLDEVAAHLDLTRRAALADELTALKLQAFLTGTDESLFD 366

Query: 357 SLNETAKFMRISN 369
            L   A  +R+ +
Sbjct: 367 HLKGRALGVRVGD 379


>gi|229586258|ref|YP_002844759.1| recombination protein F [Rickettsia africae ESF-5]
 gi|259563670|sp|C3PM56|RECF_RICAE RecName: Full=DNA replication and repair protein recF
 gi|228021308|gb|ACP53016.1| DNA replication and repair protein RecF [Rickettsia africae ESF-5]
          Length = 360

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/358 (32%), Positives = 186/358 (51%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG R A  A+V +   
Sbjct: 9   LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLRSAKLANVCKTSE 68

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL P M
Sbjct: 69  DHCLVK-ALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTPHM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSSDRRKFLDRIVYNFDPKHAELVSKYEYYMHERNKILVEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I +   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQQAIDDL--ENEFPKADLSIDGIVEQKILNGKKNIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T  APILLLDE+  HLD+ +R  L   +  +  Q+++T T+    ++    A+ +++
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFLIGLNMQLWVTTTNLEGIENFATKAQLIKL 360


>gi|51473311|ref|YP_067068.1| recombination protein F [Rickettsia typhi str. Wilmington]
 gi|81692324|sp|Q68XQ6|RECF_RICTY RecName: Full=DNA replication and repair protein recF
 gi|51459623|gb|AAU03586.1| DNA replication and repair protein RecF [Rickettsia typhi str.
           Wilmington]
          Length = 360

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 123/362 (33%), Positives = 187/362 (51%), Gaps = 14/362 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           LN+  +RN+ +L L  D    I  G+NG GKTNILEAIS   PGRG R +   D+ +  S
Sbjct: 9   LNLENYRNFKNLELKIDNIPIILTGENGSGKTNILEAISLFYPGRGLRSSKLTDICK-TS 67

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             +    A ++   G+AD S  ++   +R  R  + N   I   +EL+K   + WL P M
Sbjct: 68  EDYCRVKALLQSKLGIADFSTHIKRNSNR--RITEYNASKI-ANNELSKFTSMVWLTPQM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  D +H   +  +E  M  RN++L E   D++W   IE  
Sbjct: 125 EGIFTSSSTDRRKFLDRIVYNFDTKHAELLNKYEYYMHERNKILAEDIRDNNWLKIIEEN 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA +   I   R++ I  +   I E ++ E FP   LS+    DG  +Q    ++E+   
Sbjct: 185 MANISNIIANNRLKTIRFMQQAIDE-IENE-FPKADLSI----DGIIEQKILNVEEDIVS 238

Query: 250 ----KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
               +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA   
Sbjct: 239 FIITELYQTRSKDKLLGRTSFGIHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMN 298

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
                T   PILLLDEI  HLD+ +R  L    T +  Q+++T T+    ++    A+ +
Sbjct: 299 STIKLTKITPILLLDEIFVHLDDKRRQYLMDFFTALNIQLWVTATNLDGIENFANKAQLI 358

Query: 366 RI 367
           ++
Sbjct: 359 KL 360


>gi|209542191|ref|YP_002274420.1| recombination protein F [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529868|gb|ACI49805.1| DNA replication and repair protein RecF [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 373

 Score =  196 bits (497), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 133/367 (36%), Positives = 194/367 (52%), Gaps = 7/367 (1%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           ++  L +++FRNY  L    +A  T+  G+NG GKTN+LEA+S L PGRG R A  A++ 
Sbjct: 3   RLDRLALTDFRNYRHLAWRPEAPVTVVTGENGSGKTNLLEALSLLVPGRGLRGARSAEMA 62

Query: 66  RIGSPSFFSTFARVEGMEGLA-DISIKLE-TRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           R G+ + +   AR  G +G   DI+   +  R +R  R  + +   +R    L  HL   
Sbjct: 63  RHGT-TIWGVAARFTGPDGAPFDIATGSDPARPER--RVFRRDGETLRSRAALADHLSAV 119

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P MDR+F      RRRFLDR+V A++P H R +   ++ M  RNRLL  G  D  W 
Sbjct: 120 WLTPQMDRLFQDGLPGRRRFLDRLVLALEPGHARELAAHDQAMGQRNRLLAAGRADPGWL 179

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCA 242
           S++E  MA   V  + AR+ ++  L+      V  + FP  +L  L   +    D+   A
Sbjct: 180 SALEDSMARHAVAASAARLALVTQLNGEAAHTV-PDGFPPARLDILCPIVQQLRDRPALA 238

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++    +L  GR  D       +G HR+D+ +         A  STG+QK +L+G+ LA
Sbjct: 239 VEDWLRGRLAAGRAADGARGGAGMGAHRADMALSDQASGRPAAQASTGQQKALLLGVVLA 298

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA L++ + G AP++LLDE   HLDE +R ALFR V    + + MTGTD   F  L   A
Sbjct: 299 HAALMTRSRGEAPMILLDEPLVHLDEARRAALFRSVGAFDATVLMTGTDADQFAPLRGRA 358

Query: 363 KFMRISN 369
            F+   N
Sbjct: 359 GFVSPRN 365


>gi|167644130|ref|YP_001681793.1| recombination protein F [Caulobacter sp. K31]
 gi|259563357|sp|B0T360|RECF_CAUSK RecName: Full=DNA replication and repair protein recF
 gi|167346560|gb|ABZ69295.1| SMC domain protein [Caulobacter sp. K31]
          Length = 392

 Score =  195 bits (496), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 133/383 (34%), Positives = 190/383 (49%), Gaps = 17/383 (4%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           +R  +  L +++FR+Y    L  D       G NG GKTN+LEAIS LSPG+G R +S  
Sbjct: 2   SRAALLSLTLTDFRSYERATLRPDGASVYLFGANGAGKTNLLEAISLLSPGKGLRGSSLI 61

Query: 63  DVTR--IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDE----- 115
           +V R   G  +  +     E      D       R    V        ++R+  E     
Sbjct: 62  EVGRRLPGEATGRAWAVAAETEAPQTDFGQDEPVRLGTGVELAGAARRIVRIDGETVPPG 121

Query: 116 -LNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT 174
            L  H+R  WL P+ DR+F   + ERRRF DR+VFA +P H      +++  R R RLLT
Sbjct: 122 RLADHVRPIWLTPAQDRLFLEAASERRRFFDRLVFAGEPAHAGHANAYDKAQRERMRLLT 181

Query: 175 EGY-----FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLT 229
           +        D+ W +++EA++   G  +  AR   + AL + I +      FP  +L+LT
Sbjct: 182 DAAESGQPADAVWLTALEARLGAAGALMANARARTLMALQAEI-DSRGDRPFPRARLALT 240

Query: 230 GFLD--GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
           G  +           ++   A  L   R  D  + R L GPHR DL + + DK    A  
Sbjct: 241 GEWEKLALVGVEIAEIEARLAAALAAARPRDGAAGRALTGPHRGDLAIHHVDKDRPAAEC 300

Query: 288 STGEQKVVLVGIFLAHA-RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIF 346
           STGEQK +++ + LA A RL        PILLLDE++AHLD  +R AL   +T +G Q F
Sbjct: 301 STGEQKALILNLVLAQAARLSRAKDAPNPILLLDEVAAHLDLKRRAALADEITALGLQAF 360

Query: 347 MTGTDKSVFDSLNETAKFMRISN 369
           +TGTD+S+FD L   A  +R+S 
Sbjct: 361 LTGTDQSLFDHLKGRALGVRVSE 383


>gi|239948452|ref|ZP_04700205.1| DNA replication and repair protein RecF [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239922728|gb|EER22752.1| DNA replication and repair protein RecF [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 360

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 179/342 (52%), Gaps = 6/342 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RN+ +L L  D    I +G+NG GKTNILEAIS   PGRG + A  A + +  S
Sbjct: 9   LSLENYRNFKNLELKTDNTPIILIGENGSGKTNILEAISLFYPGRGLKSAKLAYICKT-S 67

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
               +  A ++   GLA+ + + +   +R  R  + N+  I   +EL+K   + WL   M
Sbjct: 68  EDHCTVKALLQSKLGLAEFTTQFKRSSNR--RITEYNESKI-ANNELSKFTSMVWLTSQM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  DP+H   +  +E  M  RN++L E   D +W   IE +
Sbjct: 125 EGIFTSGSSDRRKFLDRIVYNFDPKHAELVSKYEYYMHERNKILAEDIRDDNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ +  +   I E   +  FP   LS+ G ++ K       +      
Sbjct: 185 MADISNHIANNRLKTLEFMQQAIDEL--ENEFPKADLSIDGIVEQKILDGEENIVSFITA 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYQTRSKDKLLGRTSFGVHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEMNYAIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            T  APILLLDE+  HLD+ +R  L    T +  Q+++T TD
Sbjct: 303 LTKIAPILLLDEVFVHLDDKRRQYLIEFFTCLNMQLWVTATD 344


>gi|254419522|ref|ZP_05033246.1| RecF/RecN/SMC N terminal domain, putative [Brevundimonas sp. BAL3]
 gi|196185699|gb|EDX80675.1| RecF/RecN/SMC N terminal domain, putative [Brevundimonas sp. BAL3]
          Length = 377

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/382 (34%), Positives = 201/382 (52%), Gaps = 31/382 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +++FR+YAS RL   +   +  G NG GKTN+LEAIS L+PG+G R A+ A++ R
Sbjct: 2   ITSLTLTDFRSYASARLELASGPVVLHGPNGAGKTNLLEAISLLTPGKGLRGATAAEMGR 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK------HL 120
                         G      + +  ETR    V+       ++R+  E  +      +L
Sbjct: 62  -------REPGEAVGRAWAVMVELDDETRLGTGVQTAGAARRIVRIDGETAQPGRLLDYL 114

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY--- 177
           R  W  P  DR+FS    ER +F DR+VFA DP H   +  +E+ +R R RLL +     
Sbjct: 115 RPVWATPEQDRLFSDARAERLKFFDRLVFAADPDHAAAVSAYEKALRERLRLLNDAQDGR 174

Query: 178 -FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD--- 233
             D  W  ++EA++ E G +  +ARV  ++AL + I +  +   FP   L L G  +   
Sbjct: 175 EADPVWLDALEARLGEAGARAALARVAALHALQAAI-DARRDRPFPQADLGLDGPAEQMA 233

Query: 234 ---GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
               + D+   A++E  AK     R  D  + R+L GPHR+DL   + +K    A GS+G
Sbjct: 234 EAGAEEDEIAAAIREGLAK----ARARDGAAGRSLFGPHRTDLTALHREKNRPAAEGSSG 289

Query: 291 EQKVVLVGIFLAH-ARLISNTTGFA--PILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           EQK +++ + LA  +RL  +    A  P+LLLDE  AHLDE +R ALF  +  +  Q FM
Sbjct: 290 EQKALVLNLILAQISRLAHHDAAGAARPVLLLDEAPAHLDEARRAALFDEIVALDLQAFM 349

Query: 348 TGTDKSVFDSLNETAKFMRISN 369
           TGT++S+F  L+  A+F+R++ 
Sbjct: 350 TGTERSLFAGLDGRAQFVRVAG 371


>gi|330994266|ref|ZP_08318194.1| DNA replication and repair protein recF [Gluconacetobacter sp.
           SXCC-1]
 gi|329758733|gb|EGG75249.1| DNA replication and repair protein recF [Gluconacetobacter sp.
           SXCC-1]
          Length = 374

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 193/363 (53%), Gaps = 7/363 (1%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +  L +++FRNY  L        T+  G NG GKTN+LEA+S L+PGRG R A   ++ R
Sbjct: 4   VNRLVLTDFRNYRHLSWRPQRAVTVITGPNGSGKTNLLEALSLLAPGRGLRGARMDELPR 63

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDR---SVRCLQINDVVIRVVDELNKHLRIS 123
            G  + +   A V  + G   + + L T  D      R  +++   +R  D ++ +    
Sbjct: 64  HGE-ALWGIAADVADLPGPDGLPVSLATGADPLRPERRTFRVDGQTLRNRDGISGYFAAV 122

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL P MDR+F   +  RRRFLDR+V A++P H R +   +R M  R R+L +   D  W 
Sbjct: 123 WLTPQMDRLFQEGAAGRRRFLDRLVLALEPGHAREVAAHDRAMLQRGRVLAQYGADPHWL 182

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF-DQSFCA 242
           +++E  MA   V    AR +M+  L++     +  + FP  +L+L   +  +   +   A
Sbjct: 183 AALERTMARHAVAATAARADMVARLNADGQALL--DGFPAARLALDCVIARRLAHEPALA 240

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +++  A+ L   R +D     +  G HR+DL +            STG+QK +LVGI L+
Sbjct: 241 VEDWLAECLAGTRAVDRQRGGSRFGAHRADLHMADRLTDRPAGQSSTGQQKALLVGIILS 300

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HAR+++   G AP+LLLDE   HLD  +R+ALF  +  + + + +TGTD+  FD L ++A
Sbjct: 301 HARILTACRGQAPLLLLDEPLVHLDAARRDALFHAMGRMRTGVMLTGTDREQFDPLRQSA 360

Query: 363 KFM 365
           +F+
Sbjct: 361 EFV 363


>gi|300021543|ref|YP_003754154.1| SMC domain protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523364|gb|ADJ21833.1| SMC domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 455

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 126/337 (37%), Positives = 184/337 (54%), Gaps = 17/337 (5%)

Query: 47  ISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISIK----------LETRD 96
           +S  S GRG      +D +R+ +P+   +        G +D S+            E   
Sbjct: 111 LSSPSTGRGQDPGGVSDRSRVDTPAPNPSPQGGGEPFGFSDESLARNAQRGGGRAAERAP 170

Query: 97  DRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHR 156
               R ++I+         L  +L I W+ P+MD +F+G   ERRRFLDR++   D  +R
Sbjct: 171 SERGRIVRIDGTAQSGSGVLADYLEIVWVTPAMDGLFTGPGSERRRFLDRLILCFDHGYR 230

Query: 157 RRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYV 216
                FER M  RNRLL +G  D S  S  E  MAE GV +  AR+E + A++ ++ +  
Sbjct: 231 TIAGRFERAMTSRNRLLADGVRDDSQLSGFERVMAETGVAVAAARLEAVAAMAQIVGKRR 290

Query: 217 QKEN---FPHIKLSLTGFLDGKFDQSFCALKEE--YAKKLFDGRKMDSMSRRTLIGPHRS 271
           +++    FP     L G ++    Q   A++ E  YA+ L   R+ D  + RTL GPHRS
Sbjct: 291 ERDPNSAFPWSSFRLEGSIEDSL-QRLSAVEAEDLYAQTLRQTRERDRAASRTLDGPHRS 349

Query: 272 DLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN-TTGFAPILLLDEISAHLDEDK 330
           DLIV++  K +   H STGEQK +L+G+ LAHA L++    G APILLLDEI+AHLD D+
Sbjct: 350 DLIVEHGPKGLAARHCSTGEQKALLLGLVLAHAELLTERQEGAAPILLLDEITAHLDADR 409

Query: 331 RNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
           R ALF  +  +G+Q +MTGTDK+ F++L   A+F  +
Sbjct: 410 RAALFDEILHLGAQAWMTGTDKNAFEALAGRARFWAV 446



 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 3/106 (2%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
           +N + ++ L ++ FR+YA+  +  DA   + VG NG GKTN+LEA+S LSPG+G RR  +
Sbjct: 6   SNALWVERLQLTNFRSYAAANVATDAGPQVIVGANGSGKTNLLEALSLLSPGQGLRRVPF 65

Query: 62  ADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQIND 107
           +D+ R G    F+  AR   + G  DI   L      +VR L  +D
Sbjct: 66  SDLVRSGGDGGFAVAARAHTLAGATDIGTGLRA---TTVRSLSGDD 108


>gi|302381120|ref|YP_003816943.1| SMC domain protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302191748|gb|ADK99319.1| SMC domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 381

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/383 (32%), Positives = 193/383 (50%), Gaps = 29/383 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L +++FR+YA+  L  +    +  G NG GKTN+LEA+S  +PG+G R A+  ++ R
Sbjct: 2   IRALTLTDFRSYAAATLSVETGPVVLHGPNGAGKTNLLEALSLFTPGKGLRAATAQEMGR 61

Query: 67  -----IGSPSFFS--TFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
                 G  ++    T A  +G +      +++     R VR         R++D    +
Sbjct: 62  REPGETGGRAWAVALTLAGPDGDDVRLGTGVQVAGAGRRMVRIEGETAQPGRLLD----Y 117

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-- 177
           LR  W  P  DR+FS    ER +F DR+VFA DP H   +  +E+ +R R RLL +G   
Sbjct: 118 LRPVWATPEQDRLFSDARAERLKFFDRLVFAADPGHAAAVAGYEKALRERLRLLVDGAEG 177

Query: 178 --FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD-- 233
              D  W  ++E ++ E G +   AR   +  L + I    ++  FP   L L G  +  
Sbjct: 178 READPLWLDALEVRLGETGARAASARARALGVLQAAIDARAERP-FPQADLGLDGAAETA 236

Query: 234 ---GKFDQSFCA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
              G  D++  A ++E  A+     R  D  + R+L GPHR+DL   + +K    A GS+
Sbjct: 237 AANGSDDEAIAAGIREGMARS----RARDGAAGRSLFGPHRTDLTALHREKNRPAAEGSS 292

Query: 290 GEQKVVLVGIFLAHARLISNTTG---FAPILLLDEISAHLDEDKRNALFRIVTDIGSQIF 346
           GEQK +++ + LA    +  T G     P+LLLDE  AHLD  +R ALF  +  +  Q F
Sbjct: 293 GEQKALVLNLILAQIGRLKATGGPTPAPPVLLLDEAPAHLDAGRRAALFDEIVALDLQAF 352

Query: 347 MTGTDKSVFDSLNETAKFMRISN 369
           MTGT+  +F+ L   A F+R+  
Sbjct: 353 MTGTEADLFEPLRGRAAFVRVEG 375


>gi|7019618|gb|AAB70169.2| RecF [Sinorhizobium meliloti]
          Length = 176

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/167 (50%), Positives = 117/167 (70%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +S+FRNYA+L L  D +H +  G+NG GKTN++E +SFLSPGRG RRA+
Sbjct: 1   MPHKVFLTRLKLSDFRNYATLALDLDQRHVVLTGENGAGKTNLMEGVSFLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           YADV R+G+P  FS FA V+GMEG  +I    +  ++   R L+IN    R VDEL  HL
Sbjct: 61  YADVARVGAPDGFSVFAAVDGMEGSVEIGTGTQGTEEGQSRRLRINGTAARTVDELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMR 167
           R+ WL P+MD +F+G S +RRRFLDR+V ++DP H RR  +F+R MR
Sbjct: 121 RVLWLTPAMDGLFTGPSADRRRFLDRLVLSLDPEHGRRASEFDRAMR 167


>gi|114326984|ref|YP_744141.1| recombination protein F [Granulibacter bethesdensis CGDNIH1]
 gi|114315158|gb|ABI61218.1| DNA replication and repair protein recF [Granulibacter bethesdensis
           CGDNIH1]
          Length = 373

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 184/354 (51%), Gaps = 7/354 (1%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L ++ FRNYA+L           VG NG GKTN+LEAIS LSPGRG R A    + R
Sbjct: 8   IRTLTLTRFRNYAALAWSPPPGLVGVVGPNGSGKTNLLEAISLLSPGRGLRNARTDQLAR 67

Query: 67  IG--SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            G      ++  AR+    G  +++  +    +R  R ++I+  +IR   EL  H+   W
Sbjct: 68  QGEGGDGSWAVHARILSPTGPVELATGVLPGTER--RQVRIDGDIIRGQAELGAHITTVW 125

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L P MDR+F      RRRFLDR+V+ ++P H R +      +  R RLL     D +W +
Sbjct: 126 LTPQMDRLFQEGPAGRRRFLDRLVYGLEPAHAREVAAQAASLTERARLLAM-RADPAWLA 184

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           ++E  +A     +  +R+  +  L+ ++++      FP  +L L   +  +  +      
Sbjct: 185 AVEDSIARHATAVTASRLAYVTRLNDVLVQG-GAGGFPPARLDLNCAIATRLSRHPAVEV 243

Query: 245 EEYAKK-LFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           E++ +  L D R+ D  S    IG HRSDL++       + +  STG+QK +L+G+ L H
Sbjct: 244 EDWLRAALRDSRETDGESGTQGIGAHRSDLLMKDAATGRSASIASTGQQKALLIGVTLGH 303

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
           A L+    G AP++LLDE   HLD ++R  L   +  +G Q F+T TD+  FD+
Sbjct: 304 AVLLKAVRGRAPVMLLDEPMTHLDAERRRLLLTALRGLGGQGFLTATDRDAFDA 357


>gi|83944866|ref|ZP_00957232.1| recF protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851648|gb|EAP89503.1| recF protein [Oceanicaulis alexandrii HTCC2633]
          Length = 388

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 127/381 (33%), Positives = 196/381 (51%), Gaps = 14/381 (3%)

Query: 2   TNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASY 61
           T    +  L ++ FRNYA L L  DA+     G+NG GKTN++EA+SFL PGRG R A+ 
Sbjct: 8   TGGPAVTRLKLTGFRNYARLDLALDARPVALFGENGAGKTNLVEAVSFLGPGRGLR-AAG 66

Query: 62  ADVTR----IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELN 117
           AD  R     G    ++ +A     EG   ++   + ++    R     D       EL 
Sbjct: 67  ADAVRRRTDQGVDPLWAVYAEAMTPEGPVSLATGADPQN--PTRRRTKLDGAAATQTELA 124

Query: 118 KHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-- 175
           + + + WL P  DR+++G   +R RF DR+V A  P H      +E+ M+ R RLL    
Sbjct: 125 RLIPMLWLTPREDRLWAGPRADRLRFFDRLVLAAAPDHASSASAYEKSMKERQRLLDRVA 184

Query: 176 --GYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD 233
             G  D  W +++EA+MA  GV +  AR++ +  L   I +   +  FP   L+L G ++
Sbjct: 185 EGGRADPDWLNALEAEMAASGVALAAARLDALARLQDEI-DTRPESQFPKADLALDGAVE 243

Query: 234 GKFDQSFCALKEE--YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
            K  +   A + E  +A +L   R  D  + R L GPHR++L   +  K+   +  STGE
Sbjct: 244 AKLAEGLKAGEAEDWFADELQRVRPRDGAAGRALTGPHRTELDARHRAKSQPASDCSTGE 303

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           QK +++G+ LA A  I   +G  P+L+ DE  AHLD  +R+ L   V D+G Q FMTG +
Sbjct: 304 QKSMVLGLALAQAAAIRRLSGRGPVLIFDEACAHLDAARRDGLAETVLDLGVQAFMTGVE 363

Query: 352 KSVFDSLNETAKFMRISNHQA 372
             +F++    A+ + + +  A
Sbjct: 364 PVLFEAFGTGAQRVEVRDGSA 384


>gi|315497054|ref|YP_004085858.1| DNA replication and repair protein recf [Asticcacaulis excentricus
           CB 48]
 gi|315415066|gb|ADU11707.1| DNA replication and repair protein RecF [Asticcacaulis excentricus
           CB 48]
          Length = 374

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 136/376 (36%), Positives = 201/376 (53%), Gaps = 17/376 (4%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           + +I  L++++FR+Y  L +    +     G NG GKTN LEAIS L+PGRG R A+ +D
Sbjct: 2   KTRIHALSLTDFRSYDRLDVDLSGRSLYLFGPNGAGKTNFLEAISVLNPGRGLRGAAVSD 61

Query: 64  VTR--IGSPSFFSTFARVEGMEGLADISIKLETRDDRSV--RCLQINDVVIRVVDELNKH 119
           + R         +    VE      DI I   + D RS+  R ++I+   +     L  H
Sbjct: 62  LGRRLPQEAKGRAWGVSVELKSAEDDIRIGTGS-DPRSLEKRLVRIDQQTV-PAGRLLDH 119

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
           +R+ WL P+ DRIF     ER RF DR+VFA  P H   +  +E+ +R R +LL +G  D
Sbjct: 120 IRLVWLTPAQDRIFLEARAERLRFFDRLVFAATPSHATTVSAYEKALRERLKLLVQGPAD 179

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN-FPHIKLSLTGFL-DGKFD 237
           + W  ++E ++AE G ++  AR     ALS L  E    E+ FP   L L     D +  
Sbjct: 180 AVWLDALEERLAEAGSEMIGARR---AALSDLQAEIEAHESAFPKADLGLINEASDARER 236

Query: 238 QSF-CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           ++   AL+E +A+        DS + R+L GPHR+DL V + +K    A  STGEQK ++
Sbjct: 237 ETLNTALREGFARAR----ARDSAAGRSLFGPHRTDLSVFHREKDRPAADCSTGEQKALV 292

Query: 297 VGIFLAH-ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           + + LA  +RL    +   P++LLDE++AHLD  +R ALF     +G Q   TGTD+S+F
Sbjct: 293 LNLILAQGSRLSRVKSAPNPVVLLDEVAAHLDPIRRAALFDETDRLGLQTLFTGTDESLF 352

Query: 356 DSLNETAKFMRISNHQ 371
           D L   A  +R+   Q
Sbjct: 353 DGLAGRALGVRVEGGQ 368


>gi|326402805|ref|YP_004282886.1| DNA replication and repair protein RecF [Acidiphilium multivorum
           AIU301]
 gi|325049666|dbj|BAJ80004.1| DNA replication and repair protein RecF [Acidiphilium multivorum
           AIU301]
          Length = 379

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 186/362 (51%), Gaps = 8/362 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I+ L +++FR+YA L            G NG GKTN+LEA+S L+PGRG R A  A++
Sbjct: 14  LRIESLRLTDFRSYARLDWQPGGMVVALAGPNGAGKTNLLEAVSLLAPGRGLRGARLAEL 73

Query: 65  TR--IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
            R   G+   ++  AR++G EG   I   +E       R L   D        +      
Sbjct: 74  ARRAPGASGGWAVAARIDGPEGRFAIGTGIEAGQGERRRLLL--DGEPAAAARVAARFSC 131

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P MDR+F+  +  RRRFLDR+V A++P H   +  FE     RNRL+  G +D  W
Sbjct: 132 LWLTPQMDRLFTEGASARRRFLDRLVLALEPGHASEVAAFEAASANRNRLIEAGGYDPLW 191

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            ++IE  MA     +  AR+ +I    + ++     + FP  +LSL   +  +       
Sbjct: 192 LATIEDSMARHAAALTAARLHVIE-RLNALLAAGAADPFPAARLSLDCPIGAELAHRPAL 250

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             EE+ +  +   + + ++    + P R+DL +++    +  A  STG+Q+ +LV I LA
Sbjct: 251 AVEEWLRGRYAATRAEPVA---ALSPQRADLGLEHASSGLAAALASTGQQRAMLVAIVLA 307

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA L++ + G AP+LLLDE   HLD   R+AL   +   G+Q+F T T++    +L + A
Sbjct: 308 HAALVAISRGAAPVLLLDEPFVHLDAAHRSALGEALHRGGAQVFCTATERDQLAALGDAA 367

Query: 363 KF 364
            +
Sbjct: 368 IW 369


>gi|148259598|ref|YP_001233725.1| recombination protein F [Acidiphilium cryptum JF-5]
 gi|146401279|gb|ABQ29806.1| SMC domain protein [Acidiphilium cryptum JF-5]
          Length = 379

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 117/362 (32%), Positives = 186/362 (51%), Gaps = 8/362 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I+ L +++FR+YA L            G NG GKTN+LEA+S L+PGRG R A  A++
Sbjct: 14  LRIESLRLTDFRSYARLDWQPGGMVVALAGPNGAGKTNLLEAVSLLAPGRGLRGARLAEL 73

Query: 65  TR--IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
            R   G+   ++  AR++G EG   I   +E       R L   D        +      
Sbjct: 74  ARRAPGASGGWAVAARIDGPEGRFAIGTGIEAGQGERRRLLL--DGEPAAAARVAARFSC 131

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P MDR+F+  +  RRRFLDR+V A++P H   +  FE     RNRL+  G +D  W
Sbjct: 132 LWLTPQMDRLFTEGASARRRFLDRLVLALEPGHASEVAAFEAASANRNRLIEAGGYDPLW 191

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            ++IE  MA     +  AR+ +I    + ++     + FP  +LSL   +  +       
Sbjct: 192 LATIEDSMARHAAALTAARLHVIE-RLNALLAAGAADPFPAARLSLDCPIGAELAHRPAL 250

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             EE+ +  +   + + ++    + P R+DL +++    +  A  STG+Q+ +LV I LA
Sbjct: 251 AVEEWLRGRYAATRAEPVA---ALSPQRADLGLEHASSGLAAALASTGQQRAMLVAIVLA 307

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
           HA L++ + G AP+LLLDE   HLD   R+AL   +   G+Q+F T T++    +L + A
Sbjct: 308 HAALVAISRGAAPVLLLDEPFVHLDAAHRSALGEALHRGGAQVFCTATERDQLAALGDAA 367

Query: 363 KF 364
            +
Sbjct: 368 IW 369


>gi|58038494|ref|YP_190458.1| recombination protein F [Gluconobacter oxydans 621H]
 gi|58000908|gb|AAW59802.1| DNA replication and repair protein RecF [Gluconobacter oxydans
           621H]
          Length = 367

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 188/369 (50%), Gaps = 12/369 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +++FRNY       +A   +  G+NG GKTN+LEA+S L+PGRG R A+   +
Sbjct: 1   MKLTRLALTDFRNYTHTVWTPEASILVLTGENGSGKTNLLEAVSLLAPGRGLRGAALPAL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDD---RSVRCLQINDVVIRVVDELNKHLR 121
            R G+  +        G++       ++ T  D   +  R  +++   IR    + +   
Sbjct: 61  CRQGAERWGVAATLQSGLD-----EFRIGTGSDLSEKQRRTFRLDGENIRSQALIGQRFS 115

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
             WL P MDR+F   S  RRRFLDR+V A+ P H R++   +R +  RNR+L+E   ++ 
Sbjct: 116 CVWLTPQMDRLFQEGSSGRRRFLDRLVMALSPDHGRQIAAHDRSVVTRNRVLSERPNEAE 175

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
           W +SIE  +A   V  + AR+ +I ++++   E    + F    L L   +  +      
Sbjct: 176 WLTSIEDSIARHAVAASAARLALIESMNAHPFE---NDGFSASTLHLDCAISSRLTTQPA 232

Query: 242 ALKEEYAKK-LFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
              E++ +  L   R  D     T +G HR+D ++            S+G+QKV+L G  
Sbjct: 233 LEVEDWIRNSLRQARTEDRQRSTTSVGAHRADFMLSDTATGRPAELSSSGQQKVMLTGTI 292

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           L+HARL++   G+AP +LLDE   HLDE +R+AL   +  + + + +TGTD   F  +  
Sbjct: 293 LSHARLMTQERGYAPAILLDEPLLHLDEMRRHALLDSLEGLRAPVLITGTDAEAFAPIAG 352

Query: 361 TAKFMRISN 369
            A+F  I N
Sbjct: 353 RAQFFSIRN 361


>gi|15603908|ref|NP_220423.1| recombination protein F [Rickettsia prowazekii str. Madrid E]
 gi|7388064|sp|Q9ZEB6|RECF_RICPR RecName: Full=DNA replication and repair protein recF
 gi|3860599|emb|CAA14500.1| RECF PROTEIN (recF) [Rickettsia prowazekii]
 gi|292571623|gb|ADE29538.1| DNA replication and repair protein RecF [Rickettsia prowazekii
           Rp22]
          Length = 360

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 184/358 (51%), Gaps = 6/358 (1%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  +RN+ +L L  D    I  G+NG GKTNILEAIS   PGRG R +   D+ +  S
Sbjct: 9   LTLENYRNFKNLELKTDNTPIILTGENGSGKTNILEAISLFYPGRGLRSSKLTDICKT-S 67

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             +      ++   GLA++S  ++   +R  R  + N   I   +EL+K   + WL P M
Sbjct: 68  EDYCKVKTLLQSKLGLAELSTHIKRSSNR--RITEYNASKI-ANNELSKFTNMVWLTPQM 124

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
           + IF+  S +RR+FLDR+V+  D +H   +  +E  M  RN++L E   D++W   IE +
Sbjct: 125 EGIFTSSSTDRRKFLDRIVYNFDTKHAALLNKYEYYMHERNKILAEDIRDNNWLKIIEEK 184

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAK 249
           MA++   I   R++ I  +   I + ++ E FP   LS+ G ++ K       +      
Sbjct: 185 MADISNNIANNRLKTIRFIQQAIDD-IENE-FPKADLSIDGIIEQKILNVEGDIVNFIIT 242

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
           +L+  R  D +  RT  G H+SD +V +  K I     STGEQK +L+ I LA       
Sbjct: 243 ELYKTRSKDKLLGRTSFGIHKSDFLVKHQKKNILAKFCSTGEQKAILIAIILAEINSTIK 302

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRI 367
            T   PILLLDEI  HLD+ +R  L      +  Q+++T TD    ++    A+ +++
Sbjct: 303 LTKITPILLLDEIFVHLDDKRRQYLMGFFNALNIQLWVTATDLDGIENFANKAQLIKL 360


>gi|6580764|gb|AAF18270.1| DNA/ATP binding protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 318

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 169/316 (53%), Gaps = 18/316 (5%)

Query: 63  DVTRIGSPSFFSTFARVEGMEG---LADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
           D+ R      F+  A++  +E    +  ++I +      S R +++N V     + L++ 
Sbjct: 1   DLVRREGEGGFAISAKLHPLESSGRIDPVTIGIGLAPRASSRQVRVNGVTTSA-NALSEW 59

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-EGYF 178
           L I WL P+MDR++   +  RRRFLDR+   I P H R    +E  MR RN+LL+ E  +
Sbjct: 60  LAILWLTPAMDRLYQEGASSRRRFLDRLTLTIFPSHARHYSRYEAAMRQRNKLLSDEKGY 119

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKEN--FPHIKLSLTGFLDGK- 235
           D  W   +E  MAE    I +AR ++++ LS    E  ++E+  F    L+L   +D + 
Sbjct: 120 DPLWLDGLEQIMAEQATHILLARRQLVDLLSE---EIAKQEDGLFAKADLALEEGVDSRD 176

Query: 236 ----FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
                 +    L +   +K    R  D+   RTL G HR+DL V +  KA+  A  STGE
Sbjct: 177 LVTHNSEEIMPLLQNIWQK---SRTSDAAIGRTLQGVHRADLKVTHHAKAMPAAQSSTGE 233

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           QK +L+G+ LA   LI+   G  P+LLLDE++AHLD  +R  LF I+   G Q++MTGT+
Sbjct: 234 QKALLLGLVLAQVNLITEKNGQPPVLLLDEVAAHLDPSRRAILFDILRSKGGQVWMTGTE 293

Query: 352 KSVFDSLNETAKFMRI 367
            S+F++  E A + ++
Sbjct: 294 PSLFETAGEAACYFQL 309


>gi|329847541|ref|ZP_08262569.1| DNA replication and repair protein recF [Asticcacaulis biprosthecum
           C19]
 gi|328842604|gb|EGF92173.1| DNA replication and repair protein recF [Asticcacaulis biprosthecum
           C19]
          Length = 290

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 153/281 (54%), Gaps = 20/281 (7%)

Query: 97  DRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHR 156
           DR+ R ++I+   +    +L  HLR+ WL P+ DR+F     +R +F DR+V+A +P H 
Sbjct: 22  DRAKRTVRIDQQAVPAA-QLLDHLRMIWLTPAQDRLFIEARNDRLKFFDRLVYAAEPGHA 80

Query: 157 RRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYV 216
             +  +E+ +R R +LLTEG  D +W + +E ++A  G ++  AR   + AL + I  + 
Sbjct: 81  AIVAAYEKALRERLKLLTEGPADETWLTVLEHKLAANGARMTEARQAAMQALQNEIDGH- 139

Query: 217 QKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDG----RKMDSMSRRTLIGPHRSD 272
            +  FP   LSLTG +D            +    L +G    R  D  + R+L GPHR D
Sbjct: 140 -ESAFPKADLSLTGTID----------TADLTTALMNGFRHSRDRDGAAGRSLFGPHRMD 188

Query: 273 LIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRN 332
           L V + DK    A  STGEQK +L+ I LA    +S    F P+LLLDE++AHLD  +R+
Sbjct: 189 LAVVHRDKTRPAADCSTGEQKALLLNIILAQGARLS---AFKPVLLLDEVAAHLDPLRRH 245

Query: 333 ALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQAL 373
           ALF     +G Q F TGTD S+FD L   A  +R+   Q L
Sbjct: 246 ALFDETHALGLQTFFTGTDLSLFDGLLGRALGVRVEAAQIL 286


>gi|88607598|ref|YP_505900.1| recombination protein F [Anaplasma phagocytophilum HZ]
 gi|88598661|gb|ABD44131.1| putative DNA replication and repair protein RecF [Anaplasma
           phagocytophilum HZ]
          Length = 371

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 111/363 (30%), Positives = 178/363 (49%), Gaps = 6/363 (1%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ + +  FRNY+ + L  + +  + +G+NGVGKTNILEA+S LS G G R  S   +  
Sbjct: 9   VQVVKLVNFRNYSKVELESNGKSVVLLGENGVGKTNILEAVSLLSKGPGLRNVSADCMQN 68

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G+   +     + G      + I  +  + RSV      D    +   L+K L I WLV
Sbjct: 69  SGTTIPWLVHYNIVGNGEFFSVDIT-KKNNKRSVTI----DEKASLYSTLHKILCILWLV 123

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P +D I      ER RF DRMV   D  +   M+ +E+  R R ++L E   +  W SS+
Sbjct: 124 PQLDHILLKAPTERLRFFDRMVHIFDKDYSLHMVKYEKAKRDRKKILQESPHNHHWLSSL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           E  M+  GV I   R  ++  L + + E+  +  F    + L   +    D    A+ + 
Sbjct: 184 EEIMSASGVHIAKIRQHVLETLHATLAEHSSRSTFFKFIIRLESKVFELLDNPDKAV-DA 242

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           YA++L   R +D+  + T  G H  +  V    K +  +  STGEQK++L+ + L  A  
Sbjct: 243 YAERLRSNRNIDAARQCTTFGVHNDNFQVFNEKKDLVASSCSTGEQKILLLSLLLTAATA 302

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
                G API+LLD+I +HLD   R  L  I+  +G Q+++T  D+  F+   E  ++  
Sbjct: 303 KHKIDGQAPIMLLDDIMSHLDPQHRKELMSIIEHLGCQVWITDVDEKNFEGFRENFQYFH 362

Query: 367 ISN 369
           ++N
Sbjct: 363 VAN 365


>gi|218683066|ref|ZP_03530667.1| recombination protein F [Rhizobium etli CIAT 894]
          Length = 166

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 79/159 (49%), Positives = 111/159 (69%)

Query: 211 LIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHR 270
           LI E  +   FP   L L+GF+DG+F +    L+++YA  L + R  D+ + RTL GPHR
Sbjct: 3   LIEETHESSPFPSASLQLSGFMDGQFSRPSVDLEDDYAAMLAESRYRDAGAGRTLDGPHR 62

Query: 271 SDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDK 330
           +DLIV + +KA+     STGEQK +LVG+ LAHARL+ N TG APILLLDEI+AHLDE++
Sbjct: 63  ADLIVHHREKAMEAERCSTGEQKALLVGLVLAHARLVGNLTGHAPILLLDEIAAHLDENR 122

Query: 331 RNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
           R ALF ++  +G Q FMTGTD+S+F +L + A+   +++
Sbjct: 123 RAALFDLIDGLGGQAFMTGTDRSMFSALGDRAQVFTVAD 161


>gi|68171576|ref|ZP_00544950.1| recF protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658291|ref|YP_506906.1| recombination protein F [Ehrlichia chaffeensis str. Arkansas]
 gi|67999002|gb|EAM85679.1| recF protein [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599748|gb|ABD45217.1| putative DNA replication and repair protein RecF [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 372

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 110/368 (29%), Positives = 179/368 (48%), Gaps = 10/368 (2%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +  FRNY +L L   ++  + +G NG GKTNILEAIS LS G G R  +   +  
Sbjct: 9   INNLRLVNFRNYINLELDTSSKSVVLLGKNGAGKTNILEAISLLSKGTGIRGVNTESMQN 68

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S S +S   ++    G+  I+I     + R++     N    +    L+K   I WL+
Sbjct: 69  SLSNSPWSVSYQMHTQNGIYPIAIS-RNHNKRAILISNKN----QSYTTLHKITSIIWLI 123

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P +D IF     ER RF DR+    D ++   +I + +  + R++LL     D+ W SS+
Sbjct: 124 PQLDHIFLKSQSERLRFFDRIAHIFDTKYAIHIIKYNKAKQERSKLLYNNSIDNFWLSSL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           E+ +AE G+ I   R  ++  L + + +  +   F    + +   +    DQ      E 
Sbjct: 184 ESIIAENGINIARIRFNVLQTLQNTLSQNSKSHAFFKAIIKIQSQVFNLLDQENSI--EL 241

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           Y + L + R  DS+S     G H  +  + + +K +   + STGEQK++L+ + L+    
Sbjct: 242 YKEHLKNNRSKDSLSNLVNFGVHNDNFQIFHSEKNLIANYCSTGEQKILLLSLILSSVFA 301

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD--KSVFDSLNETAKF 364
             N  G  PILLLD++ +HLD   +  L  I+ DI  Q+++T  D  +  F    E  KF
Sbjct: 302 KQN-IGEYPILLLDDVMSHLDAYHQEKLLEIIRDIKCQVWLTDIDLTQQNFTKHKEYFKF 360

Query: 365 MRISNHQA 372
             ++N+ A
Sbjct: 361 FHVANNTA 368


>gi|73666678|ref|YP_302694.1| recombination protein F [Ehrlichia canis str. Jake]
 gi|72393819|gb|AAZ68096.1| RecF protein [Ehrlichia canis str. Jake]
          Length = 372

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 111/371 (29%), Positives = 181/371 (48%), Gaps = 10/371 (2%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +  FRNY++L L   ++  + +G NG GKTNILEAIS LS G G R  +   +  
Sbjct: 9   INNLRLVNFRNYSNLELDTSSKSVVLLGKNGAGKTNILEAISLLSKGTGIRGVNTESMQN 68

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S S +S   ++    G+  I I   +R+++    +  N     +   L+K + I+WL+
Sbjct: 69  STSDSPWSLSYQIHTQNGIYPIVI---SRNNKQRNIIISNKSQNYIT--LHKIISITWLI 123

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P +D IF     ER RF DR+    D ++   +I + +  + R+RLL     D+ W SS+
Sbjct: 124 PQLDHIFLKSQSERLRFFDRITHIFDTKYASYIIKYNKAKQERSRLLHNNSTDNFWLSSL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           E+ +AE G+ I   R  ++  L S + +      F    + +   +    DQ      E 
Sbjct: 184 ESIIAENGINIARTRFNVMQILQSSLSQNSHSNAFFKAVIKIQSQVFDLLDQEDSI--EL 241

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           Y + L   R  DS+S     G H  +  + + +K +   + STGEQK++L+ + L+    
Sbjct: 242 YKEHLKKNRAKDSLSNLVSFGVHNDNFQIFHLEKTLIANNCSTGEQKILLLSLILSSVIA 301

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD--KSVFDSLNETAKF 364
             N  G  PILLLD++ +HLD   +  L   + +I  Q+++T  D  +  F    E  KF
Sbjct: 302 KQN-IGEYPILLLDDVMSHLDAFHQEKLIETIINIKCQVWLTDIDLTQQNFAKYREYFKF 360

Query: 365 MRISNHQALCI 375
             I N+ A+ +
Sbjct: 361 FHIINNTAILL 371


>gi|222475581|ref|YP_002563998.1| RECF protein (recF) [Anaplasma marginale str. Florida]
 gi|222419719|gb|ACM49742.1| RECF protein (recF) [Anaplasma marginale str. Florida]
          Length = 371

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 179/374 (47%), Gaps = 22/374 (5%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R  I+ + +  FRNY    L       + +G+NG GKTNILEAIS LS G G R  S A 
Sbjct: 6   RSCIQSIKLCNFRNYTRAELESHGHSVVLLGENGSGKTNILEAISLLSKGPGLRNVSAAC 65

Query: 64  VTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           +    S + +S    V  + G A  S+ +   +++  R L I D    +   L+  L I 
Sbjct: 66  MQNRESSAPWSVHHAV--LSGNAQCSVSITKHENK--RRLLI-DEKAGLYSTLHNMLCIV 120

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P +D I      ER RF DR+V   D  +   ++ +E+  R R ++L E   D +W 
Sbjct: 121 WLMPQLDHILLKAPSERLRFFDRVVHIFDKDYSSHIVRYEKAKRDRRKILREAPQDVNWL 180

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKE-NFPHIKLSLTGFLDGKFDQSFCA 242
           +S+E  MA  GV I  AR+ + NAL  L       + N P +K ++        D +   
Sbjct: 181 TSLENVMAASGVCI--ARMRL-NALEILQKTMADNDINSPFLKFNI------HLDSAVFE 231

Query: 243 LKEE-------YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
           L E        Y ++L + R  D   + T  G H     +   DK +  ++ STGEQK++
Sbjct: 232 LLESQEHAVSRYMQQLGNSRMKDMHGQLTSFGIHNDHFQISNADKNLAASNCSTGEQKIL 291

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+ + L  A         API+LLD+I +HLD   +  L + + D+G Q ++T  D   F
Sbjct: 292 LLSLLLTAAVAKRKVHNQAPIMLLDDIMSHLDYTHKQELVQTIKDVGCQTWITDVDDRNF 351

Query: 356 DSLNETAKFMRISN 369
           + L      +RI++
Sbjct: 352 EGLERHFVRLRITD 365


>gi|56417217|ref|YP_154291.1| recombination protein F [Anaplasma marginale str. St. Maries]
 gi|56388449|gb|AAV87036.1| RECF protein [Anaplasma marginale str. St. Maries]
          Length = 371

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 178/374 (47%), Gaps = 22/374 (5%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R  I+ + +  FRNY    L       + +G+NG GKTNILEAIS LS G G R  S A 
Sbjct: 6   RSCIQSIKLCNFRNYTRAELESHGHSVVLLGENGSGKTNILEAISLLSKGPGLRNVSAAC 65

Query: 64  VTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           +    S + +S    V  + G A  S+ +   +++  R L I D    +   L+  L I 
Sbjct: 66  MQNRESSAPWSVHHAV--LSGNAQCSVSITKHENK--RRLLI-DEKAGLYSTLHNMLCIV 120

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P +D I      ER RF DR+V   D  +   ++ +E+  R R ++L E   D +W 
Sbjct: 121 WLMPQLDHILLKAPSERLRFFDRVVHIFDKDYSSHIVRYEKAKRDRRKILREAPQDVNWL 180

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKE-NFPHIKLSLTGFLDGKFDQSFCA 242
           +S+E  MA  GV I  AR+ + NAL  L       + N P +K ++        D +   
Sbjct: 181 TSLENVMAASGVCI--ARMRL-NALEILQKTMADNDINSPFLKFNI------HLDSAVFE 231

Query: 243 LKEE-------YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
           L E        Y ++L + R  D   + T  G H     +   DK +  +  STGEQK++
Sbjct: 232 LLESQEHAVSRYMQQLGNSRMKDMHGQLTSFGIHNDHFQISNADKNLAASDCSTGEQKIL 291

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+ + L  A         API+LLD+I +HLD   +  L + + D+G Q ++T  D   F
Sbjct: 292 LLSLLLTAAVAKRKVHNQAPIMLLDDIMSHLDYTHKQELVQTIKDVGCQTWITDVDDRNF 351

Query: 356 DSLNETAKFMRISN 369
           + L      +RI++
Sbjct: 352 EGLERHFVRLRITD 365


>gi|255003571|ref|ZP_05278535.1| recombination protein F [Anaplasma marginale str. Puerto Rico]
 gi|255004698|ref|ZP_05279499.1| recombination protein F [Anaplasma marginale str. Virginia]
          Length = 371

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 177/374 (47%), Gaps = 22/374 (5%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R  I+ + +  FRNY    L       + +G NG GKTNILEAIS LS G G R  S A 
Sbjct: 6   RSCIQSIKLCNFRNYTRAELESHGHSVVLLGANGSGKTNILEAISLLSKGPGLRNVSAAC 65

Query: 64  VTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           +    S + +S    V  + G A  S+ +   +++  R L I D    +   L+  L I 
Sbjct: 66  MQNRESSAPWSVHHAV--LSGNAQCSVSITKHENK--RRLLI-DEKAGLYSTLHNMLCIV 120

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           WL+P +D I      ER RF DR+V   D  +   ++ +E+  R R ++L E   D +W 
Sbjct: 121 WLMPQLDHILLKAPSERLRFFDRVVHIFDKDYSSHIVRYEKAKRDRRKILREAPQDVNWL 180

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKE-NFPHIKLSLTGFLDGKFDQSFCA 242
           +S+E  MA  GV I  AR+ + NAL  L       + N P +K ++        D +   
Sbjct: 181 TSLENVMAASGVCI--ARMRL-NALEILQKTMADNDINSPFLKFNI------HLDSAVFE 231

Query: 243 LKEE-------YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
           L E        Y ++L + R  D   + T  G H     +   DK +  +  STGEQK++
Sbjct: 232 LLESQEHAVSRYMQQLGNSRMKDMHGQLTSFGIHNDHFQISNADKNLAASDCSTGEQKIL 291

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+ + L  A         API+LLD+I +HLD   +  L + + D+G Q ++T  D   F
Sbjct: 292 LLSLLLTAAVAKRKVHNQAPIMLLDDIMSHLDYTHKQELVQTIKDVGCQTWITDVDDRNF 351

Query: 356 DSLNETAKFMRISN 369
           + L      +RI++
Sbjct: 352 EGLERHFVRLRITD 365


>gi|58616769|ref|YP_195968.1| recombination protein F [Ehrlichia ruminantium str. Gardel]
 gi|58416381|emb|CAI27494.1| DNA replication and repair protein recF [Ehrlichia ruminantium str.
           Gardel]
          Length = 372

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 114/371 (30%), Positives = 179/371 (48%), Gaps = 19/371 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L +  FRNY ++ L   ++  + +G NG GKTNILEAIS LS G G R  S   +  
Sbjct: 9   IQNLRLINFRNYLNIELDTSSKSVVLLGKNGAGKTNILEAISLLSKGTGIRGVSMESMQN 68

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S   +S    +     +  I I  +  + RS+     N   I     L+K + + WL+
Sbjct: 69  SSSDLPWSVSYHIHNQNSIYPIVIA-KGNNKRSILISNKNHNYIT----LHKIISVVWLI 123

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P +D IF     ER +F DR+V   D  +   +I + +  + RN+LL     D+ W SS+
Sbjct: 124 PQLDHIFLKSQSERLKFFDRVVHIFDTNYTSYIIKYNKAKQDRNKLLRSNSVDNFWLSSL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENF----PHIKLSLTGFLDGKFDQSFCA 242
           E+ MAE G+KI   R+ ++  L +++ +     +F      IK  +   LD   + S   
Sbjct: 184 ESIMAENGIKIAQIRLNVVQILQNVLSKNNLSNSFFKAVIEIKSQVFPLLDN--ENSI-- 239

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             E Y + L   R  DS +     G H  ++ + + +K +     STGEQK++L+ + L+
Sbjct: 240 --ENYKENLQKSRARDSSTNLVNFGVHNDNVQIFHLEKNLIANCCSTGEQKILLLSLVLS 297

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD--KSVFDSLNE 360
            + L    TG  PILLLD+I +HLD   +  L   +  I  Q+++T  D  +  F    E
Sbjct: 298 -SVLAKQDTGEYPILLLDDIMSHLDVYHQEKLLETIVSIKCQVWITDIDLKQQNFTKYKE 356

Query: 361 TAKFMRIS-NH 370
             KF  +  NH
Sbjct: 357 HFKFFHVGDNH 367


>gi|218458186|ref|ZP_03498277.1| recombination protein F [Rhizobium etli Kim 5]
          Length = 152

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 94/146 (64%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYA++ L  D +H +  G+NG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVCLSRLKLTDFRNYAAVSLALDGRHAVLTGNNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +ET ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGTAGGFSIFAALDGMEGEVEIGTGVETGEETTTRRLRINGTAAKTADELTDHL 120

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDR 146
           R+ WL P   R      +   RFLDR
Sbjct: 121 RLLWLTPGDGRALYRRLVRPPRFLDR 146


>gi|148284348|ref|YP_001248438.1| recombination protein F [Orientia tsutsugamushi str. Boryong]
 gi|146739787|emb|CAM79662.1| DNA replication and repair protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 383

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 103/361 (28%), Positives = 168/361 (46%), Gaps = 14/361 (3%)

Query: 2   TNRI-KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           TN I +I  L +  +RN   L +       + +G NG GKTN+LE+IS  +PGRG R A 
Sbjct: 9   TNSICRITKLVLHNYRNLTELTVSPKCDKILIIGKNGSGKTNLLESISLFAPGRGLRGAK 68

Query: 61  YADVTRIGS----------PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVI 110
           Y+D+ R  +           ++    A +     +  + I      + + R +++ND  I
Sbjct: 69  YSDILRKEANSSSSSSNCHNTYSQWIAEITLQTAINIVKISTNYYQNTTKRNIKLNDNTI 128

Query: 111 RVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN 170
               +L + + +  + P M+ +F   + +RR+ LDR+V+  D +H  R+  +E  +R R 
Sbjct: 129 -TSHKLLELVNMICITPQMESVFLNGATQRRKLLDRIVYLFDYKHAERVNKYEYYLRERM 187

Query: 171 RLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG 230
            LL      + W + IE  +A + V+I   R   I  L   + E      FP +KL +  
Sbjct: 188 ILLRSNSSQTRWINVIENCLASISVEIASCRYNAIKQLQLYLDEI--DAPFPKVKLDIQC 245

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
            +     Q    L E    +  + R +D  S ++  G HRSD  V +  K       STG
Sbjct: 246 QIAELCLQQSPKLLELINSRFCNSRTIDGNSGKSNFGVHRSDFKVIHSVKNQLAQFCSTG 305

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           EQK +L+ + +A            PILLLDE+  HLD +KR  L + +T    Q +++ T
Sbjct: 306 EQKALLISLLIAQMLQSRKNYNRFPILLLDELFIHLDIEKRQYLAKFLTQFPVQCWISST 365

Query: 351 D 351
           +
Sbjct: 366 E 366


>gi|291165886|gb|EFE27933.1| DNA replication and repair protein RecF [Filifactor alocis ATCC
           35896]
          Length = 355

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 182/353 (51%), Gaps = 23/353 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI  L +  FRNY  L L+F     +FVG NG GKTN+LEAIS  S GR FR     D+
Sbjct: 1   MKIHQLTLKNFRNYEQLELLFKEGANVFVGQNGQGKTNVLEAISLFSVGRSFRTVRDLDM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
              G  +  +  A VE + G   I +KL     ++V+   IN V I  + +L   L I  
Sbjct: 61  VAFGQDA-ATVSAIVENLHGRYTIDMKLGKSIKKAVK---INSVPIEKLQDLFGVLNIVV 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P   ++      ERR FLDR +  + PR+ R + ++ +++  RN LL +   D     
Sbjct: 117 FSPDDLKLVKDGPKERRLFLDREISQLKPRYYRILSEYYKVLNQRNTLLKQE-VDEVLLE 175

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG-FLDGKFDQSFCAL 243
               Q+A+ G +I+  R E I      I E+ Q+    H K+S     L+ +++ +  A+
Sbjct: 176 IYTQQIAKSGFQIHKMREEFIEH----IREFAQE---IHSKISSKKEVLEIEYEPNVYAI 228

Query: 244 -KEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAH-GSTGEQKVVLVGI 299
            +EEY + L DG++ D + + +  G H+ D  L+++  D    I H GS G+++   + +
Sbjct: 229 SEEEYFRYLMDGKEHDFIRKHSTRGIHKDDVALVINEMD----IRHFGSQGQKRSAAISL 284

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            L+  ++I   TG  PI+LLD+I + LD  ++  L   VT+  +Q+F+T  +K
Sbjct: 285 KLSEIQMIYQDTGEYPIVLLDDIFSELDYSRQRMLLDYVTN--TQVFVTTAEK 335


>gi|189183858|ref|YP_001937643.1| recombination protein F [Orientia tsutsugamushi str. Ikeda]
 gi|189180629|dbj|BAG40409.1| RecF protein [Orientia tsutsugamushi str. Ikeda]
          Length = 378

 Score =  143 bits (361), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 103/361 (28%), Positives = 171/361 (47%), Gaps = 14/361 (3%)

Query: 2   TNRI-KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           TN I +I  L +  +RN   L +       + +G NG GKTN+LE+IS  +PGRG R A 
Sbjct: 4   TNSICRITKLVLHNYRNLTELIVSPQCDKILIIGKNGSGKTNLLESISLFAPGRGLRGAK 63

Query: 61  YADVTR----IGSPS------FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVI 110
           Y+D+ R    + S S      +    A +     +  + I      + + R +++ND  I
Sbjct: 64  YSDILRKEANLSSNSSNCHNAYSQWIAEITLQTAINIVKISTNYYQNTTKRNIKLNDNTI 123

Query: 111 RVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN 170
               +L + + +  + P M+ +F   + +RR+ LDR+V+  D +H  R+  +E  +R R 
Sbjct: 124 -TSHKLLELVNMICITPQMESVFLNGATQRRKLLDRIVYLFDYKHAERVNKYEYYLRERM 182

Query: 171 RLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG 230
            LL      + W + IE  +A + ++I   R   I  L  L ++ +    FP +KL +  
Sbjct: 183 ILLRSNSSQTRWINVIENCLASISLEIASCRYNAIKQL-QLYLDEIDAP-FPKVKLDIQC 240

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
            +   + Q    L E    +  + R +D  S ++  G HRSD  V +  K       STG
Sbjct: 241 QIAELYLQQSPKLLELINSRFCNSRTIDCNSGKSNFGVHRSDFKVIHSVKNQLAQFCSTG 300

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           EQK +L+ + +A            PILLLDE+  HLD +KR  L + +     Q +++ T
Sbjct: 301 EQKALLISLLIAQMLQSRKNYNRFPILLLDELFIHLDIEKRQYLAKFLAQFPVQCWISST 360

Query: 351 D 351
           +
Sbjct: 361 E 361


>gi|57238782|ref|YP_179918.1| recombination protein F [Ehrlichia ruminantium str. Welgevonden]
 gi|58578707|ref|YP_196919.1| recombination protein F [Ehrlichia ruminantium str. Welgevonden]
 gi|57160861|emb|CAH57763.1| putative DNA replication and repair protein RecF [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417333|emb|CAI26537.1| DNA replication and repair protein recF [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 372

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 110/367 (29%), Positives = 177/367 (48%), Gaps = 18/367 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L +  FRNY ++ L    +  + +G NG GKTNILEAIS LS G G R  +   +  
Sbjct: 9   IQNLRLINFRNYLNIELDTSGKSVVLLGKNGAGKTNILEAISLLSKGTGIRGVNMESMQN 68

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S   +S    +     +  I I  +  + RS+     +   I     L+K + + WL+
Sbjct: 69  SSSDLPWSISYHIHNQNSIYPIVIA-KGNNKRSILISNKSHNYIT----LHKIISVVWLI 123

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P +D IF     ER +F DR+V   D  +   +I + +  + RN+LL     D+ W SS+
Sbjct: 124 PQLDHIFLKSQSERLKFFDRVVHIFDTNYTSYIIKYNKAKQDRNKLLRSNSVDNFWLSSL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENF----PHIKLSLTGFLDGKFDQSFCA 242
           E+ MAE G+KI   R+ ++  L +++ +     +F      IK  +   LD   + S   
Sbjct: 184 ESIMAENGIKIAQIRLNVVQILQNVLSKNNLSNSFFKAVIEIKSQVFPLLDN--ENSI-- 239

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             E Y + L   R  DS +     G H  ++ + + +K +  +  STGEQK++L+ + L+
Sbjct: 240 --ENYKENLQKSRARDSSTNLVNFGVHNDNVQIFHLEKNLIASCCSTGEQKILLLSLVLS 297

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD--KSVFDSLNE 360
            + L    TG  PILLLD+I +HLD   +  L   +  I  Q+++T  D  +  F    E
Sbjct: 298 -SVLAKQDTGEYPILLLDDIMSHLDVYHQEKLLETIVSIKCQVWITDIDLKQQNFTKYKE 356

Query: 361 TAKFMRI 367
             KF  +
Sbjct: 357 HFKFFHV 363


>gi|58696694|ref|ZP_00372244.1| recF protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698389|ref|ZP_00373302.1| recF protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630989|ref|YP_002727780.1| recombination protein F [Wolbachia sp. wRi]
 gi|58535102|gb|EAL59188.1| recF protein [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58537136|gb|EAL60246.1| recF protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592970|gb|ACN95989.1| recombination protein F [Wolbachia sp. wRi]
          Length = 365

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 111/371 (29%), Positives = 177/371 (47%), Gaps = 15/371 (4%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M     IK L +  FR++++  L  D    +  G NG+GKTNILEAIS L+   G ++A 
Sbjct: 1   MATHCYIKKLKLHNFRSHSNFELDSDDSSVVITGKNGIGKTNILEAISLLAKSNGMKKAK 60

Query: 61  YADV-TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
            +++  R  +  +   +    GM+     SI +    D+  + +QI+         L K 
Sbjct: 61  ASEIQNRFSNEDWVVHYDFFNGMDF---NSIGIAKSFDK--KLIQIDGKTQSSYSSLYKI 115

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
             + WL+P MD +      +R +FLDR+V   +  +    +   +  R R++LL E   D
Sbjct: 116 SNVIWLIPQMDYVLLNSPSDRLKFLDRIVSLFEENYTCCYMKHRKAKRERSKLLRENTLD 175

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
            +W SS+E  MA   V I   R  ++  L   I  +   E FP   L  +  L      +
Sbjct: 176 KNWLSSLENIMAVNAVSILRMRSSVLKTLQDTIDNH-SGELFPKASLKFSSQL------T 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDK-AITIAHGSTGEQKVVLVG 298
                E +  +L + R+ DS++ R   G H  +  V +C K  + I   STGEQK++L+ 
Sbjct: 229 LDDTAEYFQNRLKENREKDSLTGRVTFGVHNDNFRV-FCQKRNVPINLCSTGEQKLLLLS 287

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           I L+  +        AP+LLLD+I +HLD+  R AL   V  I  Q ++T  ++  F+S 
Sbjct: 288 IILSSVKARCIHYNKAPLLLLDDIMSHLDKHYRKALIEEVLSIQCQTWITDVNQDNFNSY 347

Query: 359 NETAKFMRISN 369
             + KF  +SN
Sbjct: 348 LYSFKFFELSN 358


>gi|254995385|ref|ZP_05277575.1| recombination protein F [Anaplasma marginale str. Mississippi]
          Length = 339

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 168/347 (48%), Gaps = 22/347 (6%)

Query: 31  IFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFSTFARVEGMEGLADISI 90
           + +G+NG GKTNILEAIS LS G G R  S A +    S + +S    V  + G A  S+
Sbjct: 1   MLLGENGSGKTNILEAISLLSKGPGLRNVSAACMQNRESSAPWSVHHAV--LSGNAQCSV 58

Query: 91  KLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFA 150
            +   +++  R L I D    +   L+  L I WL+P +D I      ER RF DR+V  
Sbjct: 59  SITKHENK--RRLLI-DEKAGLYSTLHNMLCIVWLMPQLDHILLKAPSERLRFFDRVVHI 115

Query: 151 IDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSS 210
            D  +   ++ +E+  R R ++L E   D +W +S+E  MA  GV   IAR+ + NAL  
Sbjct: 116 FDKDYSSHIVRYEKAKRDRRKILREAPQDVNWLTSLENVMAASGV--CIARMRL-NALEI 172

Query: 211 LIMEYVQKE-NFPHIKLSLTGFLDGKFDQSFCALKEE-------YAKKLFDGRKMDSMSR 262
           L       + N P +K ++        D +   L E        Y ++L + R  D   +
Sbjct: 173 LQKTMADNDINSPFLKFNI------HLDSAVFELLESQEHAVSRYMQQLGNSRMKDMHGQ 226

Query: 263 RTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEI 322
            T  G H     +   DK +  +  STGEQK++L+ + L  A         API+LLD+I
Sbjct: 227 LTSFGIHNDHFQISNADKNLAASDCSTGEQKILLLSLLLTAAVAKRKVHNQAPIMLLDDI 286

Query: 323 SAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISN 369
            +HLD   +  L + + D+G Q ++T  D   F+ L      +RI++
Sbjct: 287 MSHLDYTHKQELVQTIKDVGCQTWITDVDDRNFEGLERHFVRLRITD 333


>gi|42521081|ref|NP_966996.1| recombination protein F [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410822|gb|AAS14930.1| recF protein [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 365

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 111/371 (29%), Positives = 176/371 (47%), Gaps = 15/371 (4%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M     IK L +  FR++++  L  D    +  G NG+GKTNILEAIS L+   G ++A 
Sbjct: 1   MATHCYIKKLKLHNFRSHSNFELDSDDSSVVITGKNGIGKTNILEAISLLAKSNGMKKAK 60

Query: 61  YADV-TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
            +++  R  +  +   +    GM+     SI +    D+  + +QI+         L K 
Sbjct: 61  ASEIQNRFSNEDWVVHYDFFNGMDF---NSIGIAKSFDK--KLIQIDGKTQSSYSSLYKI 115

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
             + WL+P MD +      +R +FLDR+V   +  +    +   +  R R++LL E   D
Sbjct: 116 SNVIWLIPQMDYVLLNSPSDRLKFLDRIVSLFEENYTCCYMKHRKAKRERSKLLRENTLD 175

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
            +W SS+E  MA   V I   R  ++  L   I  +   E FP   L  +  L      +
Sbjct: 176 ENWLSSLENIMAVNAVSILRMRSSVLKTLQDTIDNH-SSEFFPKASLKFSSQL------T 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDK-AITIAHGSTGEQKVVLVG 298
                E +   L + R+ DS++ R   G H  +  V +C K  + I   STGEQK++L+ 
Sbjct: 229 LDDTAEYFQNLLKENREKDSLTGRVTFGVHNDNFRV-FCQKRNVPINLCSTGEQKLLLLS 287

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           I L+  +        AP+LLLD+I +HLD+  R AL   V  I  Q ++T  ++  F+S 
Sbjct: 288 IILSSVKARCIHYNKAPLLLLDDIMSHLDKHYRKALMEEVLSIQCQTWITDVNQDNFNSY 347

Query: 359 NETAKFMRISN 369
             + KF  +SN
Sbjct: 348 LYSFKFFELSN 358


>gi|269958391|ref|YP_003328178.1| recombination protein F [Anaplasma centrale str. Israel]
 gi|269848220|gb|ACZ48864.1| recombination protein F [Anaplasma centrale str. Israel]
          Length = 371

 Score =  136 bits (343), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 114/363 (31%), Positives = 175/363 (48%), Gaps = 14/363 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  FRNY    L       + +G NG GKTNILEAIS LS G G R  S   +  
Sbjct: 9   IQSIKLCNFRNYTRAELETHGCSVVLLGKNGSGKTNILEAISLLSKGPGLRNVSADCMQN 68

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S + +     V  + G    S+ +   +++  R L I++    +   L+  L I WL+
Sbjct: 69  HESGTPWRVHHTV--LSGSTQFSVSVTKHENK--RRLFIDEKA-GLYSTLHNMLCIVWLM 123

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P +D +      ER RF DR+V   D  +   ++ +ER  R R ++L E   D +W +S+
Sbjct: 124 PQLDHVLLKAPSERLRFFDRVVHVFDKDYASHIVRYERARRDRRKVLREAPQDLNWLASL 183

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD-GKFD--QSFCAL 243
           E  MA  GV I   R   +NAL  ++ + +   N     L  T  LD G F+  +S    
Sbjct: 184 ENVMAISGVYIAQTR---LNALR-ILQQTMADNNIDSPFLKFTIHLDSGVFELLESQEHA 239

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
             +Y ++L   R  D   + T  G H     + + DK +T +  STGEQK++L+ + L  
Sbjct: 240 VSQYMQRLKQSRAQDMHGQLTSFGVHNDHFQISHADKNLTASSCSTGEQKILLLSLLLTA 299

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
           A         API+LLD+I +HLD   R  L + +  +G Q ++T  D+  F+ L +   
Sbjct: 300 AITKHRVHSQAPIMLLDDIMSHLDYTHRQELVQTIKSVGCQTWITDVDERNFEGLEQC-- 357

Query: 364 FMR 366
           FMR
Sbjct: 358 FMR 360


>gi|254796587|ref|YP_003081423.1| putative DNA replication and repair protein RecF [Neorickettsia
           risticii str. Illinois]
 gi|254589828|gb|ACT69190.1| putative DNA replication and repair protein RecF [Neorickettsia
           risticii str. Illinois]
          Length = 349

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 158/346 (45%), Gaps = 20/346 (5%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           + +FRN+A     F+ +H +  G NG GKT+ILEAIS LSPG G R AS  ++ R GS S
Sbjct: 10  LKDFRNHAFWTASFECRHVLLCGKNGAGKTSILEAISKLSPGLGLRSASNTEMIRSGSLS 69

Query: 72  FFSTFARVEGMEGLADI-SIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMD 130
           +  +        G AD+  + +   +D+  R  QIN   ++   ++   +++ WL P M 
Sbjct: 70  WEVSLK----FAGSADLRGVGMSYCEDK--RITQINGKSVQCFKKVIDLVKVMWLTPQMS 123

Query: 131 RIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQM 190
            +F+     RRRF DRMV   +P+H   ++ +ER    R ++L  G     W    E ++
Sbjct: 124 NLFTTDKSVRRRFFDRMVALSEPQHLENLVMYERFKSERLKILNAGA-SKMWLDVNEKKL 182

Query: 191 AELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-SFCALKEEYAK 249
           AEL + I  ARV  I  L    M       F  +++ L   +    D+       +    
Sbjct: 183 AELCIAITDARVSFIRQL----MSNFPSRGFGSLEIKLLCPVASAIDKVGSSQQMQSIQS 238

Query: 250 KLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISN 309
            L   R +D+++ +   G HR+D +        T    STGEQK++++GI LA   LI  
Sbjct: 239 ALERSRAVDTVTGKMQFGVHRTDFLATVRQGDNTARCYSTGEQKLLILGIMLAAGELIDI 298

Query: 310 TTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
                         AHLD    +A     T    Q F +  D S F
Sbjct: 299 ILLDDIF-------AHLDPQNSSAFLLEATKKNCQFFFSDLDNSKF 337


>gi|190571298|ref|YP_001975656.1| recF protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213018695|ref|ZP_03334503.1| recF protein [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|190357570|emb|CAQ55009.1| recF protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995646|gb|EEB56286.1| recF protein [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 359

 Score =  135 bits (341), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 109/370 (29%), Positives = 176/370 (47%), Gaps = 15/370 (4%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           MT    IK L +  FR++++  L  D +  +  G NG+GKTNILEAIS L+   G ++A 
Sbjct: 1   MTTHCYIKKLKLYNFRSHSNFELDLDDRPVVVTGKNGIGKTNILEAISLLAKSNGMKKAK 60

Query: 61  YADV-TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
             ++  R  + S+   +    G E L  I I      + + + +QI+         L + 
Sbjct: 61  INEMQNRRSNESWVVYYDFFNGAE-LNSIGIG----KNLNKKLIQIDGKTQSSYSSLYRI 115

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
             + WL+P MD I      +R +FLDR+V   +  +    + + +    R++LL E   D
Sbjct: 116 SNVIWLIPQMDYILLNSPSDRLKFLDRIVSLFEENYTYCYMKYRKAKHERSKLLRENILD 175

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
            SW SS+E  MA   + I   R  ++  L   I  +   E FP   L  +  L      +
Sbjct: 176 ESWLSSLENVMATNAIDILRMRSSVLKILQDTIDNH-SCEFFPKASLKFSSQL------T 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKA-ITIAHGSTGEQKVVLVG 298
                E +  +L + R+ DS++ R     H  +  V +C K  + I   STGEQK++L+ 
Sbjct: 229 LNDTAEYFQNRLKENREKDSLTGRVTFSVHNDNFWV-FCQKGDMPINLCSTGEQKLLLLS 287

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           I L+  +        AP+LLLD+I +HLD+D R  L   V  I  Q ++T  ++  F++ 
Sbjct: 288 IILSSVKARCIHYNKAPLLLLDDIMSHLDKDYRKVLMEEVLSIQCQTWITDVNQDNFNNY 347

Query: 359 NETAKFMRIS 368
             + KF  +S
Sbjct: 348 LCSFKFFELS 357


>gi|225677102|ref|ZP_03788104.1| recombination protein F [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590861|gb|EEH12086.1| recombination protein F [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 365

 Score =  135 bits (341), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 108/371 (29%), Positives = 177/371 (47%), Gaps = 15/371 (4%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M     IK L +  FR++++  L  D    +  G NG+GKTNILEAIS L+   G ++A 
Sbjct: 1   MATHCYIKKLKLHNFRSHSNFELDSDDSSVVITGKNGIGKTNILEAISLLAKSNGMKKAK 60

Query: 61  YADV-TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH 119
            +++  R  +  +   +    GM+     SI +    D+  + +QI+         L K 
Sbjct: 61  ASEIQNRFSNEDWIVHYDFFNGMDF---NSIGIAKSFDK--KLIQIDGKTQSSYSSLYKI 115

Query: 120 LRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD 179
             + WL+P MD +      +R +FLDR+V   +  +    + + +    R++LL +   +
Sbjct: 116 SNVIWLIPQMDYVLLNSPSDRLKFLDRIVSLFEENYTCCYMKYRKAKHERSKLLRKNILN 175

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
            +W SS+E  MA   V I   R  ++  L   I  +   E FP   L  +  L      +
Sbjct: 176 KNWLSSLENIMAVNAVSILRMRSSVLKTLQDTIDNH-SSELFPKASLKFSSQL------T 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDK-AITIAHGSTGEQKVVLVG 298
                E +  +L + R+ DS++ R   G H  +  V +C K  + I   STGEQK++L+ 
Sbjct: 229 LNDTAEYFQNRLKENREKDSLTGRVTFGVHNDNFRV-FCQKRNVPINLCSTGEQKLLLLS 287

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           I L+  +        AP+LLLD+I +HLD+  R AL   V  I  Q ++T  ++  F+S 
Sbjct: 288 IILSSVKARCIHYNKAPLLLLDDIMSHLDKHYRKALMEEVLSIQCQTWITDVNQDNFNSY 347

Query: 359 NETAKFMRISN 369
             + KF  +SN
Sbjct: 348 LYSFKFFELSN 358


>gi|218682258|ref|ZP_03529859.1| recombination protein F [Rhizobium etli CIAT 894]
          Length = 123

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 83/122 (68%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M +++ +  L +++FRNYAS  L  D +H +  GDNG GKTN++EA+S LSPGRG RRA+
Sbjct: 1   MPHKVSLSRLKLTDFRNYASAALTLDGRHAVLTGDNGAGKTNLMEAVSLLSPGRGLRRAA 60

Query: 61  YADVTRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
           Y D+TR+G+   FS FA ++GMEG  +I   +ET ++ + R L+IN    +  DEL  HL
Sbjct: 61  YGDITRVGAAGGFSIFAALDGMEGDVEIGTGIETGEESTARRLRINGTPAKTADELTDHL 120

Query: 121 RI 122
           R+
Sbjct: 121 RL 122


>gi|296531698|ref|ZP_06894532.1| recombination protein F [Roseomonas cervicalis ATCC 49957]
 gi|296267973|gb|EFH13766.1| recombination protein F [Roseomonas cervicalis ATCC 49957]
          Length = 259

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 119/226 (52%), Gaps = 5/226 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L + +FR+YA L L F A   +  G NGVGKTN+LEAIS L+PGRG R A   ++
Sbjct: 7   LRLTRLMLQDFRSYAQLDLRFQAGVVVIAGRNGVGKTNLLEAISLLTPGRGLRNARAGEL 66

Query: 65  TR-IGSPSFFSTFA-RVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
            R  G  S   T A   +G  G   I    +   DR  R  +++   +R   EL+  +  
Sbjct: 67  GRREGEESRPWTIAGHFDGPAGPMTIGTGQDPASDR--RGFRLDGAPLRSQAELSAQIAA 124

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            WL P MDR+F   +  RR+FLDR+V+A +P H R +  +E  M  RNRLL EG  D+ W
Sbjct: 125 LWLTPQMDRLFQEGASGRRKFLDRLVWAREPSHARDVAAYESAMSQRNRLLAEGRRDARW 184

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSL 228
            +++E  MA   V    +R      L++ +   +    FP  +L L
Sbjct: 185 LAALEDTMARHAVAAIASRRTSCAQLNATLRAGIAGA-FPAARLEL 229


>gi|154503046|ref|ZP_02040106.1| hypothetical protein RUMGNA_00868 [Ruminococcus gnavus ATCC 29149]
 gi|153796287|gb|EDN78707.1| hypothetical protein RUMGNA_00868 [Ruminococcus gnavus ATCC 29149]
          Length = 361

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 165/355 (46%), Gaps = 24/355 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L + FD++  I  GDN +GKTNILEA+      +  R     D+ +
Sbjct: 3   IKSLKLKNYRNYELLDMTFDSKTNILYGDNALGKTNILEALYLSGTTKSHRGTKDRDLIQ 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   S   T    +GME   D+ +K       S + + IN + IR   EL   +   + 
Sbjct: 63  FGREESHLETIVEKKGMEFQIDMHLK-----KNSPKGIAINKIPIRKASELFGIVHFVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I       RRRF+D  +  ID  +   + ++ R++  RN LL E Y       +
Sbjct: 118 SPEDLNIIKDGPAGRRRFIDLELSQIDKVYLSNLSNYNRIINQRNSLLKELYHQDHLMDT 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGF---LDGKFDQS 239
           +   + Q+AE G K+  +R + I  ++ +I +         I   LTG    ++  ++ S
Sbjct: 178 LDIWDMQLAEYGTKVIESRKQFIRQVNQIIAD---------IHYRLTGGRERIELSYESS 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
             +L  E A K    R+ D   + T +GPHR DL     D  I    GS G+Q+   + +
Sbjct: 229 LGSLSLEQALK--KNRERDIRMKSTSVGPHRDDLCFLSGDLDIR-KFGSQGQQRTAALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            L+   L+       PILLLD++ + LD+ ++N L   + DI + I  TG D+ V
Sbjct: 286 KLSEIELVKEVIKDTPILLLDDVLSELDKHRQNYLLDSIHDIQTVITCTGLDEFV 340


>gi|154483926|ref|ZP_02026374.1| hypothetical protein EUBVEN_01632 [Eubacterium ventriosum ATCC
           27560]
 gi|149735417|gb|EDM51303.1| hypothetical protein EUBVEN_01632 [Eubacterium ventriosum ATCC
           27560]
          Length = 362

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 171/350 (48%), Gaps = 24/350 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRI-G 68
           + +S FRNY SL L  D +  I  G N  GKTN+LEAI   S  +  R +  A++ +   
Sbjct: 6   IELSNFRNYDSLSLELDDKTNILYGKNAQGKTNVLEAIYLCSTTKSHRSSKDAELIKFEN 65

Query: 69  SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
           +      F   +G E   DI +    R ++S + + IN + I+   EL     + +  P 
Sbjct: 66  NEGHIKLFINKKGREYRIDIHL----RKNKS-KGIAINGIPIKKASELFGIFNVIFFSPE 120

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
              I      ERRRF+D  +  +D  +   +I++ +++  RN+LL + Y       +++ 
Sbjct: 121 DLDIIKNGPAERRRFVDMELCQLDKIYVYNLINYNKVLGQRNQLLKDIYMKPELEDTLDV 180

Query: 189 ---QMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCAL 243
              Q+AE G K+   R + I  ++ +I    +K  EN   I++           +  C  
Sbjct: 181 WDMQLAEYGSKVIKRREQFIKDINKIIKPIHRKLTENSEEIEVVY---------KKSCNE 231

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGIFLA 302
            E Y  K+ + RK D   + T  GPHR D++  + +K I I  +GS G+++ V + + LA
Sbjct: 232 DELY-NKIIENRKKDIKLKSTSAGPHRDDIL--FFNKDINIRTYGSQGQKRTVALSLKLA 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
              L+ +     P+LLLD++ + LD D++N L + + +I + I  TG D+
Sbjct: 289 EIELVKSLINDTPVLLLDDVLSELDSDRQNHLLKSLDEIQTVITCTGLDE 338


>gi|307243415|ref|ZP_07525572.1| putative recombination protein F [Peptostreptococcus stomatis DSM
           17678]
 gi|306493225|gb|EFM65221.1| putative recombination protein F [Peptostreptococcus stomatis DSM
           17678]
          Length = 371

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 179/360 (49%), Gaps = 23/360 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +  +RNY  L + F+ +  + +G NG GKTN++EAI F+S GR FR     ++ +
Sbjct: 3   INSLKLVNYRNYDDLLVEFNKKVNLIIGMNGQGKTNLVEAIGFMSIGRSFRTNKDRELIK 62

Query: 67  IGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             + + +    F R        ++  K+E    +  + +++N V I+ + EL  +L +  
Sbjct: 63  FSAENLYCGCNFTR-------NNMDKKIEIVVAKDKKGVKVNGVSIKSMQELLGNLNVVI 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P   R+      ERR F+D+ +  I PR+   + ++ +++  RN +L     D +   
Sbjct: 116 FSPEDLRLVKDGPKERRSFIDKEISQIMPRYYSLLTNYNKILHQRNTVLKSYRIDENLLD 175

Query: 185 SIEAQMAELGVKINIAR---VEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQS 239
             +  M+    +I + R   +E I+ +SS I +   + KEN   I  +      G+ D S
Sbjct: 176 VYDETMSTYASEIYLIRNKFIEKISKISSEIHKNLTMDKENLTIIYKNQVDLESGQ-DAS 234

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              LK    +KL + R  D ++R T +GPH+ D+ +   D  + + +GS G+Q+   + +
Sbjct: 235 QVRLK--LLEKLRESRGGDMITRTTKVGPHKDDMKIFINDIDVRM-YGSQGQQRTASISL 291

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KSVFD 356
            L+   LI    G  P+L+LD++ + LD+ ++  L   + DI  Q+F+T  D   K++ D
Sbjct: 292 KLSEIELIKQEVGDYPVLILDDVFSELDQTRQKMLVEKLEDI--QMFVTSADPLHKNILD 349


>gi|331092115|ref|ZP_08340946.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402316|gb|EGG81887.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 361

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 101/352 (28%), Positives = 166/352 (47%), Gaps = 18/352 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY  L L FD+   I  GDN  GKTNILEAI      +  R     D+ R
Sbjct: 3   IKSLKLKNFRNYDLLNLDFDSATNILYGDNAQGKTNILEAIYLSGTTKSHRGTKDRDMIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   S   T    +G+E   DI +K       S + + IN + IR   EL   + + + 
Sbjct: 63  FGQEESHIETVIEKKGIEFKTDIHLK-----KNSPKGIAINKMPIRKASELFGVIHLVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   + ++ R++  RN+LL + Y      S+
Sbjct: 118 SPEDLNIIKNGPAERRRFIDMELSQLDKVYLNDLANYNRIINQRNKLLKDIYGREDLIST 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + QMA  G ++   R + I  ++ +I     K      KL+L       +++S   
Sbjct: 178 LDIWDMQMAHYGDRVMQRRAKFIAQINGIIENVHGKLTGGKEKLNLF------YEKSIG- 230

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
              ++++ +   R+ D   + T +GPHR D+     D  I    GS G+Q+   + + L+
Sbjct: 231 -DADFSEAILKNRERDIRMKSTSVGPHRDDICFKAGDLDIR-KFGSQGQQRTAALSLKLS 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
              L+       PILLLD++ + LD++++N L   +++I + +  TG D+ V
Sbjct: 289 EIELVKLLINDTPILLLDDVLSELDKNRQNYLLDSISNIQTIVTCTGVDEFV 340


>gi|88608256|ref|YP_506094.1| putative DNA replication and repair protein RecF [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600425|gb|ABD45893.1| putative DNA replication and repair protein RecF [Neorickettsia
           sennetsu str. Miyayama]
          Length = 349

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 160/351 (45%), Gaps = 30/351 (8%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           + +FRN+A     F  +H +  G NG GKT+ILEAIS LSPG G R AS  ++ R GS S
Sbjct: 10  VKDFRNHAFWTGSFKCRHVLLCGKNGAGKTSILEAISKLSPGLGLRSASNIEMVRSGSLS 69

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
           +  +  +  G   L ++ +     +D+  R  ++N   I+   ++   +++ WL P M  
Sbjct: 70  WEVSL-KFAGSTDLREVGMGY--YEDK--RVTKLNGKSIQCFKKVIDLVKVMWLTPQMSN 124

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQMA 191
           +F+     RR+F DRMV   +P+H   ++ +ER    R ++L  G     W    E ++A
Sbjct: 125 LFTTDKSVRRKFFDRMVALSEPQHLENLVMYERFKSERLKILNAGA-SKMWLDVNEKKLA 183

Query: 192 ELGVKINIARVEMINALSSLIMEYVQKENF--PHIKL-----SLTGFLDGKFDQSFCALK 244
           EL + I  ARV  I  L    M     + F  P IKL     S  G + G   Q  C   
Sbjct: 184 ELCIAITDARVSFIGQL----MSNFPSKGFGSPEIKLFCPVASAIGRV-GSSQQMQC--- 235

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
                 L   R +D+++ +   G HR+D +        T    STGEQK++++GI LA  
Sbjct: 236 --IQSALERSRAIDTVTGKMQFGVHRTDFLATVRQGDNTARCYSTGEQKLLILGIILAAG 293

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
            LI                AHLD    +A     T    Q F +  D S F
Sbjct: 294 ELIDIILLDDIF-------AHLDLHNSSAFLLEATKKNCQFFFSDLDNSKF 337


>gi|329121617|ref|ZP_08250238.1| recombination protein F [Dialister micraerophilus DSM 19965]
 gi|327468772|gb|EGF14249.1| recombination protein F [Dialister micraerophilus DSM 19965]
          Length = 356

 Score =  129 bits (323), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 98/355 (27%), Positives = 169/355 (47%), Gaps = 12/355 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KIK   + + RN+ ++ +  D   TIF G NG GKTN+LE+++  S G+ FR     ++
Sbjct: 1   MKIKKFRLIQVRNFENIEIETDKNITIFTGKNGAGKTNLLESVNLASFGKSFRTNKDEEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +       +      G     +I IK+   + + +    +N+  I+  D L    +   
Sbjct: 61  IKFDKNECTTILTFNSGKSN-HEIKIKISKTNGKQIF---LNENRIKNKD-LVGIFKTVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD--SSW 182
             P   ++  G   +RRRFLD  +  I+PR+    I+++R ++ RN  L           
Sbjct: 116 FNPDEMQLIKGNPQKRRRFLDMEISQINPRYYYEWINYKRAVQQRNAELKNAQIRGIKPQ 175

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSF 240
               + Q+A+    I   R+E I  L+  I   E +  +N  ++KL        K + +F
Sbjct: 176 TDLWDMQIAKGAAYIVRKRIEAIQKLNESIEKTEEILTKNRENLKLYYIQKESKKNETNF 235

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
               E Y  KL + R++D    +T +GPHR D++     K I+  +GS G+Q+  ++ I 
Sbjct: 236 DV--EWYIHKLLEKRQVDIKFCQTSVGPHRDDILFLLNGKDIS-KYGSQGQQRTAILSIK 292

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+    I   TG  P+LLLD++ + LD +++  LF  V +   Q  MT T+K  +
Sbjct: 293 LSEMEFIKKETGEYPVLLLDDVGSELDRERKKVLFEYVKEKDIQTIMTMTEKPAY 347


>gi|51891142|ref|YP_073833.1| DNA repair and genetic recombination protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|81692267|sp|Q67TK4|RECF_SYMTH RecName: Full=DNA replication and repair protein recF
 gi|51854831|dbj|BAD38989.1| DNA repair and genetic recombination protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 375

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 163/350 (46%), Gaps = 13/350 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +  L +  FRNY SL + F     +  GDN  GKTN+LEAI FL+ GR  R +   D+ +
Sbjct: 3   LSTLQLGAFRNYDSLTIHFSPGLNVLYGDNAQGKTNLLEAIHFLATGRSHRTSRDPDMVQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIK--LETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            G     +  A V    G  ++ ++  L+TR     + L+IN +  R +  L   L +  
Sbjct: 63  EGREELLARAAVVR-RTGTIELELRCGLQTR-----KQLKINGIAERKIARLVGSLAVVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P   ++  G    RRRFLD  +  I   +   ++ + RL+  RN LL +   D    +
Sbjct: 117 FSPDDLQLLKGPPSGRRRFLDLELSQISQTYLHHLMAYNRLVAQRNTLLKQPVIDEGLMA 176

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
             + Q+ E G ++ + R E +  LS +   Y +        L L     G  D     L+
Sbjct: 177 VYDEQLVETGAQLVVRRAEAVRRLSPIASRYHRMLAEDREDLELAYQSQGVGDDGAADLE 236

Query: 245 EEYAKKLFDGRKMDSMSRR---TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
               +   +  ++ S  RR   TL+GPHR D+      +   + + S G+Q+  ++ + L
Sbjct: 237 TVRRRLERELARLRSEERRRQVTLVGPHRDDVGFWVAGRDARL-YASQGQQRTAVLALKL 295

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           A    +S   G  P+LLLD++++ LD  +R+ L   V + G Q F+T TD
Sbjct: 296 AELEFMSEEIGEPPLLLLDDVASELDPHRRHYLLSAVRE-GVQSFITCTD 344


>gi|289422543|ref|ZP_06424386.1| DNA replication and repair protein RecF [Peptostreptococcus
           anaerobius 653-L]
 gi|289157115|gb|EFD05737.1| DNA replication and repair protein RecF [Peptostreptococcus
           anaerobius 653-L]
          Length = 371

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 171/349 (48%), Gaps = 14/349 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +  +RNY  L + F+    + +G NG GKTNI+E+++ ++ G+ FR +   ++ +
Sbjct: 3   INSLKLVNYRNYNDLSIDFNEHINLILGKNGQGKTNIVESLTLIAIGKSFRTSKDKELIK 62

Query: 67  IGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
               S +   +F R        +I  K+E    +  + +++N V ++ + +L  +L +  
Sbjct: 63  FDKDSLYIGCSFTR-------NNIDKKIEIAIAKDKKGIKVNGVSVKSIQDLLGNLNVVI 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P   ++      ERR F+D+ +  I PR+   +  + +++  RN+LL   Y D +  +
Sbjct: 116 FSPEDLKLIKDGPKERRSFIDKEISQIMPRYYSILTSYNKVLDERNKLLKSQYIDRNLLA 175

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCA 242
                +A    +I + R + +  LS +  +  QK   +   +K+     ++        +
Sbjct: 176 VYSETLANYAAEIYLIRRDFVGKLSIISSDLHQKLTSDKEVLKIRYKSQIEVTDQDDIRS 235

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           ++E+      +    D ++R T IGPHR D+++ Y +      +GS G+Q+   + + L+
Sbjct: 236 MREKIISAHEENIDHDMLNRNTRIGPHRDDIVI-YLNDIDVRLYGSQGQQRTASISLKLS 294

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
              LI    G  P+L+LD++ + LD++++  L   + DI  Q+F+T  D
Sbjct: 295 EIELIKQEIGDYPVLILDDVFSELDQNRQKMLVEKLEDI--QMFVTTAD 341


>gi|296131554|ref|YP_003638801.1| DNA replication and repair protein RecF [Thermincola sp. JR]
 gi|296030132|gb|ADG80900.1| DNA replication and repair protein RecF [Thermincola potens JR]
          Length = 368

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 176/358 (49%), Gaps = 20/358 (5%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           KI  LN   FRNY +L L F  +  +FVGDN  GKTNILEAI +   GR  R    AD+ 
Sbjct: 5   KIALLN---FRNYQTLTLSFHDKLNLFVGDNAQGKTNILEAIYYSGTGRSHRTNKDADLI 61

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
           +  + ++F      E + G   + I L     + ++   +N V  +   ++   +++   
Sbjct: 62  K-WNENYFILKISGENLHGRFVLEIGLNREGKKKIK---LNGVQKKRTGDILGTVKVILF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    +  G  + RR+F+D  +  I P +   ++ ++R++  RN LL +   + +   +
Sbjct: 118 SPEDLTLVKGSPVVRRKFIDTEISQISPGYYYNLLKYQRILVQRNALLKDIKMNKNLADN 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + Q+A  G K+   +++++  L+ L     +K      +L  T ++    D+   +
Sbjct: 178 LSVWDRQLALFGAKLIYKKLDVLKKLTPLTRLMHRKITNGKEELE-TRYISNVVDKDNLS 236

Query: 243 LKEEYAKKLF----DGRKMDSMSRR-TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
           L+E   +KLF       + + + R  T+IGPHR DL+  Y +      +GS G+Q+   +
Sbjct: 237 LEE--IEKLFLEKIAANRDEELDRGITIIGPHRDDLVF-YINGKEVKHYGSQGQQRSCSL 293

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
            I LA   L+   TG  P+LLLD++ + LDED+R  L   V     Q F+T TD S+ 
Sbjct: 294 SIKLAELELVKGETGEYPLLLLDDVMSELDEDRRQYLLESVQS-KIQTFITTTDASLL 350


>gi|210614351|ref|ZP_03290170.1| hypothetical protein CLONEX_02384 [Clostridium nexile DSM 1787]
 gi|210150695|gb|EEA81704.1| hypothetical protein CLONEX_02384 [Clostridium nexile DSM 1787]
          Length = 365

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 101/352 (28%), Positives = 161/352 (45%), Gaps = 18/352 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  FRNY  L + FDA   IF GDN  GKTNILE+I      +  R     D+ +
Sbjct: 3   VKSLKLKNFRNYNLLNIEFDAATNIFCGDNAQGKTNILESIYLSGTTKSHRGTKDRDMIQ 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +   T     G+    D+ +K       S + + IN + IR   EL   + I + 
Sbjct: 63  FGHDEAHIETVVEKNGIPFQIDMHLK-----KNSPKGIAINKIPIRKASELFGIINIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   + ++ R++  RN+LL + Y  +    +
Sbjct: 118 SPEDLNIIKNGPAERRRFIDLELAQLDKLYLSDLSNYNRIINQRNKLLKDVYNRNDLLET 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +E    Q+ + G KI   R + I  ++ +I E  +K      +L L       ++     
Sbjct: 178 LEIWDLQLIQYGNKIIERRKQFIGQVNEIISEVHRKLTGGREELKLY------YEPGIGN 231

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           L  E+ K L   R+ D   + T +GPHR D+     D  I    GS G+Q+   + + L+
Sbjct: 232 L--EFEKALLKNRERDIRMKSTSVGPHRDDICFMTNDLDIR-KFGSQGQQRTAALSLKLS 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
              L+       PILLLD++ + LD+ ++N L   + D+ + I  TG D  V
Sbjct: 289 EIELVKEIIKDTPILLLDDVLSELDKHRQNYLLDSIRDVQTLITCTGLDDFV 340


>gi|164686443|ref|ZP_02210471.1| hypothetical protein CLOBAR_00008 [Clostridium bartlettii DSM
           16795]
 gi|164604454|gb|EDQ97919.1| hypothetical protein CLOBAR_00008 [Clostridium bartlettii DSM
           16795]
          Length = 371

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 181/366 (49%), Gaps = 16/366 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  FRNY +L L F     + VG NG GKTNI+EAI  LS G+ FR     ++
Sbjct: 1   MRLNNLQLINFRNYDNLHLNFKRNINLLVGKNGQGKTNIVEAIYMLSFGKSFRTNKDKEI 60

Query: 65  TRIGSPSFFSTFARVEG-MEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            + GS + +     ++   +GL +++I        + + +++N + I  + EL  +L + 
Sbjct: 61  IKFGSENLYIGGNYLKNSSKGLIEVAI------GNNKKGIKVNKIHIHKIQELLGNLNVV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              P   ++      ERR F+D+ +  I P++   ++++ +++  RN+ L     D +  
Sbjct: 115 IFSPEDLKLVKDGPRERRSFIDKEISQIMPKYYNYLVNYNKILIQRNKTLKNRIVDENLL 174

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFC 241
           S  +  +A  G  I + R + I  ++ +  E  +K   N   + ++    ++   + +  
Sbjct: 175 SVYDESLANYGAYIYVLRRDFIKKIAKISNEMHKKLTGNNEELLITYKNQINLTDEDTVK 234

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
             K++   KL   R+ D  +R T  G H+ DL +   D  + + +GS G+Q+   + + L
Sbjct: 235 DAKDKLLSKLESNRQRDIETRMTKYGIHKDDLNIFINDLDVKL-YGSQGQQRTASISLKL 293

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KSVFDSL 358
           +   LI       P+L+LD++ + LDE ++  L   + D+  Q+F+T  +   K +FD  
Sbjct: 294 SEIELIKQEMNDNPVLILDDVFSELDETRQKLLVENLGDV--QMFITSAELAHKRIFDE- 350

Query: 359 NETAKF 364
           +ETA F
Sbjct: 351 SETAIF 356


>gi|188584646|ref|YP_001916191.1| DNA replication and repair protein RecF [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|226737815|sp|B2A2Y9|RECF_NATTJ RecName: Full=DNA replication and repair protein recF
 gi|179349333|gb|ACB83603.1| DNA replication and repair protein RecF [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 386

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 103/385 (26%), Positives = 183/385 (47%), Gaps = 19/385 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  FRNY++L+L F     +F G N  GKTN+LEAI +L+ G+  R     ++
Sbjct: 1   MKLTELCLKNFRNYSNLKLNFKKPIILFFGANAQGKTNLLEAIYYLATGKSHRAQKEKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  +  F+     +E  +    + I    ++ ++ + L++N++         K + +  
Sbjct: 61  IRWETSGFYLK-GELEKEQAQYTLEIITNYQNGKN-KNLKVNNLSQTNTRNFLKTMNVVI 118

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P    +  G    RRRF+D+ +  +DP +   + ++ + +R RN+LL + Y D +  +
Sbjct: 119 FSPEDLMLVKGTPDNRRRFIDQEITQVDPSYDFYLKNYFKALRQRNKLL-KTYQDKNTLA 177

Query: 185 S----IEAQMAELGVKINIARVEMINA---LSSLIMEYV--QKENFPHIKLSLTGFLDGK 235
                   Q+   G KI + R E+I+    L+ LI   +  Q EN          F D K
Sbjct: 178 QHLPPWNQQLVHYGSKIILKREEVIHKIRLLARLIYRKITNQTENLELDYSPSLEFEDCK 237

Query: 236 FDQSFCA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
           F +      L  ++   L +  + D   R T IGPHR DLI    +K      GS G+Q+
Sbjct: 238 FREQLSGEKLAHKFLNTLNENLQSDIEKRTTSIGPHRDDLIFKINNKDAR-QFGSQGQQR 296

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
             ++ + +A   +I    G  PILLLD++ + LD++++  L  + T+   Q F+T T   
Sbjct: 297 TTVLALKMAELEMIKGEKGEFPILLLDDVLSELDDNRKKHLLNL-TEGRVQTFVTSTSME 355

Query: 354 VFDS---LNETAKFMRISNHQALCI 375
            F+    +   ++  RI N +A+ +
Sbjct: 356 DFNGDVDIKAKSQVFRIDNGEAVKL 380


>gi|258513370|ref|YP_003189592.1| DNA replication and repair protein RecF [Desulfotomaculum
           acetoxidans DSM 771]
 gi|257777075|gb|ACV60969.1| DNA replication and repair protein RecF [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 376

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 102/360 (28%), Positives = 171/360 (47%), Gaps = 28/360 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++IK L I+ FRNY SL +       IF+GDN  GKTNILEAI FL  GR FR +   ++
Sbjct: 1   MRIKELFINNFRNYKSLHIKPKENLNIFIGDNAQGKTNILEAICFLLQGRSFRTSHEKEI 60

Query: 65  TRIGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
               S  S   T  +        DIS+          + ++IN+       EL  +    
Sbjct: 61  INFDSEQSKLKTELKAYNQNYSIDISL-----SRTKPKIIKINNSTTS-KPELATNFGTI 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------G 176
              P    I  G   ERRRFLD  + +  P+++   +++++++  RN LL E        
Sbjct: 115 VFTPDQLSIIKGSPKERRRFLDLELASFYPQYKYYFVNYQKVLLQRNNLLKELKEKKQAD 174

Query: 177 YFD--SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSL----TG 230
            FD    W    + Q+   G KI +AR+E++  L  +  +   +      KL++    + 
Sbjct: 175 TFDLLELW----DNQLISYGAKILMARMEILKKLIPMAQQIHNQITSDKEKLTIRYRSSL 230

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
            L+  F +    + +++ + +   R+ D +  +T +GPHR DL+    +K IT   GS G
Sbjct: 231 NLNSNFREEL--IYDQFREVILKNRQQDYLKGQTTVGPHRDDLVFLINNKNIT-DFGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+ +++ +  A   L S      P+LLLD++   LD  ++  +F ++     Q+F+T T
Sbjct: 288 QQRTIILTLKFAIINLWSCELNDVPVLLLDDVFFELDSKRQKYIFDLLNK-DVQVFITST 346


>gi|218659035|ref|ZP_03514965.1| recombination protein F [Rhizobium etli IE4771]
          Length = 115

 Score =  125 bits (314), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 59/108 (54%), Positives = 82/108 (75%)

Query: 266 IGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAH 325
           +GPHR+DLIV + +KA+     STGEQK +LVG+ LAHARL+ N TG APILLLDEI+AH
Sbjct: 7   MGPHRADLIVHHREKAMEAERCSTGEQKALLVGLVLAHARLVGNLTGHAPILLLDEIAAH 66

Query: 326 LDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRISNHQAL 373
           LDE +R ALF ++  +G Q FMTGTD+++F +L + A+F  +++ + L
Sbjct: 67  LDEGRRAALFDLIDGLGGQAFMTGTDRTMFSALADRAQFFTVADGKVL 114


>gi|313892256|ref|ZP_07825849.1| DNA replication and repair protein RecF [Dialister microaerophilus
           UPII 345-E]
 gi|313119394|gb|EFR42593.1| DNA replication and repair protein RecF [Dialister microaerophilus
           UPII 345-E]
          Length = 356

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 97/355 (27%), Positives = 169/355 (47%), Gaps = 12/355 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KIK   + + RN+ ++ +  D   TIF G NG GKTN+LE+++  S G+ FR     ++
Sbjct: 1   MKIKKFRLIQVRNFENIEIETDKNITIFTGKNGAGKTNLLESVNLASFGKSFRTNKDEEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +       +      G     +I IK+   + + +    +N+  I+  D L    +   
Sbjct: 61  IKFDKNECTTILTFNSGKSN-HEIKIKISKTNGKQIF---LNENRIKNKD-LVGIFKTVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P   ++  G   +RRRFLD  +  I+PR+    I+++R ++ RN  L           
Sbjct: 116 FNPDEMQLIKGNPQKRRRFLDMEISQINPRYYYEWINYKRAVQQRNAELKNAQIRGVKPQ 175

Query: 185 S--IEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSF 240
           +   + Q+A+    I   R+E I  L+  I +  ++  +N  ++KL        K + +F
Sbjct: 176 TDIWDMQIAKGAAYIVRKRIEAIQKLNESIEKTEERLTKNRENLKLYYIQKESKKNETNF 235

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
               E Y  KL + R  D    +T +GPHR D++     K I+  +GS G+Q+  ++ I 
Sbjct: 236 DV--EWYIHKLLEKRHEDIKFCQTSVGPHRDDILFLLNGKDIS-KYGSQGQQRTAILSIK 292

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           L+    I   TG  P+LLLD++ + LD +++  LF  V +   Q  MT T+K  +
Sbjct: 293 LSEMEFIKKETGEYPVLLLDDVGSELDGERKKVLFEYVKEKDIQTIMTMTEKPAY 347


>gi|258646401|ref|ZP_05733870.1| DNA replication and repair protein RecF [Dialister invisus DSM
           15470]
 gi|260403802|gb|EEW97349.1| DNA replication and repair protein RecF [Dialister invisus DSM
           15470]
          Length = 355

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 172/350 (49%), Gaps = 24/350 (6%)

Query: 14  EFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSP--S 71
           E RN+    +      T+  G NG GKTNI+E+I F S G+ FR ++  ++ R+     +
Sbjct: 10  EIRNFEDFSIDPAENMTVLTGKNGTGKTNIIESIYFASVGKSFRTSNDEELIRLNKEEGT 69

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
               F+ V G+    +I IKL     + +    IN+   +   EL    R     P   +
Sbjct: 70  ILLDFS-VRGV--THEIKIKLSRNKGKKI---LINETATKK-RELMGMFRTVLFTPDDLQ 122

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD--SSWCSSIEAQ 189
           +  G    RRRF+D  +  + PR+   ++ + R ++ RN    E  F   ++     + Q
Sbjct: 123 LIKGAPQNRRRFIDLEISQVSPRYYEEILRYGRAVQQRNAAFKEARFHGFTADVDVWDMQ 182

Query: 190 MAELGVKINIARVEMINALSSLI--MEYV---QKENFPHIKLSLTGFLDGKFDQSFCALK 244
           +A+    I   R+E I  ++ ++  ME +   +KE+   IK   +G  + +FD+ +    
Sbjct: 183 IAKGASYIVKKRMETIGKINEIVSSMESLLTDEKESIL-IKYRKSGNQEERFDEEW---- 237

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
             Y +KL   R+ DS    T IGPHR DLI       I+ ++GS G+Q+  ++ + LA  
Sbjct: 238 --YLEKLALSREEDSRFCHTSIGPHRDDLIFLMNGNDIS-SYGSQGQQRTAILSVKLAEL 294

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
             +   TG  P+LLLD++ + LD+++R+ALF  + +   Q  +T  D+S+
Sbjct: 295 EFVKKETGEYPLLLLDDVGSELDKERRDALFSYLIEKEIQTIITTADESL 344


>gi|24212703|ref|NP_710184.1| recombination protein RecF [Leptospira interrogans serovar Lai str.
           56601]
 gi|51316470|sp|Q8FA32|RECF_LEPIN RecName: Full=DNA replication and repair protein recF
 gi|24193334|gb|AAN47202.1| recombination protein RecF [Leptospira interrogans serovar Lai str.
           56601]
          Length = 365

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 103/348 (29%), Positives = 167/348 (47%), Gaps = 17/348 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  FRN+  L L FD++   FVGDNG GKTN+LEAI  LS  + FR +  +++ R
Sbjct: 3   LKHLTIQNFRNHEELSLDFDSRLIFFVGDNGEGKTNLLEAICILSWLKSFRESEDSNLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNKHLRISWL 125
            GS ++   F R +  + L +  +++      SV R L+ N   I+   +L        L
Sbjct: 63  WGSENY---FLRGKIKDNLKESVLEIGFTSKPSVKRKLKFNQEEIKKRTDLIGKFITVLL 119

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I  G   ERR+F+D  + + DP +   ++++ ++++ RN LL  G  D S  S 
Sbjct: 120 TPMDLKIIEGGPAERRKFIDAFISSFDPFYLESLLEYNKILKHRNALLKSGNPDISHLSI 179

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG--KFDQSFCAL 243
            + ++ E G+ I   R E++  L+S     + K         L+G  DG     +     
Sbjct: 180 WDKKIVEKGIFILNKRREVVLELNSFYRVNLDK---------LSGGKDGLELIYKPNVKD 230

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           ++E+ +KL      D     T +G HR DL +    + IT   GS G+++  ++ +  A 
Sbjct: 231 QDEFLEKLNHNLSRDLRLGYTSVGIHRDDLFIGSDQRDIT-EFGSQGQKRSTVIALKAAT 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
                N     P+LL+D++   LD  +R     +V   G Q F T TD
Sbjct: 290 FNYYKNILNTIPVLLIDDVIRELDVKRREYFVDLVVTAG-QAFFTTTD 336


>gi|116326858|ref|YP_796578.1| recombinational DNA repair ATPase [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116329805|ref|YP_799523.1| recombinational DNA repair ATPase [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|122282419|sp|Q04WF5|RECF_LEPBJ RecName: Full=DNA replication and repair protein recF
 gi|122285291|sp|Q056V0|RECF_LEPBL RecName: Full=DNA replication and repair protein recF
 gi|116119602|gb|ABJ77645.1| Recombinational DNA repair ATPase [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116123494|gb|ABJ74765.1| Recombinational DNA repair ATPase [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 365

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 100/347 (28%), Positives = 170/347 (48%), Gaps = 15/347 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  FR+Y  L L F+++   FVGDNG GKTN+LEAI  LS  + FR +  +++ R
Sbjct: 3   LKHLTLQNFRSYEELSLDFNSRLIFFVGDNGEGKTNLLEAICMLSWLKSFRESEDSNLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            GS ++F    +++G +  + + +   T      R L+ N   ++   +L        L 
Sbjct: 63  WGSENYFLR-GKIKGDQKESVLEVGF-TAKPTVKRKLKFNQEEVKKRTDLIGKFITVLLT 120

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P   +I  G   ERR+F+D  + + DP +   ++++ ++++ RN LL  G  D+S  S  
Sbjct: 121 PMDLKIIEGGPAERRKFIDAFISSFDPFYLECLLEYNKILKHRNALLKTGISDASHLSIW 180

Query: 187 EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           + ++ E GV I   R E++  L+S     + K +    +L +    + K        K+E
Sbjct: 181 DRKLIEKGVLILNKRKEIVFGLNSFYQPNLNKLSGGKDELEMIYGPNVK-------DKDE 233

Query: 247 YAKKLFDGRKMDSMSR--RTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           + +KL  GR +    R   T +G HR DL +   DK      GS G+++  ++ +  A  
Sbjct: 234 FVEKL--GRNLGKDLRLGYTSVGIHRDDLFIG-ADKRDITEFGSQGQKRSTVIALKAATF 290

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
               N     P+LL+D++   LD  +R     +V + G Q F T TD
Sbjct: 291 NYYRNVLDTMPVLLIDDVIRELDVKRREYFVDLVINAG-QAFFTTTD 336


>gi|24753765|gb|AAN64013.1|AF434658_10 recombination protein RecF [Leptospira interrogans]
          Length = 365

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 103/348 (29%), Positives = 167/348 (47%), Gaps = 17/348 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  FRN+  L L FD++   FVGDNG GKTN+LEAI  LS  + FR +  +++ R
Sbjct: 3   LKHLTIQNFRNHEELSLDFDSRLIFFVGDNGEGKTNLLEAICILSWLKSFRESEDSNLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNKHLRISWL 125
            GS ++   F R +  + L +  +++      SV R L+ N   I+   +L        L
Sbjct: 63  WGSENY---FLRGKIKDNLKESVLEIGFTSKPSVKRKLKFNQEEIKKRTDLIGKFITVLL 119

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I  G   ERR+F+D  + + DP +   ++++ ++++ RN LL  G  D S  S 
Sbjct: 120 TPMDLKIIEGGPAERRKFIDAFISSFDPFYLESLLEYNKILKHRNALLKSGNPDISHLSI 179

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG--KFDQSFCAL 243
            + ++ E G+ I   R E++  L+S     + K         L+G  DG     +     
Sbjct: 180 WDKKIVEKGIFILNKRREVVLELNSFYKVNLDK---------LSGGKDGLELIYKPNVKD 230

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           ++E+ +KL      D     T +G HR DL +    + IT   GS G+++  ++ +  A 
Sbjct: 231 QDEFLEKLNRNLSRDLRLGYTSVGIHRDDLFIGTDQRDIT-EFGSQGQKRSTVIALKAAT 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
                N     P+LL+D++   LD  +R     +V   G Q F T TD
Sbjct: 290 FNYYKNILNTIPVLLIDDVIRELDVKRREYFVDLVVTAG-QAFFTTTD 336


>gi|328956386|ref|YP_004373772.1| DNA replication and repair protein RecF [Carnobacterium sp. 17-4]
 gi|328672710|gb|AEB28756.1| DNA replication and repair protein RecF [Carnobacterium sp. 17-4]
          Length = 373

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 98/378 (25%), Positives = 175/378 (46%), Gaps = 26/378 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K +++S +RNY    ++F     +F+G+N  GKT+++EAI  L+  R  R A+  +  R
Sbjct: 3   LKEIHLSNYRNYEHAEVIFSKGINVFLGENAQGKTSLMEAIYVLAMARSHRTANDKETIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                +   FARV G     + S  LE    +  +  + N +  + + E   +L +    
Sbjct: 63  -----WEQEFARVSGRIQKKNTSFPLEISISKKGKKAKFNHLEQKKLSEYIGNLNVILFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DSSW 182
           P    +  G    RR+FLD  +  + P +   ++ ++ L++ RN  L +       D ++
Sbjct: 118 PEDLSLVKGSPSVRRKFLDMEMGQMSPIYLHHLVQYQHLLKQRNSYLKQLSLKKVKDLTF 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLI----MEYVQKENFPHI----KLSLTGFLDG 234
              +  Q+AE G  I + R   I  L +       E  +++    I     L +T   D 
Sbjct: 178 LDILTEQLAEFGAAILVERFSFIKKLENWAKPVHAEISRQKEILEIGYSCSLKITNETDK 237

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
           K  Q +  L   Y +    GR+ +   R T+ GPHR DL      + +   +GS G+Q+ 
Sbjct: 238 K--QIYSDLMNAYTQ----GRQRELEQRTTIFGPHRDDLKFSVNGRNVQ-TYGSQGQQRT 290

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD-KS 353
             + + LA   L+   TG  P+LLLD++ + LD++++  L + + +   Q F+T T    
Sbjct: 291 TALSVKLAEIDLMKEMTGEYPVLLLDDVLSELDDERQTHLLKAIQN-KVQTFLTTTSLDG 349

Query: 354 VFDSLNETAKFMRISNHQ 371
           + +++ ET K   I N Q
Sbjct: 350 IKENMLETPKIFLIDNGQ 367


>gi|58584386|ref|YP_197959.1| recombination protein F [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58418702|gb|AAW70717.1| Recombinational DNA repair ATPase, RecF [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 356

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 170/358 (47%), Gaps = 17/358 (4%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M     IK L +S FRN+ +  L  D    + +G NG+GKTNILEAIS L+   G ++A 
Sbjct: 1   MAAHCYIKKLKLSNFRNHLNFELDSDDSSVVIIGKNGIGKTNILEAISLLAKSNGMKKAK 60

Query: 61  YADV-TRIGSPSFFSTFARVEGMEGLADI-SIKLETRDDRSVRCLQINDVVIRVVDELNK 118
            +++  R  +  +   +    G    AD+ SI +    ++ +  +QI   +      L +
Sbjct: 61  ASEMQNRFSNKDWAVHYDFFNG----ADLNSIGIAKSFNKKL--IQIGGKMQSSYSSLYR 114

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
              + WL+P MD I      +R +FLDR+V   +  +    + + +  R R RLL E   
Sbjct: 115 ISNVIWLIPQMDYILLNSPSDRLKFLDRIVSLFEENYACYYMRYRKAKRERGRLLRENIL 174

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
           + SW SS+E  MA   V I   R+ ++  L   I  Y   + FP + L     L      
Sbjct: 175 NKSWLSSLENIMAVNAVNILDMRLSVLKMLQDTINSY-STQFFPKVSLKFNSQL------ 227

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKA-ITIAHGSTGEQKVVLV 297
           +     + +  +L + R+ DS++ R     +     V +C +  + I   STGEQK++L+
Sbjct: 228 TLSDTAKYFQNRLRENREKDSLTGRITFCVNNDKFQV-FCQRRDLPINLCSTGEQKLLLL 286

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
            I L+  +        AP+LLLD+I +HLD+  R  L   +  I  Q ++T  D++ F
Sbjct: 287 SIILSSVKARCIHYNKAPLLLLDDIMSHLDKYYRKVLIEEMLSIRCQAWITDVDQNNF 344


>gi|226326149|ref|ZP_03801667.1| hypothetical protein COPCOM_03968 [Coprococcus comes ATCC 27758]
 gi|225205691|gb|EEG88045.1| hypothetical protein COPCOM_03968 [Coprococcus comes ATCC 27758]
          Length = 361

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 160/353 (45%), Gaps = 20/353 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L + ++RNY  L + FD    IF GDN  GKTNILE +      +  R     D+ R
Sbjct: 3   IKSLKLKDYRNYEILNIEFDHATNIFYGDNAQGKTNILEGVYLSGTTKSHRGTKDRDLIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +   T     G+    D+ +K       S + + IN V IR   EL       + 
Sbjct: 63  FGQDEAHIETVIEKNGVPWQIDMHLK-----KNSPKGIAINKVPIRRASELFGLTNFVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   + ++ R +  RNRLL + Y+      +
Sbjct: 118 SPEDLNIIKNGPAERRRFMDLELSQLDKVYLSDLANYNRTLNQRNRLLKDAYYRDDILDT 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           ++    Q+ + G KI   R+  I  ++++I +   K      ++ L+      ++    A
Sbjct: 178 LDVWDMQLVQYGEKIIQRRLRFIEEVNAIIGDIHHKLTGGRERIGLS------YEPGCGA 231

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVGIFL 301
           L  E A  L   R+ D   + T +GPHR D+   +    I I   GS G+Q+   + + L
Sbjct: 232 LSLEAA--LEKNRERDIRMKSTSVGPHRDDIC--FMAGGIDIRRFGSQGQQRTAALSLKL 287

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           +   L+       P+LLLD++ + LD+ ++N L   + DI + I  TG D+ V
Sbjct: 288 SEIELVRQIIKDTPVLLLDDVLSELDKHRQNYLLDSIHDIQTLITCTGLDEFV 340


>gi|223940285|ref|ZP_03632143.1| DNA replication and repair protein RecF [bacterium Ellin514]
 gi|223891052|gb|EEF57555.1| DNA replication and repair protein RecF [bacterium Ellin514]
          Length = 361

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 169/352 (48%), Gaps = 19/352 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L + +FRNY  L + F     + +GDN  GKTNILEAI  ++  R FR    + +
Sbjct: 1   MHLAHLRLRDFRNYPRLDVDFAPGFQVLLGDNAQGKTNILEAIYLMATLRSFRGVGGSQM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R G   +F     V    G  D  IK+      + R L +++  IR + +    +R+  
Sbjct: 61  VRHGQKGYFVGGKVV----GQGDHEIKMYWSP--AERKLSLDNQPIRKLADYFGAIRVVI 114

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
                 ++  G S  RRRF+D ++    P +   +  +   +R RN LL +   D S   
Sbjct: 115 FCTEDLQLVKGTSRARRRFVDLLLSQTHPTYLPLLQRYASALRSRNALLKQRVQDESALE 174

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           S  A++ +LG  +   R E+I  LS L     ++ +    +L L         +   ++K
Sbjct: 175 SFTAELVKLGNDLIRMRHELIPKLSPLARLAYRRISNDAEELRL---------EYQPSVK 225

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           +++A +L   R  +   R TLIGPHR ++ +   D++     GS G+++ + + + +A A
Sbjct: 226 KDFAVELAQTRARERTYRSTLIGPHRDEVQLLLNDRS-AAQFGSEGQKRTLAIALKMAQA 284

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT---DIGSQIFMTGTDKS 353
             ++   G APILL+D+I   LD  +R+ L  ++        Q+FMT T+++
Sbjct: 285 EYLTGLHGSAPILLIDDIMGELDAKRRSGLLPLLERAHHTRGQVFMTCTEEN 336


>gi|220927463|ref|YP_002504372.1| DNA replication and repair protein RecF [Clostridium cellulolyticum
           H10]
 gi|254790470|sp|B8I3R5|RECF_CLOCE RecName: Full=DNA replication and repair protein recF
 gi|219997791|gb|ACL74392.1| DNA replication and repair protein RecF [Clostridium cellulolyticum
           H10]
          Length = 372

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 108/381 (28%), Positives = 183/381 (48%), Gaps = 40/381 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  +RN+ + R++F  +  IF GDNG GKTNILEAI   + GR  R +  +++ +
Sbjct: 3   VKNLVLENYRNHTNTRILFSDRFNIFYGDNGQGKTNILEAIYLCASGRSHRTSRDSELIK 62

Query: 67  IGSPSFFSTFARVEGMEGL-ADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G  + FS    V    GL  DI I       + ++   IND+ I+ +  L  +L     
Sbjct: 63  FGCEN-FSIAVHVSKTGGLDKDIEISYYENQKKQIK---INDIPIKKIGALMGNLYAVLF 118

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  I P +   +    ++++ RN LL     +     +
Sbjct: 119 SPEDLFIVKQGPTERRRFVDITLSQIKPSYFYNLQQMSKILKQRNTLLKNISSNPKLMDT 178

Query: 186 IE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ-SF- 240
           ++    ++AE+   I  AR      LS +       EN  H       FL GK ++ SF 
Sbjct: 179 VDIWNMRLAEVAAAIIKARRTFSIMLSGM------AEN-QH------NFLTGKSEKISFD 225

Query: 241 --CALK------EEYAKKLFDGRKMDSMSR-----RTLIGPHRSDLIVDYCDKAITIAHG 287
             C+ +       E  +KL+  +   SM R      T +GPHR D  +   DK++ + +G
Sbjct: 226 YRCSFQISGQDDTEQIEKLYLVQLEKSMQRDIVLGYTTVGPHRDDYDIMINDKSLKL-YG 284

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           S G+Q+  ++ + +A   L+   T   P+LLLD++ + LD++++  L   + ++  Q F+
Sbjct: 285 SQGQQRSAVLSLKIAEIELVKKATNQYPVLLLDDVMSELDKNRQKYLMDSIKEV--QTFI 342

Query: 348 TGTDKSVFDS-LNETAKFMRI 367
           T T+K  F + L+  + F +I
Sbjct: 343 TCTNKEHFGNLLSANSNFFKI 363


>gi|260437692|ref|ZP_05791508.1| DNA replication and repair protein RecF [Butyrivibrio crossotus DSM
           2876]
 gi|292809918|gb|EFF69123.1| DNA replication and repair protein RecF [Butyrivibrio crossotus DSM
           2876]
          Length = 361

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 168/360 (46%), Gaps = 24/360 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY + ++ FD    I  GDN  GKTNILEAI      +  + +  +++  
Sbjct: 3   IKSIDLQNFRNYETEKIEFDENTNILYGDNAQGKTNILEAIFLSGTSKSHKGSKDSEIIN 62

Query: 67  -IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            +   S   T    + ++   DI I    R ++S + + +N V I+   EL   + I + 
Sbjct: 63  FLKDESHIKTVISKKEIDYRIDIHI----RKNKS-KGIAVNGVPIKKSSELYGIVNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I       RRRF+D  +  +D  +   +I++ + +  RNRLL + YF      +
Sbjct: 118 SPEDLNIIKAGPFARRRFMDMEMCQLDKIYVNSLINYNKAIDQRNRLLKDIYFSPYLEDT 177

Query: 186 IE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG---KFDQS 239
           ++     + + G +I   R   IN L+ +I +         I  +L+G  +    K++  
Sbjct: 178 MDIWDENILKYGSEIIRKRESFINELNEIIGK---------IHFTLSGGRENIVIKYEP- 227

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
            C  +EE+   L   R  D   + T  GPHR D+I    D      +GS G+Q+   + +
Sbjct: 228 -CVKEEEFESVLKSTRDRDKKQKSTCSGPHRDDIIF-LIDNVDIRKYGSQGQQRTAALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   ++    G  PILLLD++ + LD  ++N L   + +I + +  TG D+ + +  N
Sbjct: 286 KLAEIEIVKKQIGDTPILLLDDVLSELDSSRQNYLLNSIHNIQTIMTCTGLDEFINNRFN 345


>gi|153854252|ref|ZP_01995551.1| hypothetical protein DORLON_01545 [Dorea longicatena DSM 13814]
 gi|149753027|gb|EDM62958.1| hypothetical protein DORLON_01545 [Dorea longicatena DSM 13814]
          Length = 374

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 162/358 (45%), Gaps = 30/358 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  FRNY  L + FD    IF G+N  GKTNILEA+      +  R +   D+
Sbjct: 12  LKVNSLKLKNFRNYDLLNVEFDGSTNIFYGNNAQGKTNILEAVYLSGTTKSHRGSKDRDM 71

Query: 65  TRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R G   S   T     G+    D+ +K       S + + IN + IR   EL   + + 
Sbjct: 72  IRFGEDESHIETVVEKNGISYQIDMHLK-----KNSPKGIAINKMPIRKASELFGIVNLV 126

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFD 179
           +  P    I      ERRRF+D  +  +D  +   + ++ R++  RN LL E    G  D
Sbjct: 127 FFSPEDLNIIKNGPAERRRFIDLELSQLDKVYLNNLSNYNRIVNQRNHLLKELSFGGKKD 186

Query: 180 SSWCSSI-EAQMAELGVKINIARVEMINALSSLIMEYVQ-----KENFPHIKLSLTGFLD 233
            S    I E QM + G ++   R E +  ++ +I +  Q     KE+   I    TG  D
Sbjct: 187 LSDTLEIWELQMVQYGERLIARRKEFVEQINGIIAKIHQRLTGGKESLKIIYEPSTG--D 244

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
             F+Q+    +E            D   + T +GPHR D+     D  I   +GS G+Q+
Sbjct: 245 LPFEQALNRYRER-----------DLRMKSTTVGPHRDDIGFLIGDMDIR-KYGSQGQQR 292

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
              + + L+   L+   T   PILLLD++ + LD+ ++N L   + DI + I  TG +
Sbjct: 293 TAALSLKLSEIELVKLATHDTPILLLDDVLSELDKHRQNYLLDSIHDIQTLITCTGVE 350


>gi|225570328|ref|ZP_03779353.1| hypothetical protein CLOHYLEM_06425 [Clostridium hylemonae DSM
           15053]
 gi|225160860|gb|EEG73479.1| hypothetical protein CLOHYLEM_06425 [Clostridium hylemonae DSM
           15053]
          Length = 361

 Score =  122 bits (307), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 163/354 (46%), Gaps = 18/354 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KIK L +  FRNY  L+L FD    IF GDN  GKTNILE++      +  R     D+
Sbjct: 1   MKIKSLKLKSFRNYDFLKLEFDNATNIFYGDNAQGKTNILESVYLSGTTKSHRGTKDRDL 60

Query: 65  TRIG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            + G   S   T     G+    D+ +K       S + + IN + IR   EL   + I 
Sbjct: 61  VQFGKEESHIETVVEKNGITYQIDMHLK-----KNSPKGIAINKIPIRKASELFGIINIV 115

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           +  P    I      ERRRF+D  +  +D  +   + ++ R++  RN LL +     +  
Sbjct: 116 FFSPEDLNIIKNGPSERRRFIDLELSQLDKVYLNNLSNYNRIVNQRNHLLKDITQQRNLM 175

Query: 184 SSI---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            ++   E Q+ + G KI   R + +  ++ +I    +K      +++L       ++ S 
Sbjct: 176 ETLDVWEIQLIQYGNKIIERRKQFVKEINKIISNIHKKLTGEKEEINLI------YEPSV 229

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L  E A  L   R+ D   + T +GPHR D+     D  I    GS G+Q+   + + 
Sbjct: 230 GNLTFEQA--LAKNRERDMRIKSTSVGPHRDDICFMVGDLDIR-RFGSQGQQRTAALSLK 286

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           L+   L+  +    P+LLLD++ + LD+ ++N L   + DI + I  TG D+ V
Sbjct: 287 LSEIELVKQSIHDTPVLLLDDVLSELDKHRQNYLLDSIHDIQTLITCTGVDEFV 340


>gi|160893408|ref|ZP_02074193.1| hypothetical protein CLOL250_00957 [Clostridium sp. L2-50]
 gi|156864803|gb|EDO58234.1| hypothetical protein CLOL250_00957 [Clostridium sp. L2-50]
          Length = 360

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 169/352 (48%), Gaps = 24/352 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ LNI+ +RNY  L + FD    I  GDN  GKTNILE+I   +  +  R +   ++ +
Sbjct: 3   VESLNINNYRNYDELFITFDKNTNILYGDNAQGKTNILESIYMAATTKSHRGSKDREIIK 62

Query: 67  IGSPSFFSTFARVEGMEGLADIS--IKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           IG        + +      +DIS  I +  R +++ + + I+ + IR   EL   L + +
Sbjct: 63  IGEEE-----SHIRLCIKKSDISHRIDMHLRKNKN-KGVAIDGLPIRRTTELFGLLNVIF 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P    I      ERRRFLD  +  +   + + +  + +++  RN LL +  ++ S   
Sbjct: 117 FSPEDLSIIKNGPSERRRFLDLELCQLSRLYYQNLSSYSKILNQRNNLLKQIVYNKSLMD 176

Query: 185 SIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
           +++    Q+ + G K+   R   I  L++LI E   K      KL +       +D++  
Sbjct: 177 TLDVWNIQLVDYGKKVIKERQNFIMMLNNLIGEIHSKLTSGKEKLEII------YDKNVS 230

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLI--VDYCDKAITIAHGSTGEQKVVLVGI 299
             ++E+ K L D   +D     T  GPHR D++  ++  D       GS G+Q+ V + +
Sbjct: 231 --EDEFEKVLADKVHVDLNYMSTQTGPHRDDIMFMINGIDAR---RFGSQGQQRTVALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            +A  +L+ N     PILLLD++ + LD  +R AL   + DI + I  TG D
Sbjct: 286 KIAEIKLVKNIINDNPILLLDDVMSELDSSRREALLEEIKDIQTIITCTGYD 337


>gi|183219430|ref|YP_001837426.1| DNA replication and repair protein RecF [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189909576|ref|YP_001961131.1| recombinational DNA repair ATPase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|226737810|sp|B0S909|RECF_LEPBA RecName: Full=DNA replication and repair protein recF
 gi|226737811|sp|B0SK33|RECF_LEPBP RecName: Full=DNA replication and repair protein recF
 gi|167774252|gb|ABZ92553.1| Recombinational DNA repair ATPase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167777852|gb|ABZ96150.1| DNA replication and repair protein RecF [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 367

 Score =  122 bits (307), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 97/348 (27%), Positives = 167/348 (47%), Gaps = 17/348 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K + I  FRN+   +L F ++   F+G+NG GKTN+LE+IS LS  + FR +    + R
Sbjct: 3   LKKIYIKNFRNHEETQLTFKSRLVFFIGNNGEGKTNLLESISLLSYLKSFRESDQNQLLR 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              S +F       EG E L +  I+         + L++N    + + +   + R   +
Sbjct: 63  WDTSDTFIRAEFESEGNEYLFEYGIE---HSQTKRKKLKVNGEEFKKISDYVGYFRSIVM 119

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I    ++ERRRFLD  + + +  + +++I++ERL++ RN  L +          
Sbjct: 120 SPPDILIIEDGNVERRRFLDAFISSTNRYYLKQLIEYERLIKQRNAALKKENASDREIGI 179

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF--DQSFCAL 243
            +  + E   +I   R + I +L+           F    L L+   D  F   +     
Sbjct: 180 WDEPIIEHDSEIREIRTKTIQSLAGY---------FHQNLLQLSSGKDPYFLTYKPNITS 230

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           KEE+ +KL D  + D     T  G HR  L + + DK ++   GS G+++  ++ +  A 
Sbjct: 231 KEEHKQKLIDNLRKDKAIGYTSCGNHRDTLPIGFDDKDLS-GFGSQGQKRSAVIALKTAC 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            ++I +TTG AP+LL+D+I   LD  +R     ++++ G Q F T TD
Sbjct: 290 FQMIRDTTGEAPVLLIDDIIRELDVKRREYFVNLISECG-QAFFTTTD 336


>gi|126697570|ref|YP_001086467.1| DNA replication and repair protein [Clostridium difficile 630]
 gi|254977346|ref|ZP_05273818.1| DNA replication and repair protein [Clostridium difficile
           QCD-66c26]
 gi|255094676|ref|ZP_05324154.1| DNA replication and repair protein [Clostridium difficile CIP
           107932]
 gi|255102903|ref|ZP_05331880.1| DNA replication and repair protein [Clostridium difficile
           QCD-63q42]
 gi|255308723|ref|ZP_05352894.1| DNA replication and repair protein [Clostridium difficile ATCC
           43255]
 gi|255316430|ref|ZP_05358013.1| DNA replication and repair protein [Clostridium difficile
           QCD-76w55]
 gi|255519090|ref|ZP_05386766.1| DNA replication and repair protein [Clostridium difficile
           QCD-97b34]
 gi|255652273|ref|ZP_05399175.1| DNA replication and repair protein [Clostridium difficile
           QCD-37x79]
 gi|260681773|ref|YP_003213058.1| DNA replication and repair protein [Clostridium difficile CD196]
 gi|306521987|ref|ZP_07408334.1| DNA replication and repair protein [Clostridium difficile
           QCD-32g58]
 gi|123363673|sp|Q18C86|RECF_CLOD6 RecName: Full=DNA replication and repair protein recF
 gi|115249007|emb|CAJ66818.1| DNA replication and repair protein RecF [Clostridium difficile]
 gi|260207936|emb|CBA60047.1| DNA replication and repair protein [Clostridium difficile CD196]
          Length = 371

 Score =  122 bits (306), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 93/364 (25%), Positives = 177/364 (48%), Gaps = 17/364 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  FRNY  L L F+ +  + VG NG GKTNI+E+I  LS G+ FR     ++
Sbjct: 1   MKLKSLQLVNFRNYKKLHLEFNGKVNLLVGKNGQGKTNIVESIYMLSFGKSFRTNKDKEM 60

Query: 65  TRIGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
            R  S + +   +F++      L ++ I    +D + +R   IN V ++ + EL  +L +
Sbjct: 61  VRFNSENLYIGGSFSKYNKY-SLIELII---GKDKKGIR---INKVPLQKIQELLGNLNV 113

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
               P   R+      ERR F+D+ +  I P++ + + ++ + +  R+R+L   + D + 
Sbjct: 114 VIFSPEDLRLVKEGPKERRAFIDKEISQIIPKYYKYLTNYNKTLSQRSRVLKNIHVDEAL 173

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSF 240
               +  +A+ G  I I R + I  ++++   M          + +     ++   + + 
Sbjct: 174 LDVYDDTLAKYGSYIYILRRDFIKKIANISENMHMNLTNGVERLSIRYKNQINITDEDTI 233

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +  ++  KL   R  D  S+ T  G H+ DL + + +       GS G+Q+   + + 
Sbjct: 234 DTVYNKFLAKLSSNRPNDIESKTTRYGIHKDDLNI-FINDLDARLFGSQGQQRTASISLK 292

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KSVFDS 357
           L+   LI N     P+L+LD++ + LDE ++  L   ++++  Q+F+T  +   K +FD 
Sbjct: 293 LSEIELIKNEVEEYPVLILDDVFSELDEARQKLLVNNLSNV--QMFITSAEVSHKKIFDE 350

Query: 358 LNET 361
            N T
Sbjct: 351 KNVT 354


>gi|255657642|ref|ZP_05403051.1| DNA replication and repair protein [Clostridium difficile
           QCD-23m63]
 gi|296452677|ref|ZP_06894368.1| recombination protein F [Clostridium difficile NAP08]
 gi|296880070|ref|ZP_06904039.1| recombination protein F [Clostridium difficile NAP07]
 gi|296258459|gb|EFH05363.1| recombination protein F [Clostridium difficile NAP08]
 gi|296428937|gb|EFH14815.1| recombination protein F [Clostridium difficile NAP07]
          Length = 371

 Score =  122 bits (306), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 93/364 (25%), Positives = 176/364 (48%), Gaps = 17/364 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  FRNY  L L F+ +  + VG NG GKTNI+E+I  LS G+ FR     ++
Sbjct: 1   MKLKSLQLVNFRNYKKLHLEFNGKVNLLVGKNGQGKTNIVESIYMLSFGKSFRTNKDKEM 60

Query: 65  TRIGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
            R  S + +   +F++      L ++ I    +D + +R   +N V ++ + EL  +L +
Sbjct: 61  VRFNSENLYIGGSFSKYNKY-SLIELII---GKDKKGIR---VNKVPLQKIQELLGNLNV 113

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
               P   R+      ERR F+D+ +  I P++ + + ++ + +  R+R+L   + D + 
Sbjct: 114 VIFSPEDLRLVKEGPKERRTFIDKEISQIIPKYYKYLTNYNKTLSQRSRVLKSIHVDEAL 173

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSF 240
               +  +A  G  I I R + I  ++S+   M          + +     ++   + + 
Sbjct: 174 LDVYDDTLARYGSYIYILRRDFIKKIASISENMHMNLTNGVERLSIRYKNQINITDEDTI 233

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +  ++  KL   R  D  S+ T  G H+ DL + + +       GS G+Q+   + + 
Sbjct: 234 DTVYNKFLAKLSSNRPNDIESKTTRYGIHKDDLNI-FINDLDARLFGSQGQQRTASISLK 292

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KSVFDS 357
           L+   LI N     P+L+LD++ + LDE ++  L   ++++  Q+F+T  +   K +FD 
Sbjct: 293 LSEIELIKNEVEEYPVLILDDVFSELDEARQKLLVNNLSNV--QMFITSAEISHKKIFDE 350

Query: 358 LNET 361
            N T
Sbjct: 351 KNVT 354


>gi|45655917|ref|YP_000003.1| DNA repair and genetic recombination protein [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
 gi|51316280|sp|Q72WD4|RECF_LEPIC RecName: Full=DNA replication and repair protein recF
 gi|45599150|gb|AAS68640.1| DNA repair and genetic recombination protein [Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130]
          Length = 365

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 102/348 (29%), Positives = 166/348 (47%), Gaps = 17/348 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  FRN+  L L FD++   FVGDNG GKTN+LEAI  LS  + FR +  +++ R
Sbjct: 3   LKHLTIQNFRNHEELSLDFDSRLIFFVGDNGEGKTNLLEAICILSWLKSFRESEDSNLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNKHLRISWL 125
            GS ++   F R +    L +  +++      SV R L+ N   I+   +L        L
Sbjct: 63  WGSENY---FLRGKIKNNLKESVLEIGFTSKPSVKRKLKFNQEEIKKRTDLIGKFITVLL 119

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I  G   ERR+F+D  + + DP +   ++++ ++++ RN LL  G  D S  S 
Sbjct: 120 TPMDLKIIEGGPAERRKFIDAFISSFDPFYLEFLLEYNKILKHRNALLKSGNLDISHLSI 179

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG--KFDQSFCAL 243
            + ++ E G+ I   R E++  L+S     + K         L+G  DG     +     
Sbjct: 180 WDKKIVEKGIFILNKRREVVLELNSFYRVNLDK---------LSGGKDGLELIYKPNVKD 230

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           ++E+ +KL      D     T +G HR DL +    + IT   GS G+++  ++ +  A 
Sbjct: 231 QDEFLEKLNRNLSRDLRLGYTSVGIHRDDLFIGTDQRDIT-EFGSQGQKRSTVIALKAAT 289

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
                +     P+LL+D++   LD  +R     +V   G Q F T TD
Sbjct: 290 FNYYKDILNTIPVLLIDDVIRELDVKRREYFVDLVVTAG-QAFFTTTD 336


>gi|150014896|ref|YP_001307150.1| recombination protein F [Clostridium beijerinckii NCIMB 8052]
 gi|189039620|sp|A6LPB4|RECF_CLOB8 RecName: Full=DNA replication and repair protein recF
 gi|149901361|gb|ABR32194.1| DNA replication and repair protein RecF [Clostridium beijerinckii
           NCIMB 8052]
          Length = 367

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 173/373 (46%), Gaps = 20/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K +N+  +RNY  L +       +FVGDN  GKTNILE++ + +  +  R +   ++  
Sbjct: 3   VKNINLLNYRNYKKLSVELTENVNVFVGDNAQGKTNILESVYYCAFAKSHRTSKDKELIN 62

Query: 67  I-GSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              S ++ S       ++   DI+I    RD +  + +++N++ +  + EL     +   
Sbjct: 63  WENSTAYISLLIGKNRLDKKIDINI---LRDGK--KAIKVNNIKVNKIGELFGIFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   ++       RRR LD  +  ++P +   ++ + +++  RN LL    F       
Sbjct: 118 SPEDLKVIKEAPSLRRRLLDMELSQVNPNYYFNLVQYNKVLGERNILLKSRSFSEDILDV 177

Query: 186 IEAQMAELGVKINIARVEMINALS---SLIMEYVQ--KENFPHIKLSLTGFLDGKFDQSF 240
            + Q+++    I   R+E IN ++    +I   +   KE             +GKF    
Sbjct: 178 YDIQLSKYADYIISKRLEYINKINFYGDIIHREITSGKEEINFKYNCTVNLENGKF---- 233

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
              K+ Y KKL D  + D     T +GPHR D  V + +   T   GS G+Q+  ++ + 
Sbjct: 234 ---KDNYLKKLKDNIQKDREKGLTSVGPHRDDFSV-FINNIDTKIFGSQGQQRTSILTMK 289

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
            A  ++I   TG  P+LLLD++ + LD +++  + R + DI + I   G +  + D L++
Sbjct: 290 FASLKIIREITGEYPVLLLDDVLSELDLNRKKYILRSIKDIQTIITCAGIE-DLNDYLDD 348

Query: 361 TAKFMRISNHQAL 373
             K   +SN Q L
Sbjct: 349 KVKIFNVSNGQIL 361


>gi|332798027|ref|YP_004459526.1| DNA replication and repair protein recF [Tepidanaerobacter sp. Re1]
 gi|332695762|gb|AEE90219.1| DNA replication and repair protein recF [Tepidanaerobacter sp. Re1]
          Length = 364

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 165/361 (45%), Gaps = 44/361 (12%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L + +FRN+  L L F     IF GDN  GKTN+LEAI F++  R  R     +V R   
Sbjct: 6   LRLYDFRNFLELDLEFKNGINIFYGDNAQGKTNLLEAIYFITELRATRAFREQEVIRYDQ 65

Query: 70  P-----SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           P       FST A         DI        DR V   +     ++  +  NK  R S 
Sbjct: 66  PLAFLKGLFSTKA--------GDI--------DRQVTIYRNQKKEVKEGE--NKKSRWSE 107

Query: 125 LVPSMDRIF---------SGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE 175
           L PS+  ++          G    RRRF+D +++ I P   + +  ++R++  RN LL  
Sbjct: 108 LDPSISAVYFSPEDIDLVKGEPSLRRRFIDNLIYRIRPSFYKYLQGYQRVLTQRNTLLKT 167

Query: 176 GYFDSSWCSSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFL 232
                    +++    Q++ELG ++   R++M+  +SSL  +Y +   F H +  L    
Sbjct: 168 IKIKPGMTKTLDPWDEQLSELGSQLINERLKMLQRISSLSQDYFK--TFTHKRNDLRISY 225

Query: 233 DGKFDQSFCAL-KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTG 290
             + D S   L K +Y  KL   R+ D     T +GPHR D  +D+      I H  S G
Sbjct: 226 RSEIDFSNPELIKADYKNKLILNREKDINRSFTSVGPHRDD--IDFFIDGKNIKHYASQG 283

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q++ ++ +  A   L+    G  PILLLD++ + LD  +R     I+     Q+F+T T
Sbjct: 284 QQRLTVLCLMFAQRNLLYTEKGEYPILLLDDVMSELDIHRRQL---ILGQENHQVFITTT 340

Query: 351 D 351
           D
Sbjct: 341 D 341


>gi|125974859|ref|YP_001038769.1| DNA replication and repair protein RecF [Clostridium thermocellum
           ATCC 27405]
 gi|256003885|ref|ZP_05428872.1| DNA replication and repair protein RecF [Clostridium thermocellum
           DSM 2360]
 gi|281418686|ref|ZP_06249705.1| DNA replication and repair protein RecF [Clostridium thermocellum
           JW20]
 gi|166220707|sp|A3DHZ7|RECF_CLOTH RecName: Full=DNA replication and repair protein recF
 gi|125715084|gb|ABN53576.1| DNA replication and repair protein RecF [Clostridium thermocellum
           ATCC 27405]
 gi|255992223|gb|EEU02318.1| DNA replication and repair protein RecF [Clostridium thermocellum
           DSM 2360]
 gi|281407770|gb|EFB38029.1| DNA replication and repair protein RecF [Clostridium thermocellum
           JW20]
 gi|316939070|gb|ADU73104.1| DNA replication and repair protein RecF [Clostridium thermocellum
           DSM 1313]
          Length = 369

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/360 (27%), Positives = 167/360 (46%), Gaps = 26/360 (7%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +  FRNY    + F     I  G N  GKTNI+EA+   + GR  R +   ++  I    
Sbjct: 8   LKNFRNYKDETIKFSKNLNIIYGQNAQGKTNIIEAVFLCASGRSHRTSKDTELVNIDGTG 67

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
            FS    +E  EG   I I  E    + V+   IN++ ++ +  L  +L      P    
Sbjct: 68  -FSVLLDLESSEGRKKIEIDYECGKKKVVK---INEIPLKKIGNLMGNLLAVIFSPEDIL 123

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA--- 188
           I      ERRRF+D  +  + P +   +  + +++  RN LL E  +  +   ++E    
Sbjct: 124 IIKEGPSERRRFIDITLCQLKPSYFYDLQQYNKVLSQRNMLLKEIQYKRNLLDTLEVWDY 183

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSF------- 240
           +MAEL  +I   R E I  L  +  +        H+KL+  +  ++ K+  S        
Sbjct: 184 KMAELSSRIMTTRSEFIKRLCEISKKI-------HLKLTDGSEIMEIKYSPSVDLHDLSN 236

Query: 241 -CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              +K E+ ++L   R ++     TLIGPHR D  ++     + +  GS G+Q+  L+ +
Sbjct: 237 PSEIKNEFIRQLNSIRDIELKRCVTLIGPHRDDYEMELNGLNLKM-FGSQGQQRTSLLSL 295

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   +I + T   P+LLLD++ + LD  +R  L   + ++  Q F+T TDK +F++ N
Sbjct: 296 KLAEIEIIKSETDEDPVLLLDDVMSELDFKRREFLLENIRNV--QTFITCTDKELFENRN 353


>gi|163849398|ref|YP_001637442.1| DNA replication and repair protein RecF [Chloroflexus aurantiacus
           J-10-fl]
 gi|222527396|ref|YP_002571867.1| DNA replication and repair protein RecF [Chloroflexus sp. Y-400-fl]
 gi|189039618|sp|A9WDD4|RECF_CHLAA RecName: Full=DNA replication and repair protein recF
 gi|254790468|sp|B9LH68|RECF_CHLSY RecName: Full=DNA replication and repair protein recF
 gi|163670687|gb|ABY37053.1| DNA replication and repair protein RecF [Chloroflexus aurantiacus
           J-10-fl]
 gi|222451275|gb|ACM55541.1| DNA replication and repair protein RecF [Chloroflexus sp. Y-400-fl]
          Length = 392

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 175/377 (46%), Gaps = 32/377 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +  L + +FRNY  L L      T+F G N  GKT++LEAI +L+  R  R +S  ++ R
Sbjct: 3   VHHLFLRDFRNYRRLDLALAPATTLFYGPNAAGKTSLLEAIFYLATTRSPRLSSDRELVR 62

Query: 67  ------IGSPSFFSTFARVEGMEGLADISIKLETRDDR-------SVRCLQINDVVIRVV 113
                  G+P F    A VE   G   + + ++ R D        + + ++I+    R +
Sbjct: 63  WDAVGEAGTPPFARIAADVERRIGPVRLEVLVQRRADDDGQPLNGAQKLVRIDKRPARAI 122

Query: 114 DELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL 173
           D L   LR+    P+   +  G   ERRR+LD  +  +DP + R +  +++++  RN LL
Sbjct: 123 D-LIGQLRVVLFTPTDLTLVDGPPAERRRYLDITLSQLDPHYVRTLAHYQKILLQRNSLL 181

Query: 174 --------TEGYFDSS---WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFP 222
                      + D+    W   + A    L  +   A VE+ +    L  E    E+  
Sbjct: 182 RAWREQRRVPRHVDAELAYWDQELAAAGGYLLAERLRAIVELNDLAGPLYQEMSGGEDRL 241

Query: 223 HIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSR-RTLIGPHRSDLIVDYCDKA 281
            I+ + +  L    D    A +   A   F  ++ D ++R +TL GPHR DLI  +    
Sbjct: 242 QIEYAASCDLGTARDAGGLAERLLLA---FAAQRSDELARGQTLCGPHRDDLI--FTVAG 296

Query: 282 ITIA-HGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD 340
           I +  +GS G+Q+ + + + +  A L+   +G AP+LLLD++ + LD  +R  L  ++  
Sbjct: 297 INLGRYGSRGQQRSIALALKIGEAGLMRRRSGEAPVLLLDDVLSELDAQRRAHLLALIHH 356

Query: 341 IGSQIFMTGTDKSVFDS 357
              Q  +T TD S F +
Sbjct: 357 PDQQTLLTATDLSDFSA 373


>gi|257871392|ref|ZP_05651045.1| recombination protein F [Enterococcus gallinarum EG2]
 gi|257805556|gb|EEV34378.1| recombination protein F [Enterococcus gallinarum EG2]
          Length = 370

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 167/355 (47%), Gaps = 20/355 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L ++ +RNY SL L FD    IF+G+N  GKTN+LE+I  L+  +  R  S  ++
Sbjct: 1   MRLNNLQLNNYRNYESLELSFDKNLVIFLGENAQGKTNVLESIYVLAMTKSHRTTSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  +       A+V G       +I LE    +  R  ++N +  + +      L +  
Sbjct: 61  IRWDTAG-----AQVSGAVSRGHSTIPLELFLTKKGRKTKVNHIEQKKLSSYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY----FDS 180
             P    +  G    RR+F+D  +  IDP +   ++ ++ +++ RN+ L + +     D 
Sbjct: 116 FAPEDLSLVKGSPQVRRKFIDMEIGQIDPIYLYDLVQYQSVLKQRNQYLKQLFEKKQNDE 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ-----KENFPHIKLSLTGFLDGK 235
            + + +  Q+ E G KI  AR   +  L+    +  Q     KE      LS  G +   
Sbjct: 176 LYLTVLTEQLIEFGSKIIFARQRFVKRLAFWANQLHQKISDEKEVLQIEYLSSVGTVSAS 235

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
            +Q    +++++   L   +  + M + +L+GPHR DL     D+ +    GS G+Q+  
Sbjct: 236 LEQ----VQQQFKDALDQVKTREKMRQISLVGPHRDDLNFLINDRNVQ-TFGSQGQQRTT 290

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
            + + LA   L+   TG  P+LLLD++ + LD+ ++  L   + +   Q F+T T
Sbjct: 291 ALSVKLAEIDLMKEETGEYPVLLLDDVMSELDDSRQLHLLETI-EGKVQTFITTT 344


>gi|167770841|ref|ZP_02442894.1| hypothetical protein ANACOL_02194 [Anaerotruncus colihominis DSM
           17241]
 gi|167666881|gb|EDS11011.1| hypothetical protein ANACOL_02194 [Anaerotruncus colihominis DSM
           17241]
          Length = 379

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 102/369 (27%), Positives = 167/369 (45%), Gaps = 32/369 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  + I++FRN ASL L       +  GDNG GKTN +EA+   +  + FR A  A +
Sbjct: 1   MRIDRIRITDFRNIASLELALCPGANVIYGDNGQGKTNFIEAVWMCTGAKSFRGAKDAQL 60

Query: 65  TRIGSP------SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
            R G+P       F++      G E  A ++I  E R     R   +N+V ++   EL  
Sbjct: 61  VRFGAPQAAVEAGFYAA-----GREQKALLTI--EKR-----RAAALNEVPLKSAAELAG 108

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
                   P+   +      E+RRF+D  +  I P++   +  + R++  RNRLL +  +
Sbjct: 109 QFCAVVFSPAHLTLVKNGPQEKRRFIDTSICQIKPKYIHVLNQYTRVLDQRNRLLKDIMY 168

Query: 179 DSSWCSSI---EAQMAELGVKINIARVEMINALSSLIMEYV-----QKENFPHIKLSLTG 230
           ++S   ++   +A++A  G  +   R   +  L+    E        +E F         
Sbjct: 169 ETSLFDTLDIWDARLAAYGAVVIKTRATFLERLAPCAQEIYGGLAGGREKFGARYAPSLA 228

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
              G    S   +++   + L   R  D  +R T  GPHR D+ +   D     A GS G
Sbjct: 229 VDPGA---SMSEIEQRALEDLRVHRGEDIRTRMTGAGPHRDDIDLTL-DGQSARAFGSQG 284

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ + LA   LI  T G  P++LLD++ + LD  +R+ L   +   G QI MT  
Sbjct: 285 QQRSCVLALKLAECELIRETRGEYPVVLLDDVMSELDAARRDYLLNHLQ--GRQIIMTSC 342

Query: 351 DKSVFDSLN 359
           D S F  L+
Sbjct: 343 DGSDFKGLS 351


>gi|325567638|ref|ZP_08144305.1| recombination protein F [Enterococcus casseliflavus ATCC 12755]
 gi|325159071|gb|EGC71217.1| recombination protein F [Enterococcus casseliflavus ATCC 12755]
          Length = 370

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 171/371 (46%), Gaps = 13/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L++S +RNY SL L F+    IF+G+N  GKTNILE+I  L+  +  R +S  ++
Sbjct: 1   MRLNELHLSNYRNYDSLTLTFEKGLVIFLGENAQGKTNILESIYVLAMTKSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  +       AR+ G       +I LE    +  R  ++N +  + +      L +  
Sbjct: 61  IRWDTEG-----ARISGSVSRGRSTIPLELFLSKKGRKTKVNHIEQKKLSSYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  IDP +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQVRRKFLDMEIGQIDPIYLYDLVQYQSVLKQRNQYLKQLNEKKQTDE 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQ 238
            +   +  Q+   G KI +AR   +  L+    +  QK  +    +++     + G+   
Sbjct: 176 IYLDVLTEQLVAFGSKIILARQRFVQRLAYWANQLHQKISQGKETLQIDYLSNVPGEAT- 234

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           S   +++++ K L   +  +   + TL GPHR DL     +K +    GS G+Q+   + 
Sbjct: 235 SLEEIQQQFVKALAQVKDRERFRQVTLAGPHRDDLDFLINEKNVQ-TFGSQGQQRTTALS 293

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + LA   L+   TG  P+LLLD++ + LD+ ++  L   +         T T + V D +
Sbjct: 294 VKLAEIDLMKEETGEYPVLLLDDVMSELDDSRQLHLLETIEGKVQTFLTTTTLEHVKDKM 353

Query: 359 NETAKFMRISN 369
           +  A+   +  
Sbjct: 354 SVEAEIFYVEQ 364


>gi|291548765|emb|CBL25027.1| recF protein [Ruminococcus torques L2-14]
          Length = 363

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 104/358 (29%), Positives = 161/358 (44%), Gaps = 28/358 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L L FD +  I  GDN  GKTNILEA+      +  R     D+ +
Sbjct: 3   IKSLKLKNYRNYDLLDLTFDPKTNILYGDNAQGKTNILEALYLSGTTKSHRGTKDRDMIQ 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   S   T    +G+    D+ +K       S + + I+ V IR   EL   +   + 
Sbjct: 63  FGYDESHLETVVEKKGIIFQIDMHLK-----KNSPKGIAIDKVPIRRASELFGIVHFVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS---- 181
            P    I       RRRF+D  +  +D  +   + ++ R++  RN LL + Y  +     
Sbjct: 118 SPEDLNIIKEGPAGRRRFIDLELSQLDKIYLNNLSNYNRIINQRNSLLKDIYGSNQQHLL 177

Query: 182 -----WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF 236
                W    + Q+A  G K+   R E +  ++ +I E   +      +LSLT      +
Sbjct: 178 ETLDIW----DMQLAAYGTKVLDRRKEFVRQVNEIISEIHFRLTGGKERLSLT------Y 227

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           + S   +  E A K    R+ D   + T +GPHR DL     D  I    GS G+Q+   
Sbjct: 228 ESSIGEMSMEQALK--KNRERDLRMKSTSVGPHRDDLCFLSGDLDIR-KFGSQGQQRTAA 284

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           + + LA   L+    G  PILLLD++ + LD++++N L   + DI + I  TG D+ V
Sbjct: 285 LSLKLAEIELVKRIIGDTPILLLDDVLSELDKNRQNYLLDSIHDIQTVITCTGLDEFV 342


>gi|304439075|ref|ZP_07398994.1| recombination protein F [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304372434|gb|EFM26021.1| recombination protein F [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 361

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 101/366 (27%), Positives = 176/366 (48%), Gaps = 13/366 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  FRNY  L+L+      +FVG N  GKTN++E+I+    G  FR +  A++
Sbjct: 1   MKLKSLQLINFRNYEDLKLIPSETLNLFVGKNAQGKTNLIESIAVSISGSSFRTSKNAEM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             +G+ S  +  + +E    L   SI +    D S     IN  +  + D   K      
Sbjct: 61  IELGNKS-SNIISEIEKKGRLEKRSIYI----DSSGIKHSINGKITTLKD-FTKSSAAVI 114

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P    I      +RRR+LD ++  +D  +R  +  +++++  +N+ L     D +   
Sbjct: 115 FKPDDLYIIKNSPSDRRRYLDDIISNLDSIYRYNLNSYKKVLYEKNKALKVNNND-TLLD 173

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
             + Q+++   +I I R+ +I  L S   EY +  +    K++    ++ K  ++   L 
Sbjct: 174 IYDRQLSKFASEILIKRLNIIKILESYAKEYYKTLSGCDFKITYLSTINLK--KTREELV 231

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           EE+   L   R +D     T IGPHR D+     DK++    GS GE +  ++ + LA  
Sbjct: 232 EEFLNALRSRRHIDKRKLYTSIGPHRDDIDFKINDKSVK-NFGSQGEIRSSILVLKLAEL 290

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS-LNETAK 363
           + I N     P+LLLD++ + LD  +R+AL   +   G Q F+T T+  + DS +++ +K
Sbjct: 291 KYILNVLNITPVLLLDDVLSELDSTRRDALLTSIE--GIQTFITSTNSEIIDSYIDDNSK 348

Query: 364 FMRISN 369
              I N
Sbjct: 349 VFMIEN 354


>gi|163790922|ref|ZP_02185345.1| recombination protein F [Carnobacterium sp. AT7]
 gi|159873764|gb|EDP67845.1| recombination protein F [Carnobacterium sp. AT7]
          Length = 373

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 175/381 (45%), Gaps = 32/381 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K +++S +RNY    ++F     +F+G+N  GKT+++EAI  L+  R  R A+  +  R
Sbjct: 3   LKEIHLSNYRNYEHAEVIFSKGINVFLGENAQGKTSLMEAIYVLAMARSHRTANDKETIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                +   FARV G     + S  LE    +  +  + N +  + + E   +L +    
Sbjct: 63  -----WDQDFARVSGRIQKKNTSFPLEISISKKGKKAKFNHLEQKKLSEYIGNLNVILFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DSSW 182
           P    +  G    RR+FLD  +  + P +   ++ ++ L++ RN  L +       D ++
Sbjct: 118 PEDLSLVKGSPSVRRKFLDMEMGQMSPIYLHHLVQYQHLLKQRNSYLKQLSLKKEKDLTF 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
              +  Q+AE G  I + R   +  L +   + V  E     +L   G+         C+
Sbjct: 178 LDILTEQLAEYGAAILLERFSFVKKLENW-AKPVHSEISKQKELLEIGYA--------CS 228

Query: 243 LK---EEYAKKLF--------DGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
           LK   E   ++L+         GR+ +   R T+ GPHR DL      + +   +GS G+
Sbjct: 229 LKITDETSKEQLYSDLMNAFAQGRQRELEQRTTIFGPHRDDLKFTVNGRNVQ-TYGSQGQ 287

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           Q+   + + LA   L+   TG  P+LLLD++ + LD++++  L + + +   Q F+T T 
Sbjct: 288 QRTTALSVKLAEIDLMKEMTGEYPVLLLDDVLSELDDERQTHLLKAIQN-KVQTFLTTTS 346

Query: 352 -KSVFDSLNETAKFMRISNHQ 371
              +  ++ ET K   I N Q
Sbjct: 347 LDGIKKNMLETPKIFLIDNGQ 367


>gi|325288204|ref|YP_004264385.1| DNA replication and repair protein RecF [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324963605|gb|ADY54384.1| DNA replication and repair protein RecF [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 366

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 166/364 (45%), Gaps = 15/364 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L    FRNY+   + F     I VG NG GKTN+LE I +L  G+ +R    +++  
Sbjct: 3   IHNLYFKNFRNYSEQEITFTNGINILVGSNGQGKTNVLEGIYYLLMGKSYRVNQESELIY 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G  +F+   A  E  E        LE+  ++  + ++IN +  + + E    + + +  
Sbjct: 63  WGQKNFYLR-ANFEAYER----KYCLESYYEKGKKAIKINQLACQKLSEYVGMINVVFFT 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I     +ERRRF+D ++  + P H   +  + R+++ ++ LL      ++    +
Sbjct: 118 PDDLNIIKSGPLERRRFIDLLLIQVKPAHISLLNTYIRILKQKSILLKRSLNKAAANDQL 177

Query: 187 ---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK--FDQSFC 241
                Q+ E G ++   R EM   L +   +   K    H  + L     G+   D++  
Sbjct: 178 LVWNEQLLETGSRVIRNRYEMTEKLQNQCGKMFSKVFGCHENMDLQYVSLGRKSLDEALA 237

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
              E   K+    R  +   R  L+GPHR D+IV+   ++    + S G+Q+ +++ + L
Sbjct: 238 YFPEALEKQ----RDAEIERRAVLVGPHRDDIIVNINGRSARY-YASQGQQRSLVLCLKL 292

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           A   +I+      PILLLD++ + LDE +R  L   +++   Q  +T TD    +   + 
Sbjct: 293 AEMEIINKEKEEYPILLLDDVLSELDEGRREYLMEYISNSNKQTMITTTDLGQIEKQKDP 352

Query: 362 AKFM 365
           A ++
Sbjct: 353 AVYI 356


>gi|166032887|ref|ZP_02235716.1| hypothetical protein DORFOR_02608 [Dorea formicigenerans ATCC
           27755]
 gi|166027244|gb|EDR46001.1| hypothetical protein DORFOR_02608 [Dorea formicigenerans ATCC
           27755]
          Length = 361

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 102/379 (26%), Positives = 170/379 (44%), Gaps = 31/379 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KIK L +  FRNY  L L FD    IF GDN  GKTNILEA+      +  R +   D+
Sbjct: 1   MKIKSLKLKNFRNYELLNLEFDDSTNIFYGDNAQGKTNILEAVYLSGTTKSHRGSKDRDM 60

Query: 65  TRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R G+  S         G++   D+ +K         + + IN + IR   EL   + + 
Sbjct: 61  IRFGAEESHIEVIVEKRGIQDQIDMHLK-----KNRPKGVAINKIPIRKAGELFGIVNLV 115

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           +  P    I       RR+F+D  +  +D  +   + ++ R++  RN LL +  +     
Sbjct: 116 FFSPEDLNIIKNGPAGRRKFIDLELSQLDKVYFNHLSNYSRVVNQRNHLLKDSAYRQDAM 175

Query: 184 SSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK----- 235
            +++    Q+ + G  I   R + ++ ++ ++           I   LTG   GK     
Sbjct: 176 ETLDIWDLQLVQYGNAIIARRKQFVDEMNEIV---------SGIHKKLTG---GKEEIRL 223

Query: 236 -FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
            ++ S   +  E A ++   R+ D   + T +GPHR D+     +  I    GS G+Q+ 
Sbjct: 224 IYEPSTKNMSLEQALEM--NRQRDIRMKSTSVGPHRDDVCFMVGNLDIR-RFGSQGQQRT 280

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
             + + LA   L+   TG  P+LLLD++ + LD+ ++N L   + DI + I  TG D+ V
Sbjct: 281 AALSLKLAEIELVKRVTGDTPVLLLDDVLSELDKHRQNYLLDSIHDIQTLITCTGVDEFV 340

Query: 355 FDSLNETAKFMRISNHQAL 373
                E  K   + N Q +
Sbjct: 341 NHRF-EVNKVFHVQNGQVI 358


>gi|67809989|gb|AAY81983.1| recombinase F [Wolbachia pipientis]
          Length = 320

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 98/327 (29%), Positives = 157/327 (48%), Gaps = 15/327 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV-T 65
           IK L +  FR++++  L  D    +  G NG+GKTNILEAIS L+   G ++A  +++  
Sbjct: 6   IKKLKLHNFRSHSNFELDSDDSSVVITGKNGIGKTNILEAISLLAKSNGMKKAKASEIQN 65

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
           R  +  +   +    GM+     SI +    D+  + +QI+         L K   + WL
Sbjct: 66  RFSNEDWVVHYDFFNGMDF---NSIGIAKSFDK--KLIQIDGKTQSSYSSLYKISNVIWL 120

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
           +P MD +      +R +FLDR+V   +  +    +   +  R R++LL E   D +W SS
Sbjct: 121 IPQMDYVLLNSPSDRLKFLDRIVSLFEENYTCCYMKHRKAKRERSKLLRENTLDKNWLSS 180

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +E  MA   V I   R  ++  L   I  +   E FP   L  +  L      +     E
Sbjct: 181 LENIMAVNAVSILRMRSSVLKTLQDTIDNH-SGELFPKASLKFSSQL------TLDDTAE 233

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDK-AITIAHGSTGEQKVVLVGIFLAHA 304
            +  +L + R+ DS++ R   G H  +  V +C K  + I   STGEQK++L+ I L+  
Sbjct: 234 YFQNRLKENREKDSLTGRVTFGVHNDNFRV-FCQKRNVPINLCSTGEQKLLLLSIILSSV 292

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKR 331
           +        AP+LLLD+I +HLD+  R
Sbjct: 293 KARCIHYNKAPLLLLDDIMSHLDKHYR 319


>gi|319945993|ref|ZP_08020242.1| recombination protein F [Streptococcus australis ATCC 700641]
 gi|319747801|gb|EFW00046.1| recombination protein F [Streptococcus australis ATCC 700641]
          Length = 362

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 104/374 (27%), Positives = 172/374 (45%), Gaps = 24/374 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K ++I +FRNY  + L F +   IF+G N  GKTN+LE+I FL+  R  R  S  D+  
Sbjct: 3   LKSIHIQKFRNYKDVDLQFHSGLNIFLGQNAQGKTNLLESIYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F      V G+      SI LE       R  +IN +    +     ++ +    
Sbjct: 63  FQEEQF-----TVSGILEKKTGSIPLEISLSSKGRVTKINHLKQSKLSTYIGNMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  + P +   +  +  +++ RN  L T    D ++   
Sbjct: 118 PEDLQLVKGSPALRRKFIDIDLGQMKPVYLSDLTAYHHVLKQRNSYLKTATTVDPTFLDV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG-FLDGKFDQSFCALK 244
           ++ Q+A+ G ++ I R + +  L     EY  +E   H ++S     L  ++D S     
Sbjct: 178 LDEQLADYGSRVCIHRKDFLKKL-----EYFGQEK--HFEISNQAEKLTIRYDSSIPFQD 230

Query: 245 EEYAKKLF-----DGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           EE  ++ F     + R  D + + T +GPHR D+     D   T   GS G+ + V++ I
Sbjct: 231 EETLRQTFIILLRENRTKDLIKKTTSVGPHRDDITFYINDMNATF--GSQGQHRSVVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSL 358
            LA   LI + T   PILLLD++ + LD +++  L  +++ DI  Q F+T T       L
Sbjct: 289 KLAEISLIESLTKEKPILLLDDVMSELDNNRQLHLLEVISRDI--QTFITTTTLDHLKDL 346

Query: 359 NETAKFMRISNHQA 372
            E  K   I + Q 
Sbjct: 347 PEDLKIFNIHSGQV 360


>gi|163814984|ref|ZP_02206371.1| hypothetical protein COPEUT_01137 [Coprococcus eutactus ATCC 27759]
 gi|158449667|gb|EDP26662.1| hypothetical protein COPEUT_01137 [Coprococcus eutactus ATCC 27759]
          Length = 369

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 100/382 (26%), Positives = 175/382 (45%), Gaps = 33/382 (8%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M   + I+ + ++ +RNY  L++ F     I  G+N  GKTNILE+I   +  +  R   
Sbjct: 1   MVKDMYIESIELNNYRNYRKLKVEFGKNTNILYGNNAQGKTNILESIYMAATTKSHRGTK 60

Query: 61  YADVTRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSV-RCLQINDVVIRVVDELNK 118
             D+ RIG   S    F R        D+S K++    +S  + + I+ + IR   EL  
Sbjct: 61  DRDIIRIGEDESHIRLFLRKR------DVSHKIDMHLRKSKNKGVAIDGIAIRRATELYG 114

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF 178
            L + +  P    I      ERRRF+D  +  I   + + +  + +++  RN LL + Y+
Sbjct: 115 LLNVIFFSPEDLSIIKNGPAERRRFMDLELCQISRLYYQNLASYNKILNQRNNLLKQIYY 174

Query: 179 DSSWCSSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK 235
           + S   +++    Q+ + G KI   R   I+ ++ +I +   +      KL +       
Sbjct: 175 NKSLIDTLDVWNIQLVDYGSKIIKERKNFIDMMNDIICDIHSRLTGGREKLEIV------ 228

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGSTGEQK 293
               +   +  +   L +  + D     T  GPHR D+  +++  D      +GS G+Q+
Sbjct: 229 --YEYNVNENNFEDVLREKLETDLKYSSTQAGPHRDDISFLINGIDAR---KYGSQGQQR 283

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK- 352
            V + + +A  +L+       PILLLD++ + LD D+RNAL   + DI + I  TG D+ 
Sbjct: 284 TVALSLKMAEIKLVKKIISDNPILLLDDVMSELDTDRRNALIDEIKDIQTIITCTGYDEF 343

Query: 353 --------SVFDSLNETAKFMR 366
                   +V+  +N TA  +R
Sbjct: 344 IKEQVIINNVYSVVNGTATRVR 365


>gi|325663386|ref|ZP_08151836.1| hypothetical protein HMPREF0490_02577 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331086960|ref|ZP_08336036.1| hypothetical protein HMPREF0987_02339 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|325470840|gb|EGC74070.1| hypothetical protein HMPREF0490_02577 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330409621|gb|EGG89060.1| hypothetical protein HMPREF0987_02339 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 361

 Score =  120 bits (300), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 167/359 (46%), Gaps = 32/359 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY  L + FD    IF GDN  GKTNILEA+      +  R     D+ +
Sbjct: 3   IKSLKLKNFRNYDFLSIEFDHATNIFYGDNAQGKTNILEAVYLTGTTKSHRGTKDRDLIQ 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  S   T    +G+E   D+ +K       S + + IN + IR   EL   + + + 
Sbjct: 63  FGNEESHIETVIEKDGIEFQVDMHLK-----KNSPKGIAINKIPIRKASELFGLVHLVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   + ++ R++  RNRLL +       C +
Sbjct: 118 SPEDLNIIKNGPAERRRFMDLELSQLDKVYLSDLANYNRIINQRNRLLKD-------CQN 170

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQK------ENFPHIKLSLTGFLDG---KF 236
                AEL   +++  +++I    S IME  +K      E    I   LTG  +     +
Sbjct: 171 ----RAELNEMLDLWDMQLI-QYGSRIMERREKFLEEVNEIISGIHYKLTGGRETITISY 225

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVV 295
           +++   +  E+   L   R+ D   + T  GPHR D+   +  K I I   GS G+Q+  
Sbjct: 226 EKNIGQM--EFESVLKKNRERDIRMKSTSAGPHRDDIC--FLTKDIDIRKFGSQGQQRTA 281

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            + + L+   ++       P+LLLD++ + LD++++N L   + DI + I  TG D+ V
Sbjct: 282 ALSLKLSEIEIVRKLIKDTPVLLLDDVLSELDKNRQNYLLDSIHDIQTLITCTGVDEFV 340


>gi|332980608|ref|YP_004462049.1| DNA replication and repair protein RecF [Mahella australiensis 50-1
           BON]
 gi|332698286|gb|AEE95227.1| DNA replication and repair protein RecF [Mahella australiensis 50-1
           BON]
          Length = 363

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 175/375 (46%), Gaps = 25/375 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L ++++RNY ++++ F+    +F GDNG GKTNILEAI   S GR  R +   D+ R
Sbjct: 3   IKELTLTDYRNYNNVKINFNIGINVFWGDNGAGKTNILEAIYLTSAGRSHRTSRDKDMIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G+   F    +V   +G  D+++ +     + ++   +N   I  + +L   +      
Sbjct: 63  QGAQDAFINI-KVIRKDGEIDVNMMIPQNGSKRIK---VNGKYINRIAQLMGIVTAVIFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE---GYFDSSWC 183
           P   ++      ERRRF+D  +  I P +   +  + +++  RN+ L +   G+      
Sbjct: 119 PEDLKLVKEGPEERRRFIDIFISQIKPDYLYNLQKYYKILENRNKTLKDIKYGHASRDLL 178

Query: 184 SSIEAQMAELGVKINIAR---VEMINALSSLIMEYV--QKENFPHIKLSLTGFLDGKFDQ 238
           +    Q+A +G ++   R   V+ I A  S I EY+   KEN   ++   T  L G   Q
Sbjct: 179 AVWNEQLAYIGTELLEQRLYFVDKICAEVSDIHEYITDHKENLK-LRYKSTLSLSGNIKQ 237

Query: 239 SF-CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
           +F  AL + +   +  G         T IGPHR D+I+   D  +   +GS G+Q+   +
Sbjct: 238 NFISALNQRFDADINMG--------TTTIGPHRDDMIILVNDMDMR-YYGSQGQQRTAAL 288

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
            + L    +  +  G +P+LLLD++ + LD  ++N L   +     Q  MT   KS +  
Sbjct: 289 SLKLGQLEVTEDLIGESPVLLLDDVMSELDIMRQNMLMSYMKRY--QTMMTCIRKSDYLE 346

Query: 358 LNETAKFMRISNHQA 372
             +   F  + N Q 
Sbjct: 347 QYDKKTFFYVENGQV 361


>gi|323342251|ref|ZP_08082483.1| recombination protein F [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463363|gb|EFY08557.1| recombination protein F [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 361

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 95/366 (25%), Positives = 175/366 (47%), Gaps = 14/366 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L + +FRN ++L L F+    +FVGDNG GKTNI+E++ +LS GR FR +S   +
Sbjct: 1   MKVKNLELKQFRNISNLNLSFNKNINVFVGDNGQGKTNIIESLVYLSSGRSFRVSSDEYL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            + G+  F S  A +E      ++ + L +    + + LQ+N   ++ + E      +  
Sbjct: 61  IQYGN-EFLSVIADIEDQNNTQNLKVVLSS----AGKYLQVNQQPLKKMTEFIGRCNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P     +S    +RRR +D  +  +  R+  ++    +L+  RN  L     D  +  
Sbjct: 116 FNPEDINFYSNSPRKRRREIDFELGKMSKRYLNQLSLSNKLLSERNAYLKNKNVDQDYLE 175

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGKFDQSFCA 242
            +  ++ +  + I   R + ++AL+ +I  Y     ++  HI L     +  + D     
Sbjct: 176 ILTEKLVDASILIIEMRAKFVHALNPIINHYYHLLSDSKDHIVLHYKAPISLEGD----- 230

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           LKE+   K+ D  + D   + T  G HR D I    D  + +   S G+++++++   LA
Sbjct: 231 LKEQLLSKMQDSFQRDCDFKVTQNGIHRDDFIFMINDIPV-VNVSSQGQKRMLIIAFKLA 289

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
              LI  +    PIL LD++ + LD  +R  +  ++ +   Q+F+T TD     S  + +
Sbjct: 290 IVELIFQSRKTYPILCLDDLFSELDNVRRERVLNVLHE-EMQVFITTTDLDYVKSKRDKS 348

Query: 363 KFMRIS 368
            F  +S
Sbjct: 349 VFKVVS 354


>gi|289449549|ref|YP_003474443.1| putative DNA replication and repair protein RecF [Clostridiales
           genomosp. BVAB3 str. UPII9-5]
 gi|289184096|gb|ADC90521.1| putative DNA replication and repair protein RecF [Clostridiales
           genomosp. BVAB3 str. UPII9-5]
          Length = 382

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 179/360 (49%), Gaps = 25/360 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +  FRNY  L   F  +  +F G NG GKTN+LEAI   + GR  R +  AD+ +
Sbjct: 3   INKLELENFRNYDHLTASFIPEINVFYGFNGQGKTNLLEAIYLCTCGRSHRTSRDADLIK 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQI--NDVV--IRVVDELNKHLRI 122
                +      +   E    +SI  +  +  S R  +I  +D +   R+VD +     +
Sbjct: 63  FEQLHYQVLIEFIPQDEYCETLSIAYKKDNFSSARGKRIIKHDGIELTRIVDLMGIFHAV 122

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
            +    +  +  G  + RRRFLD ++  ID  +  ++  F ++++ RN++L +   +S W
Sbjct: 123 IFAPEDLQLLKDGPGI-RRRFLDILISQIDKLYFIKLQQFVKIIQQRNKMLKDKNTNSKW 181

Query: 183 CSSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
            S ++    Q+AEL   I   R++++N +S +  E+ Q+ +      S +  +D K++ +
Sbjct: 182 QSLMDIWDFQLAELVTYIISKRIQVLNEISDMTKEFYQQIS------SGSEMIDLKYECT 235

Query: 240 FCA----LKEEYAKKLFD----GRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
           F       KE+  + ++D     R+ D     T +GPH  D+     +K   +   S G+
Sbjct: 236 FKTNLKLEKEKVVQNIYDELQKQRQNDLYRGSTSLGPHHDDMQFFLNNKQAKLV-ASQGQ 294

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            + +++ + LA    ++  TG  P+LLLD++ + LD+++RNAL   +    +Q+F+T T+
Sbjct: 295 TRSIVLALKLAELECLTEKTGIRPVLLLDDVMSELDQNRRNALIGAMK--SAQVFVTCTE 352


>gi|257866279|ref|ZP_05645932.1| recombination protein F [Enterococcus casseliflavus EC30]
 gi|257873205|ref|ZP_05652858.1| recombination protein F [Enterococcus casseliflavus EC10]
 gi|257800237|gb|EEV29265.1| recombination protein F [Enterococcus casseliflavus EC30]
 gi|257807369|gb|EEV36191.1| recombination protein F [Enterococcus casseliflavus EC10]
          Length = 370

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 171/371 (46%), Gaps = 13/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L++S +RNY SL L F+    IF+G+N  GKTNILE+I  L+  +  R +S  ++
Sbjct: 1   MRLNELHLSNYRNYDSLTLTFEKGLVIFLGENAQGKTNILESIYVLAMTKSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  +       AR+ G       +I LE    +  R  ++N +  + +      L +  
Sbjct: 61  IRWDTEG-----ARISGSVSRGRSTIPLELFLSKKGRKTKVNHIEQKKLSSYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  IDP +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQVRRKFLDMEIGQIDPIYLYDLVQYQSVLKQRNQYLKQLNEKKQTDE 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQ 238
            +   +  Q+   G KI +AR   +  L+    +  QK  +    +++     + G+   
Sbjct: 176 IYLDVLTEQLVAFGSKIILARQRFVQRLAYWANQLHQKISQGKETLQIDYLSNVPGEAS- 234

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +   +++++ K L   +  +   + TL GPHR DL     +K +    GS G+Q+   + 
Sbjct: 235 TLEEIQQQFVKALAQVKDRERFRQVTLAGPHRDDLDFLINEKNVQ-TFGSQGQQRTTALS 293

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + LA   L+   TG  P+LLLD++ + LD+ ++  L   +         T T + V D +
Sbjct: 294 VKLAEIDLMKEETGEYPVLLLDDVMSELDDSRQLHLLETIEGKVQTFLTTTTLEHVKDKM 353

Query: 359 NETAKFMRISN 369
           +  A+   +  
Sbjct: 354 SVEAEIFYVEQ 364


>gi|262281653|ref|ZP_06059422.1| recombination protein F [Streptococcus sp. 2_1_36FAA]
 gi|262262107|gb|EEY80804.1| recombination protein F [Streptococcus sp. 2_1_36FAA]
          Length = 361

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 168/365 (46%), Gaps = 12/365 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  FRNY    + F +   +F+G N  GKTNILE+I FL+  R  R  S  D   
Sbjct: 3   LKSLTLKHFRNYQDAEINFHSGLNVFLGQNAQGKTNILESIYFLALTRSHRTRSDKDFIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F     +V G+      +I L+       R  +IN +    + +    + +    
Sbjct: 63  -----FQEKDLKVSGILEKKTGTIPLDIELTAKGRITKINHLKQNRLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPLYLADLSNYNHVLKQRNSYLKNSQKIDENFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLT-GFLDGKFDQSFCALK 244
           ++ Q+ E G ++   R++ +  L     E  +  +    K +LT  +L     Q   +++
Sbjct: 178 LDEQLIEYGCRVVKHRLDFLKKLEIFAQE--KHLDISQKKETLTIDYLSSVPLQDIDSIE 235

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E + + L   RK D   + T +GPHR D  + +    +   +GS G+ + V++ + LA  
Sbjct: 236 ESFRQSLSKNRKRDLFKQNTGVGPHRDD--IAFFINQMDANYGSQGQHRSVVLSLKLAEI 293

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           +LI N T  +PILLLD++ + LD D++  L   ++    Q F+T T      +L +  K 
Sbjct: 294 KLIENITKESPILLLDDVMSELDNDRQLKLLETISQ-EIQTFITTTTLEHLKNLPKDIKI 352

Query: 365 MRISN 369
             ISN
Sbjct: 353 FEISN 357


>gi|108763273|ref|YP_628527.1| DNA replication and repair protein RecF [Myxococcus xanthus DK
           1622]
 gi|122981391|sp|Q1DFP6|RECF_MYXXD RecName: Full=DNA replication and repair protein recF
 gi|108467153|gb|ABF92338.1| DNA replication and repair protein RecF [Myxococcus xanthus DK
           1622]
          Length = 380

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 93/355 (26%), Positives = 163/355 (45%), Gaps = 11/355 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L++ +FRN   ++L   A  TI VG NG GKTN+LEA+ FL+  +  R    +++
Sbjct: 1   MRLLALHVHDFRNLPQVQLTPSAHATIAVGQNGQGKTNLLEALYFLATLKPLRAGRLSEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS       ARV G   L     ++        R   ++      +++    + +  
Sbjct: 61  VRWGSQG-----ARVTGRFLLKGAEREIAVEVGGGTRQAFVDGKKASSLEDYFGGVSVVA 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWC 183
             P    +  G    RR FLDR VF   P   R   ++ R ++ RNRLL EG+  D+ + 
Sbjct: 116 FTPDDLEVVKGGPDSRRGFLDRAVFNRFPAFLRESREYARALKNRNRLLREGHTVDAVYL 175

Query: 184 SSIEAQMAELGVKINIARVEMINALSS---LIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            + +  +A+ G +I   R  ++  L+         + +   P +       L+G F  + 
Sbjct: 176 EAYDETLAKAGARIYSRRRALMAELAPRAQATFASIGRTVDPAVYNYRPAHLEGDFAAAD 235

Query: 241 CALKEEYAKKLFDGRKMDSMSRR-TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
                   ++    R    M R  T +GPH  D+ V    ++   A+ S G+Q+ +++G 
Sbjct: 236 ETALAAMLRESLSARLRRDMERGFTSVGPHSDDVSVTLGGRSAR-AYASQGQQRALVLGW 294

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            +A    +    GF P+LLLD++S+ LD ++   L   +   G+Q+ +T TD S+
Sbjct: 295 KIAEIENLEAAMGFLPLLLLDDVSSELDPERNAYLMGYLAQSGAQVVLTTTDGSL 349


>gi|1107710|emb|CAA61549.1| recF [Lactococcus lactis]
          Length = 357

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 157/330 (47%), Gaps = 19/330 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K + +  FRNY  L+L F     IF+G N  GKTNILEAI FL+  R  R +   ++
Sbjct: 1   MKLKAIELKNFRNYEELKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                 S+     +V G+   A  +I LE +     R  + N +    + +    L+I  
Sbjct: 61  I-----SWSQQEMKVSGVGEKAHATIPLEVQLSPKGRIAKANHLKENRLADYIGQLKILM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT--EGYFDSSW 182
             P    +  G    RR+F+D  +  I   +    + + R ++ RN  L   +   D ++
Sbjct: 116 FAPENLELVKGSPATRRKFMDIELGQIHAVYLYDSMRYNRALKERNAYLKFDKDKIDKNF 175

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            S ++ Q+AE G KI + R   I+ L   +      E   H K +L       ++Q+   
Sbjct: 176 LSVLDGQLAEHGNKIMLERQNFIDKLE--VHAKKIHEQLTHGKENLKII----YNQN--- 226

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVGIFL 301
           +K +++K+L   +  D    +T +GPHR DL   +    I +A  GS G+Q+ V + I L
Sbjct: 227 VKTDFSKELLSRQDHDIFRHQTSVGPHRDDL--QFFINEINVADFGSQGQQRTVALSIKL 284

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKR 331
           A   LI   TG  PILLLD++ + LD  ++
Sbjct: 285 AEIDLILEETGEYPILLLDDVMSELDNHRQ 314


>gi|51316445|sp|Q899S7|RECF_CLOTE RecName: Full=DNA replication and repair protein recF
          Length = 367

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/379 (24%), Positives = 178/379 (46%), Gaps = 26/379 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K+L +  FRNY  L +  D    +F+G+N  GKTN+LE+I + S GR  R +   ++ +
Sbjct: 3   VKYLKLINFRNYKELNIELDKNINVFIGNNAQGKTNVLESIYYASIGRSHRTSKDKELIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              S S+   +   E ++   +I +  E +     + + +N + I  + EL   L +   
Sbjct: 63  WQESNSYIKIYVAKERLDKTIEIRVLKEGK-----KAINVNSININKLSELFGILNVVIF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD-SSWCS 184
            P    I       RR+FLD  +  +  ++   ++ +++++  RN LL +G  +  +   
Sbjct: 118 SPEDLSIVKESPSFRRKFLDIELSKLSKQYYYNLVQYQKVLNERNMLLKKGGDEVPNIIG 177

Query: 185 SIEAQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHI-KLSLTGFLDGKF 236
             + Q+A  G  I   R + +  L+ +       I    ++ +F ++  +      DGK 
Sbjct: 178 VYDEQLARFGSNIIREREKYLKKLNDIGKKIHLEITSDKEEISFTYLSSIKNKNMDDGKI 237

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           ++ F        +++   R  D   R T +GPHR D +++  +   T ++GS G+Q+   
Sbjct: 238 EEIFL-------QEIIKNRNSDIEKRYTSVGPHRDDFLIN-INNVNTRSYGSQGQQRTAT 289

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + I  A   +I +  G  P+LLLD++ + LD  ++  +   + DI + I  TG + ++  
Sbjct: 290 LTIKFASLDIIKDEIGEYPVLLLDDVLSELDSSRQKYILSSIRDIQTIITCTGIE-NIKK 348

Query: 357 SLNETAKFMRISNHQALCI 375
            L   AK  ++ N +  CI
Sbjct: 349 YLKNDAKIFKVENGE--CI 365


>gi|18308986|ref|NP_560920.1| recombination protein F [Clostridium perfringens str. 13]
 gi|110801062|ref|YP_694479.1| recombination protein F [Clostridium perfringens ATCC 13124]
 gi|110802319|ref|YP_697355.1| recombination protein F [Clostridium perfringens SM101]
 gi|168207733|ref|ZP_02633738.1| DNA replication and repair protein RecF [Clostridium perfringens E
           str. JGS1987]
 gi|168212007|ref|ZP_02637632.1| DNA replication and repair protein RecF [Clostridium perfringens B
           str. ATCC 3626]
 gi|168215270|ref|ZP_02640895.1| DNA replication and repair protein RecF [Clostridium perfringens
           CPE str. F4969]
 gi|168218303|ref|ZP_02643928.1| DNA replication and repair protein RecF [Clostridium perfringens
           NCTC 8239]
 gi|169343436|ref|ZP_02864436.1| DNA replication and repair protein RecF [Clostridium perfringens C
           str. JGS1495]
 gi|182627052|ref|ZP_02954777.1| DNA replication and repair protein RecF [Clostridium perfringens D
           str. JGS1721]
 gi|20978577|sp|Q8XPF9|RECF_CLOPE RecName: Full=DNA replication and repair protein recF
 gi|122956936|sp|Q0SWY1|RECF_CLOPS RecName: Full=DNA replication and repair protein recF
 gi|123345112|sp|Q0TV61|RECF_CLOP1 RecName: Full=DNA replication and repair protein recF
 gi|18143661|dbj|BAB79710.1| DNA repair and genetic recombination protein [Clostridium
           perfringens str. 13]
 gi|110675709|gb|ABG84696.1| DNA replication and repair protein RecF [Clostridium perfringens
           ATCC 13124]
 gi|110682820|gb|ABG86190.1| DNA replication and repair protein RecF [Clostridium perfringens
           SM101]
 gi|169298388|gb|EDS80477.1| DNA replication and repair protein RecF [Clostridium perfringens C
           str. JGS1495]
 gi|170660924|gb|EDT13607.1| DNA replication and repair protein RecF [Clostridium perfringens E
           str. JGS1987]
 gi|170710063|gb|EDT22245.1| DNA replication and repair protein RecF [Clostridium perfringens B
           str. ATCC 3626]
 gi|170713334|gb|EDT25516.1| DNA replication and repair protein RecF [Clostridium perfringens
           CPE str. F4969]
 gi|177907578|gb|EDT70217.1| DNA replication and repair protein RecF [Clostridium perfringens D
           str. JGS1721]
 gi|182379694|gb|EDT77173.1| DNA replication and repair protein RecF [Clostridium perfringens
           NCTC 8239]
          Length = 361

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 171/374 (45%), Gaps = 21/374 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY +L +       +F+GDN  GKTN++EAI +    +  R     ++  
Sbjct: 3   IKSLQLINYRNYENLSIKLCPNVNVFIGDNAQGKTNVIEAIYYCGFAKSHRTNRDKELIE 62

Query: 67  IGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                +F       + ++ + D++I    +D +  + + IN + I  + EL     +   
Sbjct: 63  WNKDRAFIRLDVHKDRLDKIIDVNI---LKDGK--KAISINSIKISKIGELIGTFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I       RRRF+D  +  ++ R+   ++ + +++  RN +L     +      
Sbjct: 118 SPEDLKIVKESPGIRRRFIDMELSQLNKRYYHNLVQYNKVLHERNLVLKNKNINEEMLDI 177

Query: 186 IEAQMAELG---VKINIARVEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGKFDQSF 240
            + Q+A+ G   +K  +  +E +N  S  I + +   KE      +S    LD       
Sbjct: 178 YDIQLAQYGENIIKTRLKYIEQLNKYSKEIHKEITSGKEEIEFKYISTVKDLDN------ 231

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +K+   K L   RK D   R T IGPHR D  + Y +      +GS G+Q+  ++ I 
Sbjct: 232 --IKDSMIKLLEQNRKKDIDKRATSIGPHRDDFNI-YLNNIDAKIYGSQGQQRTSVLTIK 288

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
            A  ++I   TG  P+LLLD++ + LD +++  +   + +I + I  TG +  +   L+E
Sbjct: 289 FASLKIIKEITGEYPVLLLDDVLSELDFNRKRYVLTSIKNIQTVITCTGIE-DLTSYLDE 347

Query: 361 TAKFMRISNHQALC 374
            +K  R+ N +  C
Sbjct: 348 NSKVFRVINGRIQC 361


>gi|326789143|ref|YP_004306964.1| DNA replication and repair protein RecF [Clostridium lentocellum
           DSM 5427]
 gi|326539907|gb|ADZ81766.1| DNA replication and repair protein RecF [Clostridium lentocellum
           DSM 5427]
          Length = 360

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/379 (27%), Positives = 175/379 (46%), Gaps = 42/379 (11%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L ++ FRNY  L +  D    IF GDN  GKTNILE+I   +  R  R     ++ R
Sbjct: 3   IKELALTNFRNYEELNISLDKGINIFKGDNAQGKTNILESIYLCATARSHRTHKEKEIIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S     A V+       I   L ++   ++    IN + I  + EL   L I    
Sbjct: 63  WNEESAHVKLA-VQKNYVQDIIDFHLTSKAKSAI----INRMPIGRLGELFGCLNIVMFS 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF---DSSWC 183
           P   ++      ERRRF+D  +  ID  +   +  + ++++ RN  L + YF   D+S  
Sbjct: 118 PEDLQLIKNSPKERRRFIDIELCQIDKLYYYSLRQYHKVLKQRNLALKQ-YFSNKDASML 176

Query: 184 SSIEAQMAELGVKINIAR---VEMINALSSLIMEYV--QKENF-----PHIKLSLTGFLD 233
              + Q+ E    +   R   ++ IN ++S I + +   KE       P++++       
Sbjct: 177 DVWDMQLEEYASAVIKKRHEFIQEINEIASKIHDDISGHKEKLQVIYEPNVEV------- 229

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
                       ++ KK+   R+ D + + T IGPHR DL     D  +   +GS G+Q+
Sbjct: 230 -----------RDFGKKILKYREKDILYQTTSIGPHRDDLTFLINDMDVK-TYGSQGQQR 277

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            V++ + LA   ++    G  PILLLD++ + LD +++  LF+   +I + I  TG ++S
Sbjct: 278 SVVLSMKLAELNIMKKYIGEEPILLLDDVLSELDHNRQGDLFKYTQNIQTLITCTGIEQS 337

Query: 354 VFDSLNETAKFMRISNHQA 372
           V++    T K  ++ N +A
Sbjct: 338 VWN----TQKIGKLYNVKA 352


>gi|171778593|ref|ZP_02919720.1| hypothetical protein STRINF_00572 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282816|gb|EDT48240.1| hypothetical protein STRINF_00572 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 364

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/365 (25%), Positives = 163/365 (44%), Gaps = 13/365 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY +  L F  +  +F+G N  GKTN LEAI FLS  R  R  S  ++  
Sbjct: 3   IQKIALKNYRNYLTNELEFSPRLNVFIGKNAQGKTNFLEAIYFLSLTRSHRTRSDKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                      RV G+   +  ++ LE       R  ++N +    + +    + +    
Sbjct: 63  FQEKEL-----RVSGILQRSSGTVPLEINLSSKGRVTKVNHLKQAKLSDYIGVMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L T    D  + + 
Sbjct: 118 PEDLQLIKGAPSLRRKFIDIDLGQIKPVYLSDLSNYNHVLKQRNTYLKTAEKVDIDFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R++ ++ L        Y       H K+    +L     Q    +
Sbjct: 178 LDEQLADFGSRVMEHRLDFVSNLEKAADRYHYAISNGLEHFKIR---YLSSVPFQEKSEI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           KE + K L   RK D   + T  GPHR DL  ++    +    GS G+ + +++ + +A 
Sbjct: 235 KEYFLKTLEKNRKRDIFKKNTGAGPHRDDL--EFFINDMPANFGSQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             LI N TG  PILLLD++ + LD  ++  L +++     Q F+T T       L E  K
Sbjct: 293 IELIKNVTGDFPILLLDDVMSELDNYRQTELLKMIIAENVQTFITTTSLEHLSKLPEELK 352

Query: 364 FMRIS 368
              ++
Sbjct: 353 IFTVN 357


>gi|28209864|ref|NP_780808.1| recombination protein F [Clostridium tetani E88]
 gi|28202299|gb|AAO34745.1| recFprotein [Clostridium tetani E88]
          Length = 370

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/379 (24%), Positives = 178/379 (46%), Gaps = 26/379 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K+L +  FRNY  L +  D    +F+G+N  GKTN+LE+I + S GR  R +   ++ +
Sbjct: 6   VKYLKLINFRNYKELNIELDKNINVFIGNNAQGKTNVLESIYYASIGRSHRTSKDKELIK 65

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              S S+   +   E ++   +I +  E +     + + +N + I  + EL   L +   
Sbjct: 66  WQESNSYIKIYVAKERLDKTIEIRVLKEGK-----KAINVNSININKLSELFGILNVVIF 120

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFD-SSWCS 184
            P    I       RR+FLD  +  +  ++   ++ +++++  RN LL +G  +  +   
Sbjct: 121 SPEDLSIVKESPSFRRKFLDIELSKLSKQYYYNLVQYQKVLNERNMLLKKGGDEVPNIIG 180

Query: 185 SIEAQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHI-KLSLTGFLDGKF 236
             + Q+A  G  I   R + +  L+ +       I    ++ +F ++  +      DGK 
Sbjct: 181 VYDEQLARFGSNIIREREKYLKKLNDIGKKIHLEITSDKEEISFTYLSSIKNKNMDDGKI 240

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           ++ F        +++   R  D   R T +GPHR D +++  +   T ++GS G+Q+   
Sbjct: 241 EEIFL-------QEIIKNRNSDIEKRYTSVGPHRDDFLIN-INNVNTRSYGSQGQQRTAT 292

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + I  A   +I +  G  P+LLLD++ + LD  ++  +   + DI + I  TG + ++  
Sbjct: 293 LTIKFASLDIIKDEIGEYPVLLLDDVLSELDSSRQKYILSSIRDIQTIITCTGIE-NIKK 351

Query: 357 SLNETAKFMRISNHQALCI 375
            L   AK  ++ N +  CI
Sbjct: 352 YLKNDAKIFKVENGE--CI 368


>gi|326202775|ref|ZP_08192642.1| LOW QUALITY PROTEIN: DNA replication and repair protein RecF
           [Clostridium papyrosolvens DSM 2782]
 gi|325986852|gb|EGD47681.1| LOW QUALITY PROTEIN: DNA replication and repair protein RecF
           [Clostridium papyrosolvens DSM 2782]
          Length = 372

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/364 (28%), Positives = 175/364 (48%), Gaps = 25/364 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  +RN+ + RLVF  +  I  GDNG GKTNILEAI   + GR  R A  +++ +
Sbjct: 3   VKSLVLKNYRNHTNTRLVFSDRFNIIYGDNGQGKTNILEAIYLCASGRSHRTAKDSELIK 62

Query: 67  IGSPSFFSTFARVEGMEGL-ADISIK-LETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            G  S FS  A V  +  L  DI IK  E + ++    L+IN++ I+ +  L  +L    
Sbjct: 63  FGCDS-FSINANVFNIGSLEKDIEIKYYENQKNK----LKINEIPIKKIGALMGNLYAVL 117

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P    I      ERRRF+D  +  I P +   +    ++++ RN LL     +     
Sbjct: 118 FSPEDLFIVKQGPTERRRFVDITLSQIRPSYFYNLQQLTKILKQRNTLLKNINSNPKLMD 177

Query: 185 SIE---AQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHIKLSLTGFLDG 234
           +++    ++AE+   I  AR      LS+L       + E  +K +F + K S     D 
Sbjct: 178 TVDIWNIRLAEVAASIITARRTFSKMLSNLAESQHNFLTEKSEKISFDY-KCSFQITEDD 236

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
             ++    ++  Y K L      D +   T +GPHR D  +    K++ +  GS G+Q+ 
Sbjct: 237 DKNK----IQNLYIKSLEKTLSRDIILGYTTMGPHRDDYDIMVNGKSLKL-FGSQGQQRS 291

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            ++ + +A   LI   T   P+LLLD++ + LD +++  L   + ++  Q F+T T    
Sbjct: 292 AVLSLKIAEIELIKRETEQYPVLLLDDVMSELDNNRQKYLMESIKEV--QTFVTCTSTEH 349

Query: 355 FDSL 358
           F++L
Sbjct: 350 FENL 353


>gi|331270703|ref|YP_004397195.1| DNA replication and repair protein RecF [Clostridium botulinum
           BKT015925]
 gi|329127253|gb|AEB77198.1| DNA replication and repair protein RecF [Clostridium botulinum
           BKT015925]
          Length = 360

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 97/375 (25%), Positives = 179/375 (47%), Gaps = 33/375 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY +L L F+    +FVGDN  GKTNILE+I +   G+  R     ++ +
Sbjct: 3   IKNLQVINFRNYDNLVLEFNKGINVFVGDNAQGKTNILESIYYCGLGKSHRTNKDKELIK 62

Query: 67  IGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            GS  ++ S +   E ++   DI I  E +     + +++N + ++ + +L     +   
Sbjct: 63  WGSKDAYVSIYVCKERLDKKIDIKIFKEGK-----KGVKVNSIKLKTISDLIGIFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I     + RR+FLD  +  ++ ++   ++ + +++  RN +L +   D      
Sbjct: 118 SPEDLKIVKESPLYRRKFLDIELSKLNKKYYYSLVRYNKVLNERNTILRKWNSDKGVTEV 177

Query: 186 IEAQMAELGVKINIARVEMINALS-------SLIMEYVQKENFPHIKLSLTGFLD---GK 235
            + Q+++ G  I   R++ I +LS         I  + +K  F +I  S+  F +   G 
Sbjct: 178 YDHQLSKYGSFIIKERLKYIESLSIKGKRIHDEITSHKEKIEFKYI-TSIKNFNNIQSGF 236

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
           FD     L +++ K              T  GPHR D I++  +   T   GS G+Q+  
Sbjct: 237 FDILRKNLDKDFEKG------------STSFGPHRDDFIIN-INNTDTRTFGSQGQQRTA 283

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD-KSV 354
           ++ I LA   +I   TG  P+LLLD++ + LD +++  +   +     Q  +TGT   ++
Sbjct: 284 ILTIKLASLEIIKEQTGEYPVLLLDDVLSELDINRQKYILNSIKKF--QTIITGTGILNI 341

Query: 355 FDSLNETAKFMRISN 369
            D L++  K  +++N
Sbjct: 342 KDYLDDHVKLFKVTN 356


>gi|118578452|ref|YP_899702.1| recombination protein F [Pelobacter propionicus DSM 2379]
 gi|118501162|gb|ABK97644.1| DNA replication and repair protein RecF [Pelobacter propionicus DSM
           2379]
          Length = 370

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 163/350 (46%), Gaps = 10/350 (2%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L+I++FRN  S+R        +  G NG GKTN+LEAI  L   R FR A   D 
Sbjct: 1   MRLTRLSIADFRNIGSVRFTPGRCFNLIHGRNGQGKTNLLEAIYLLGSPRSFRNARLPDF 60

Query: 65  TRIGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R G   +         G+ G   +SI      + + R ++++   I+   +L   + + 
Sbjct: 61  IRHGEQRAHLHGEVESAGIHGRIGLSI------ENAGRRVELDGKGIQRASDLYGRINVV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              P    +       RRR+LDR ++  D  +      F+R+++ RN+LL     D S  
Sbjct: 115 VFSPDDTAMVRYGPETRRRYLDRTIYMCDIGYLHCWHAFQRILKQRNQLLKNS--DKSGL 172

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
            +   Q+AE G +I + R   +  L+ ++  +    +      S+    +G   Q    +
Sbjct: 173 DTWTEQLAETGAEIIVRRRRFVERLNGMLQRHYGNISAGEETASVAYEPEGINSQEQQRV 232

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +EE  +     ++ D     T  GPHR DL      + +  + GSTG+QK  ++ + +A 
Sbjct: 233 REELLELFQRSQQSDIRQGTTTAGPHRDDLKFRLDGRPLK-SFGSTGQQKSFVLALKMAE 291

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
              +++  G  P+LLLD++S+ LD+ +   L   + ++  Q+FMT T +S
Sbjct: 292 IDNLTDIFGEPPLLLLDDVSSELDDARSGNLLHFLLNMDIQVFMTTTQRS 341


>gi|157149944|ref|YP_001449331.1| recombination protein F [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|189039648|sp|A8AU71|RECF_STRGC RecName: Full=DNA replication and repair protein recF
 gi|157074738|gb|ABV09421.1| DNA replication and repair protein RecF [Streptococcus gordonii
           str. Challis substr. CH1]
          Length = 361

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 167/365 (45%), Gaps = 12/365 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  FRNY    + F +   IF+G N  GKTNILE+I FL+  R  R  S  D   
Sbjct: 3   LKSLTLKHFRNYQDAEINFHSGLNIFLGQNAQGKTNILESIYFLALTRSHRTRSDKDFIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F     +V G+      +I L+       R  +IN +    + +    + +    
Sbjct: 63  -----FQEKDLKVSGILEKKTGTIPLDIELTAKGRITKINHLKQNRLSDYIGAMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPIYLADLSNYNHVLKQRNSYLKNSQNIDENFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLT-GFLDGKFDQSFCALK 244
           ++ Q+ E G ++   R++ +  L     E  +  +    K +LT  +L     Q   +++
Sbjct: 178 LDEQLIEYGCRVVKHRLDFLKKLEIFAQE--KHLDISQKKETLTIDYLSSVPLQDIDSIE 235

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E +   L   RK D   + T +GPHR D  + +    +   +GS G+ + V++ + LA  
Sbjct: 236 ESFRLSLSKNRKRDLFKQNTGVGPHRDD--IAFFINQMDANYGSQGQHRSVVLSLKLAEI 293

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKF 364
           +LI N T  +PILLLD++ + LD D++  L   ++    Q F+T T      +L +  K 
Sbjct: 294 KLIENITKESPILLLDDVMSELDNDRQLKLLETISQ-EIQTFITTTTLEHLKNLPKDIKI 352

Query: 365 MRISN 369
             ISN
Sbjct: 353 FEISN 357


>gi|229824638|ref|ZP_04450707.1| hypothetical protein GCWU000282_01985 [Catonella morbi ATCC 51271]
 gi|229786009|gb|EEP22123.1| hypothetical protein GCWU000282_01985 [Catonella morbi ATCC 51271]
          Length = 384

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 160/359 (44%), Gaps = 18/359 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +S FRNY  + L      TI  G+N  GKTN+LE+I  LS  +  R    +++
Sbjct: 1   MKLKTLKLSHFRNYQGIELCLGPGLTILTGENAQGKTNLLESIFLLSLAKSHRTNHDSEM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                       AR+E +    +  I L     +  +  Q+N +    +           
Sbjct: 61  IEWDQEQ-----ARIEAVIETKNYEIPLALTLTKKGKVAQVNYLDQSKLSHFVGQFNTVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEG---YFDS 180
             P   ++  G    RRRFLD  +   +P +   ++ ++RL++ RN  L  EG    FD 
Sbjct: 116 FAPEDMQLIKGAPNLRRRFLDIELGQANPIYLNHLLTYQRLLKQRNSYLKQEGRGKKFDQ 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            +   +  Q+ + G  +   R+E +  L  +     Q  +    +L L  +++G   Q +
Sbjct: 176 VFFEILTEQLCQEGAHLIQYRMEFLEKLGQIASPIHQNLSNGRDQLRLE-YING--SQVY 232

Query: 241 CALK-EEYAKKLFDGRKMDSMSRR----TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
             L  EE  K+L D     +   R    TL GPHR D +    DK      GS G+Q+ +
Sbjct: 233 QPLSLEERIKQLLDQASTYASRERDQGTTLFGPHRDDFMTYVNDKKAQF-FGSQGQQRTI 291

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           ++ + LA   LI    G  P+LLLD++ + LD+D+++ L   + D    I  T T K +
Sbjct: 292 VLSLKLAEIELIKQARGEYPVLLLDDVLSELDDDRQHILMSYIKDKVQTILTTATIKGL 350


>gi|295108630|emb|CBL22583.1| DNA replication and repair protein RecF [Ruminococcus obeum A2-162]
          Length = 363

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 167/356 (46%), Gaps = 26/356 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY +L+L FD    IF GDN  GKTNILE++      +  R +   ++ R
Sbjct: 3   IKSLELKNYRNYQNLQLDFDKGTNIFYGDNAQGKTNILESVYLCGTTKSHRGSKDKEIIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G      +  R+   +      I +  R +++ + + IN + I+   EL   + + +  
Sbjct: 63  FGEE---ESHIRMMIRKDEFSYKIDMHLRKNKA-KGVAINGLPIKKARELFGIVNLVFFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I      ERRRF+D  +  +D  +   +  +  ++  RNRLL + Y + S   ++
Sbjct: 119 PEDLNIIKNGPGERRRFMDLELCQLDQIYLTDLAGYNHIVNQRNRLLKDLYMNPSLKETL 178

Query: 187 ---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG---FLDGKFDQSF 240
              + QM + G KI   R + +  L+ +I +         I  +LTG    L+  ++ S 
Sbjct: 179 DIWDMQMLQYGTKIINKRKDFVRDLNQVIQD---------IHHNLTGGIEHLEVVYEPST 229

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAHGSTGEQKVVLVG 298
            A  E++   L   R+ D   + T  GPHR D  L+V+  D      +GS G+Q+   + 
Sbjct: 230 EA--EDFENVLKKNRERDIRMKMTSAGPHRDDLSLVVNGID---IRKYGSQGQQRTAALS 284

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           + L+   L+       PILLLD++ + LD +++  L   + DI + I  TG D  V
Sbjct: 285 LKLSEIYLVKEKIKDTPILLLDDVLSELDSNRQTYLLDCIHDIQTLITCTGLDDFV 340


>gi|313904728|ref|ZP_07838102.1| DNA replication and repair protein RecF [Eubacterium cellulosolvens
           6]
 gi|313470521|gb|EFR65849.1| DNA replication and repair protein RecF [Eubacterium cellulosolvens
           6]
          Length = 362

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 167/358 (46%), Gaps = 26/358 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ L +  FRNY  + L FD+   +  GDN  GKTN+LEAI  L   +  + +  +++
Sbjct: 1   MHVESLELKNFRNYERIVLDFDSGTNVLYGDNAQGKTNLLEAIHVLGTTKSHKGSHDSEM 60

Query: 65  TRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R G   +      R  G+    D+ +K   +     + + I+ + IR   +L   + I 
Sbjct: 61  IRFGEDEAHMRLIFRKNGIAHKVDMHLKKNGK-----KGVAIDGLPIRKAADLFGMINIV 115

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              P    I      ERRRFLD  +  +D  + + + D+ R++  RN LL +  F+ S  
Sbjct: 116 LFSPEDLNIIKHGPKERRRFLDSELCQLDKIYYQNLADYNRILVQRNALLKDIPFNPSLE 175

Query: 184 SSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGF---LDGKFD 237
            +++    Q+  LG  I   R      L+ +++          I  +LTG    ++  ++
Sbjct: 176 PTLDVWDMQLIRLGSHIIEQRSRFTRKLNEIVV---------GIHENLTGGREQIEIIYE 226

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVL 296
               A  EE+ +KL  GR  D   + +  GPHR D  V      I I H GS G+Q+   
Sbjct: 227 PDVTA--EEFEEKLTRGRPRDLKLKTSGTGPHRDDFRVQV--NGIDIRHFGSQGQQRSAA 282

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           + + L+   L+    G  P+LLLD++ + LD +++  L + + DI + I  TG D+ +
Sbjct: 283 LSLKLSEIYLVKEMIGDTPVLLLDDVLSELDRNRQKTLLQNMNDIQTLITCTGLDELI 340


>gi|15673957|ref|NP_268132.1| recombination protein F [Lactococcus lactis subsp. lactis Il1403]
 gi|281492578|ref|YP_003354558.1| DNA replication and repair protein RecF [Lactococcus lactis subsp.
           lactis KF147]
 gi|13959468|sp|Q9CE70|RECF_LACLA RecName: Full=DNA replication and repair protein recF
 gi|12725018|gb|AAK06073.1|AE006427_8 RecF protein [Lactococcus lactis subsp. lactis Il1403]
 gi|281376242|gb|ADA65733.1| DNA replication and repair protein RecF [Lactococcus lactis subsp.
           lactis KF147]
          Length = 358

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 157/330 (47%), Gaps = 19/330 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K + +  FRNY  L+L F     IF+G N  GKTNILEAI FL+  R  R +   ++
Sbjct: 1   MKLKAIELKNFRNYEELKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                 S+     +V G+   A  ++ LE +     R  + N +    + +    L+I  
Sbjct: 61  I-----SWSQQEMKVSGVVEKAHATVPLEVQLSPKGRIAKANHLKENRLADYIGQLKILM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT--EGYFDSSW 182
             P    +  G    RR+F+D  +  I   +    + + R ++ RN  L   +   D ++
Sbjct: 116 FAPENLELVKGSPATRRKFMDIELGQIHAVYLYDSMRYNRALKERNAYLKFDKDKIDKNF 175

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            S ++ Q+AE G KI + R   I+ L   +      E   H K +L       ++Q+   
Sbjct: 176 LSVLDGQLAEHGNKIMLERQNFIDKLE--VHAKKIHEQLTHGKENLKII----YNQN--- 226

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVGIFL 301
           +K +++K+L   +  D    +T +GPHR DL   +    I +A  GS G+Q+ V + I L
Sbjct: 227 VKTDFSKELLSRQDHDIFRHQTSVGPHRDDL--QFFINEINVADFGSQGQQRTVALSIKL 284

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKR 331
           A   LI   TG  PILLLD++ + LD  ++
Sbjct: 285 AEIDLIFEETGEYPILLLDDVMSELDNHRQ 314


>gi|257875896|ref|ZP_05655549.1| recombination protein F [Enterococcus casseliflavus EC20]
 gi|257810062|gb|EEV38882.1| recombination protein F [Enterococcus casseliflavus EC20]
          Length = 370

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 171/371 (46%), Gaps = 13/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L++S +RNY SL L F+    IF+G+N  GKTNILE+I  L+  +  R +S  ++
Sbjct: 1   MRLNELHLSNYRNYDSLTLTFEKGLVIFLGENAQGKTNILESIYVLAMTKSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  +       AR+ G       +I LE    +  R  ++N +  + +      L +  
Sbjct: 61  IRWDTEG-----ARISGSVSRGRSTIPLELFLSKKGRKTKVNHIEQKKLSSYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  IDP +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQVRRKFLDMEIGQIDPIYLYDLVQYQSVLKQRNQYLKQLNEKKQTDE 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQ 238
            +   +  Q+   G KI +AR   +  L+    +  QK  +    +++     + G+   
Sbjct: 176 IYLDVLTEQLVAFGSKIILARQRFVQRLAYWANQLHQKISQGKETLQIDYLSNVPGEAS- 234

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +   +++++ K L   +  +   + TL GPHR DL     +K +    GS G+Q+   + 
Sbjct: 235 TLEEIQQQFVKALALVKDRERFRQVTLAGPHRDDLDFLINEKNVQ-TFGSQGQQRTTALS 293

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           + LA   L+   TG  P+LLLD++ + LD+ ++  L   +         T T + V D +
Sbjct: 294 VKLAEIDLMKEETGEYPVLLLDDVMSELDDSRQLHLLETIEGKVQTFLTTTTLEHVKDKM 353

Query: 359 NETAKFMRISN 369
           +  A+   +  
Sbjct: 354 SVEAEIFYVEQ 364


>gi|94995364|ref|YP_603462.1| recombination protein F [Streptococcus pyogenes MGAS10750]
 gi|166221872|sp|Q1J443|RECF_STRPF RecName: Full=DNA replication and repair protein recF
 gi|94548872|gb|ABF38918.1| DNA replication and repair protein recF [Streptococcus pyogenes
           MGAS10750]
          Length = 368

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 168/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLFELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+   ++ +
Sbjct: 178 LDEQLASYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TSIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|116617178|ref|YP_817549.1| DNA replication and repair protein RecF [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
 gi|122272621|sp|Q040E6|RECF_LEUMM RecName: Full=DNA replication and repair protein recF
 gi|116096025|gb|ABJ61176.1| DNA replication and repair protein RecF [Leuconostoc mesenteroides
           subsp. mesenteroides ATCC 8293]
          Length = 374

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++++ L +  +RNY+ L L F +   +F+G+N  GKTN+LE+I  L+  R  R +S  D+
Sbjct: 1   MELESLKLDHYRNYSDLTLEFSSGVNVFLGENAQGKTNLLESIYVLALARSHRTSSDKDL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +  +    +   RV+       +S+    +  ++    ++N +    +      L +  
Sbjct: 61  VQWQAKE-ATISGRVKRSISETPLSLHFSNKGKKA----RVNHLEQSKLSHYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN----RLLTEGYFDS 180
             P    +  G    RRRF+D     ++P +      ++R+++ RN    RL  +   D+
Sbjct: 116 FAPEDLELVKGAPSVRRRFIDMEFGQMNPLYLYNTTQYKRILKERNAYLKRLQLKQTTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKE---NFPHIKLSLTGFLDGKFD 237
            +   +  Q+ ++G +I IAR E +N L  L  + +  E       +KL     +D   D
Sbjct: 176 VFLDVLSEQLVDVGSQILIARQEFLNKL-ELAAQPIHAEISDQREALKLRYMSSVDFASD 234

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            S   +K  +A  L   R  + M   T++GPHR +L  D     + I  GS G+Q+   +
Sbjct: 235 ASLEEVKSVFADALSRQRSREIMQGSTMVGPHRDELQFDVNGNNVAI-FGSQGQQRTTAL 293

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
            I LA   L+   TG  P+LLLD++ + LD  ++  L   + D   Q F+T 
Sbjct: 294 AIKLAEIDLMQQETGEYPVLLLDDVLSELDASRQTHLLLAIQD-KVQTFITA 344


>gi|56808225|ref|ZP_00365998.1| COG1195: Recombinational DNA repair ATPase (RecF pathway)
           [Streptococcus pyogenes M49 591]
 gi|209560278|ref|YP_002286750.1| recombination protein F [Streptococcus pyogenes NZ131]
 gi|226737844|sp|B5XJC1|RECF_STRPZ RecName: Full=DNA replication and repair protein recF
 gi|209541479|gb|ACI62055.1| Recombination protein F [Streptococcus pyogenes NZ131]
          Length = 368

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|222150257|ref|YP_002559410.1| recombination protein F [Macrococcus caseolyticus JCSC5402]
 gi|254790482|sp|B9E903|RECF_MACCJ RecName: Full=DNA replication and repair protein recF
 gi|222119379|dbj|BAH16714.1| recombination protein F [Macrococcus caseolyticus JCSC5402]
          Length = 369

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 161/350 (46%), Gaps = 11/350 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L ++ +RNY +  L F  +  IF+G N  GKTN+LEAI  L+  +  R ++  ++
Sbjct: 1   MKLKTLTLTHYRNYETAELNFSDEVNIFIGINAQGKTNLLEAIYCLAMAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
              G       F+ +EGM      ++ L     +  +  ++N +  + + E   H+ +  
Sbjct: 61  IGWGHE-----FSHIEGMLSYKHGTMPLSLSISKKGKKAKVNYLEQKRLTEYIGHMNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    +  G    RRRF+D  +  I   +   + +++RL++ +N LL +       D 
Sbjct: 116 FAPEDLNLVKGSPQIRRRFIDMEIGQISAVYLNDLSNYQRLLKQKNHLLKQMKLSNSNDM 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
           +    I  Q A+  VK+ + R   I  L +L +           +LSL       ++ + 
Sbjct: 176 TMLEVINEQFAQYAVKLTLRRKMFIEQLETLAIPIHTGITKDKERLSLRYNASLNYELAE 235

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             + EE  + L      +    ++L GPHR DL     D  +   +GS G+Q+   + I 
Sbjct: 236 QEMFEETIRILNANMGKEIERTQSLYGPHRDDLSFKINDIDVQ-TYGSQGQQRTTALSIK 294

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           LA   LI+   G  PILLLD++ + LD+D++  L   +     Q F+T T
Sbjct: 295 LAEIELINQEIGEYPILLLDDVLSELDDDRQTHLLTTIQH-KVQTFVTTT 343


>gi|42521653|ref|NP_967033.1| DNA repair and genetic recombination protein [Bdellovibrio
           bacteriovorus HD100]
 gi|39574183|emb|CAE77687.1| DNA repair and genetic recombination protein [Bdellovibrio
           bacteriovorus HD100]
          Length = 374

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 97/377 (25%), Positives = 189/377 (50%), Gaps = 22/377 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  FRNY  + L F  +  +F+G+NG GKTN+LEA+  +S G  FR   Y+D + + +
Sbjct: 6   LRLVNFRNYRDVVLSFSPRVNVFLGENGQGKTNLLEAMYMISQGDSFR---YSDNSTLIN 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
            +  ++ + ++ +    D+  KL+    +S + L +ND  +   D       + +   S+
Sbjct: 63  TN--TSESVIQALITQNDLHYKLKLGLSKSRKVLTLNDKRVNSADIRKIFASVVFSPESL 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFD----SSW 182
             I  G +  RR  +D ++   D ++ + + D+ + ++ RN++L    EG  D     + 
Sbjct: 121 SSIKEG-ADHRRELVDELLVTFDRKNAQLIADYRKALKTRNKILKNFLEGLQDKVVTQNL 179

Query: 183 CSSIEAQMAELGVKINIARVEMINALS---SLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
             S+  Q   L   +  AR+  ++ LS   +  M+Y+   +   + +S+   +  +   S
Sbjct: 180 LESLNPQFVRLATDLTHARITALHGLSKDFNNAMQYISGNS--SVDISVEYLVSDQNAVS 237

Query: 240 FCALKEEYA--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
           F   + E A  K+L +    +  S  +L+GPH+ D++  Y  K       S G+Q+ +++
Sbjct: 238 FTREEVENAITKRLRELHDAELSSGTSLVGPHKHDIVFLYGQKDSRF-FCSQGQQRAIIL 296

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
              +A         G  P+L+LD++ + LD+ KR+AL   + +I +QIF+T TD ++ +S
Sbjct: 297 SFKMAQIVYHRKAHGTYPVLMLDDVLSELDKAKRDALITFLHEINTQIFVTTTDFTLPES 356

Query: 358 LN-ETAKFMRISNHQAL 373
            + +  + +RI + Q L
Sbjct: 357 FSLDQLRVVRIKDGQIL 373


>gi|29840206|ref|NP_829312.1| recombination protein F [Chlamydophila caviae GPIC]
 gi|33301500|sp|Q823G6|RECF_CHLCV RecName: Full=DNA replication and repair protein recF
 gi|29834554|gb|AAP05190.1| recF protein [Chlamydophila caviae GPIC]
          Length = 367

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 105/371 (28%), Positives = 167/371 (45%), Gaps = 18/371 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI  L +  FRNY    +          G+N  GKTN+LEA+  LS GR FR     + 
Sbjct: 1   MKILSLRLKNFRNYKEAEVSLSPDMNYIFGENAQGKTNLLEALYVLSLGRSFRTTHLTEA 60

Query: 65  TRIGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
              GS  FF   TF +    +G       L T  D+  + +  +   I+ + +L   + I
Sbjct: 61  IFFGSSHFFLEMTFEK----DGFCHT---LSTYVDKQGKKILCDHSPIKTLSQLIGMVPI 113

Query: 123 SWLVPSMDR-IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
             L  S DR + SG   +RR FL+ ++   DP+++  +  + R +  RN LL      +S
Sbjct: 114 V-LFSSKDRSLISGAPADRRLFLNLLLSQCDPQYKHTLSYYHRALLQRNTLLKTK--QTS 170

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
             S  + Q+A LG  + ++R      L+ L+ E         +++     L  + + S  
Sbjct: 171 TLSVWDEQLATLGAYLTVSRYFCCEQLNQLVQELWSNSLSEQLRIKFKSSLIKQGNLSQE 230

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF- 300
           A+ EE  K+L      D     T +GPHR D  +   D  +++A  S+  QK  L+ I  
Sbjct: 231 AIIEELRKQLTTALHRDLELGTTSVGPHREDFTLMIND--LSVAQFSSEGQKHSLLAILR 288

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA    I N     P+  +D+I A LD  + + L  +   +G Q  MT T+     SL+E
Sbjct: 289 LAECLYIKNIYNACPLFCMDDIHAGLDNHRISQLLDLAPTLG-QTLMTSTNIP-HQSLSE 346

Query: 361 TAKFMRISNHQ 371
           T+K   ++  Q
Sbjct: 347 TSKIFSVNQAQ 357


>gi|304315541|ref|YP_003850686.1| DNA replication and repair protein RecF [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777043|gb|ADL67602.1| DNA replication and repair protein RecF [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 362

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 168/350 (48%), Gaps = 13/350 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  F+N    ++ F A   +  G N  GK+N+LE I  LS G+ FR +   D+  
Sbjct: 3   LKELTIDNFKNLRQQKVTFSAGTNVIYGTNAQGKSNLLECIRILSIGKSFRNSKNKDMV- 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDD-RSVRCLQINDVVIRVVDELNKHLRISWL 125
               +F S +  ++G+  + +  I +ET       R  ++N+  I+ + EL   +  +  
Sbjct: 62  ----NFNSDYYYIKGIFDIDNEEITVETGYKLNQNRFFKVNNNKIKSISELIGVILTTIF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS---W 182
            P    I  G    RRR++D  +  I   +   +I + +++  RN++L    F S     
Sbjct: 118 SPDDLNIVKGSPFIRRRYMDASISMIKRNYLYDIIQYNKVLANRNKVLKNIKFKSENLKL 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
              ++ Q++  G KI + R + IN L+ ++ + +   +   +++     +  K D     
Sbjct: 178 LDIMDEQLSIYGSKIMMYRKQYINNLNLIVKKILHDISDEEVEICYWSNVMDKID-DIKY 236

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +KE  + KL   R++D     T  GPHR D+ + Y +   +  + S G+Q+ + + + LA
Sbjct: 237 IKESLSNKLKLNREIDIKYGDTRYGPHRDDIKI-YVNGHDSRIYASQGQQRTIALCLKLA 295

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
              +I +     PILLLD++ + LD ++R  +   VT  G Q F+T T+K
Sbjct: 296 EHEMIKSENHENPILLLDDVMSELDLNRRRYILNKVT--GCQTFITHTEK 343


>gi|323128305|gb|ADX25602.1| recombination protein F [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 368

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRVSGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGTRVMEHRIDFINALEKEANTHHQAISNGLENLSLSYQSSVVFDKR-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLKKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|332139413|ref|YP_004425151.1| Recombinational DNA repair ATPase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549435|gb|AEA96153.1| Recombinational DNA repair ATPase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 362

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 91/352 (25%), Positives = 168/352 (47%), Gaps = 17/352 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  + I++FRN  S+ L      TI  G+NG GK++++EA+ +L  GR FR   ++ V
Sbjct: 1   MKLDRVQITQFRNLTSVSLSPSPALTIIKGENGSGKSSLIEALYYLGFGRSFRTNKHSSV 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +    S FS FA  +  EG  ++ +  +   + +  C  IN      + +L   + +  
Sbjct: 61  IQNEKDS-FSVFASCKTEEG-DELKLGFQRSRNETFTC-SINGEHSNKLSDLVSLVPLQL 117

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWC 183
             P    +  G   ERRRF D  +F ++ + +     + + ++ RN LL  +    +   
Sbjct: 118 FTPQSTDLIIGSPSERRRFCDWGLFHVEHQFQSLANQYGKFLKHRNALLKQQANLSAPQN 177

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
              E+Q +ELG  ++  R E ++ L+ +  +Y Q E  P+  + L+ +   + D     L
Sbjct: 178 QYWESQFSELGESLSATRQEYVDTLTPIFKQYAQ-EFLPNFDVELSYYKGWEKD---VGL 233

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            E   KK    R+ D     T  GPH++D  L V+  +    +   S G+ ++ +  + +
Sbjct: 234 SESLVKK----REYDGKIGHTSSGPHKADLRLKVNGVNAQELL---SRGQLRMAVAALQM 286

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
           +  +L ++ T    I LLD++ A LD DKR      +  + +Q+F+T  + S
Sbjct: 287 SQTKLFNSATQRKSIFLLDDVGAELDADKREQFIDGLLKMDTQVFVTAIESS 338


>gi|256389236|ref|YP_003110800.1| DNA replication and repair protein RecF [Catenulispora acidiphila
           DSM 44928]
 gi|256355462|gb|ACU68959.1| DNA replication and repair protein RecF [Catenulispora acidiphila
           DSM 44928]
          Length = 381

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 173/370 (46%), Gaps = 20/370 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L++++FR+YASL +      T FVG NG GKTN++EAI +++     R A+   +
Sbjct: 1   MRVTHLSLADFRSYASLDVALGGGVTAFVGPNGQGKTNLVEAIGYIATLDSHRVATDQPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R G+P      A VE  EG   + +++E     + R  ++N   +    E+   LR   
Sbjct: 61  VRFGAPRAI-VRANVE-REGRTQL-VEIELNPGGANRA-RLNRNPVPRPREVLGVLRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF------ 178
             P    +  G   ERRRFLD ++ A  PR      D++R+++ RN LL           
Sbjct: 117 FAPEDLALVKGDPGERRRFLDELLVARWPRFAGVRADYDRVLKQRNTLLRTAAMARRNKA 176

Query: 179 ---DSSWCSSIEAQMAELGVKINIARVEMINALSSLIME-YVQKENFPHIKLSLTGFLDG 234
              + S   + +  +A  G ++  AR+ +I+ALS L+ + YV+       ++     +  
Sbjct: 177 SGPNISTLDAWDHHLALAGAELVAARLALISALSPLVDKCYVEIAEGGQTRIGYRSTISA 236

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC----DKAITIAHGSTG 290
           + D +  AL E++   L + R  +     TL+GPHR +++++      D      + S G
Sbjct: 237 EPDPTAAALTEQFMTALGEARANELDRGITLVGPHRDEMVLELTSSSGDNMPARGYASHG 296

Query: 291 EQKVVLVGIFLAHARLI--SNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
           E     + + LA   L+    + G  P+L+LD++ A LD  +R  L   V+     +   
Sbjct: 297 ESWSYALALRLAAYDLLRSDGSDGGEPVLILDDVFAELDAKRRRRLAERVSGADQVLITA 356

Query: 349 GTDKSVFDSL 358
             D  V + L
Sbjct: 357 AVDADVPEQL 366


>gi|21911391|ref|NP_665659.1| recombination protein F [Streptococcus pyogenes MGAS315]
 gi|28896763|ref|NP_803113.1| recombination protein F [Streptococcus pyogenes SSI-1]
 gi|25453245|sp|Q8K5G2|RECF_STRP3 RecName: Full=DNA replication and repair protein recF
 gi|21905607|gb|AAM80462.1| RecF protein [Streptococcus pyogenes MGAS315]
 gi|28812017|dbj|BAC64946.1| RecF protein [Streptococcus pyogenes SSI-1]
          Length = 368

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDQLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSQRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|19747036|ref|NP_608172.1| recombination protein F [Streptococcus pyogenes MGAS8232]
 gi|94991484|ref|YP_599584.1| recombination protein F [Streptococcus pyogenes MGAS10270]
 gi|306826422|ref|ZP_07459735.1| recombination protein F [Streptococcus pyogenes ATCC 10782]
 gi|25453247|sp|Q8NYZ4|RECF_STRP8 RecName: Full=DNA replication and repair protein recF
 gi|166221871|sp|Q1JEB8|RECF_STRPD RecName: Full=DNA replication and repair protein recF
 gi|19749296|gb|AAL98671.1| recF protein [Streptococcus pyogenes MGAS8232]
 gi|94544992|gb|ABF35040.1| DNA replication and repair protein recF [Streptococcus pyogenes
           MGAS10270]
 gi|304431386|gb|EFM34382.1| recombination protein F [Streptococcus pyogenes ATCC 10782]
          Length = 368

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  F-DHSTVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLAGYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|125624996|ref|YP_001033479.1| recombination protein F [Lactococcus lactis subsp. cremoris MG1363]
 gi|166220713|sp|A2RNA8|RECF_LACLM RecName: Full=DNA replication and repair protein recF
 gi|124493804|emb|CAL98796.1| DNA replication and repair protein recF [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071794|gb|ADJ61194.1| recombination protein F [Lactococcus lactis subsp. cremoris NZ9000]
          Length = 359

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 156/333 (46%), Gaps = 25/333 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K + +  FRNY  L+L F     IF+G N  GKTNILEAI FL+  R  R +   ++
Sbjct: 1   MKLKQIELKNFRNYEDLKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R           +V G+   A  ++ LE +     R  + N +    + +    L+I  
Sbjct: 61  IRWSGQEM-----KVSGLVEKAHATVPLEVQLSSKGRIAKANHLKENRLADYIGQLKILM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT--EGYFDSSW 182
             P    +  G    RRRF+D  +  I   +    + + R ++ RN  L   +   D ++
Sbjct: 116 FAPENLELVKGSPATRRRFMDIELGQIHAVYLYDSMRYNRALKERNAYLKFDQAKIDKNF 175

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG---KFDQS 239
            + ++ Q+AE G KI   R   I  L      + +K     I   LT  L+     ++Q+
Sbjct: 176 LTVLDEQLAEHGNKIMFERKTFIEKLEI----HAKK-----IHEQLTHGLETLKITYNQN 226

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVG 298
              +K +++K+L   +  D    +T +GPHR DL     D  I +A  GS G+Q+ V + 
Sbjct: 227 ---VKTDFSKELLSRQDHDIFRHQTTVGPHRDDLQFFIND--INVADFGSQGQQRTVALS 281

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKR 331
           I LA   LI   TG  PILLLD++ + LD  ++
Sbjct: 282 IKLAEIDLIFEETGEYPILLLDDVMSELDNHRQ 314


>gi|315221608|ref|ZP_07863528.1| recombination protein F [Streptococcus anginosus F0211]
 gi|315189442|gb|EFU23137.1| recombination protein F [Streptococcus anginosus F0211]
          Length = 365

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 157/355 (44%), Gaps = 30/355 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  FRNY +  + F +   IF+G N  GKTNILEAI FL+  R  R  S  D+  
Sbjct: 3   LKKLQIQHFRNYEATEIDFHSGLNIFLGQNAQGKTNILEAIYFLALTRSHRTRSDKDLIY 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               +      ++ G        I LE       R  ++N +    + +   ++ +    
Sbjct: 63  FSKDTL-----KISGQLVKQTGKISLEIDLTPKGRITKVNHLKQSKLSDYVGNMNVILFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L T    D ++ + 
Sbjct: 118 PEDLQLIKGAPALRRKFIDIELGQIKPIYLSDLSHYHHVLKQRNTYLKTAKTIDETFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIK-LSLTGFLDGKFDQSFCA-- 242
           ++ Q+ E G ++   R+E +  L          E+F   K L L+  L+      +C+  
Sbjct: 178 LDDQLVEFGCRVMQHRIEFLKKL----------EHFGQQKHLELSSHLEN-LTIKYCSSV 226

Query: 243 -------LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
                  LKE +   L   R  D   + T +GPHR D  + +C   +    GS G+ + V
Sbjct: 227 PLSDSNKLKESFQIALKQSRSRDLFKKNTGVGPHRDD--IAFCINDMNANFGSQGQHRSV 284

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           ++ + LA   L+   T   PILLLD++ + LD  ++  L   ++    Q FMT T
Sbjct: 285 VLSLKLAEIELMETVTKEKPILLLDDVMSELDNSRQLNLLETISQ-NIQTFMTTT 338


>gi|255283817|ref|ZP_05348372.1| RecF protein [Bryantella formatexigens DSM 14469]
 gi|255265700|gb|EET58905.1| RecF protein [Bryantella formatexigens DSM 14469]
          Length = 360

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 163/359 (45%), Gaps = 32/359 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ + + +FRNY SL+L FD+   IF GDN  GKTNILEA+      +  R +   +V +
Sbjct: 3   VQSIELEKFRNYKSLKLKFDSGTNIFYGDNAQGKTNILEAVYLCGTTKSHRGSKDREVIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +  R++       I I +  + ++  + + IN V IR   EL       +  
Sbjct: 63  FQEE---ESHLRMKVERNNVPIEIDMHLKKNKP-KGIAINGVPIRKASELFGIANFVFFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I       RR F+D  +  +   +   + ++ +++  RNRLL E  F      ++
Sbjct: 119 PEDLNIIKDGPSVRRHFIDMELCQLHKVYLHHLSNYNKVINQRNRLLKESAFRPDILDTL 178

Query: 187 ---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK-------F 236
              + QMAE G K+   R   I  L+ +I              S+ G L G+       +
Sbjct: 179 DIWDIQMAEYGKKVIEERRAFIRRLNEIID-------------SIHGRLTGEKEHLRIIY 225

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVV 295
           +++  A  EE+A+ L   R+ D   + ++ GPHR D+   +    + I   GS G+Q+  
Sbjct: 226 EENVTA--EEFAEALRSSREKDLRMKMSMTGPHRDDIC--FQTNGVDIRKFGSQGQQRTA 281

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            + + L+   L+    G  PILLLD++ + LD  ++  L   + DI + I  TG D  V
Sbjct: 282 ALSLKLSEIELVKQEIGDTPILLLDDVLSELDSSRQKYLLDSIHDIQTFITCTGLDDFV 340


>gi|219847382|ref|YP_002461815.1| DNA replication and repair protein RecF [Chloroflexus aggregans DSM
           9485]
 gi|254790467|sp|B8G3J6|RECF_CHLAD RecName: Full=DNA replication and repair protein recF
 gi|219541641|gb|ACL23379.1| DNA replication and repair protein RecF [Chloroflexus aggregans DSM
           9485]
          Length = 392

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 102/390 (26%), Positives = 177/390 (45%), Gaps = 29/390 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L + +FRNY    +       +  G N  GKT++LEAI +L+  R  R +S  D+ R
Sbjct: 3   IHHLALRDFRNYRRQDVALSPTTILLYGPNAAGKTSLLEAIFYLATTRSPRLSSDRDLVR 62

Query: 67  ------IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRV------VD 114
                  G+P F    A VE   G   + I ++ R D   + L     ++R+        
Sbjct: 63  WDAVGEAGAPPFARIAADVERRIGPVRLEILVQRRLDDGGQPLNGAQKLVRIDKRPARAI 122

Query: 115 ELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT 174
           +L   LR+    P+   +  G   ERRR+LD  +  +DP + R +  +++++  RN LL 
Sbjct: 123 DLIGQLRVVLFTPTDVMLVDGPPAERRRYLDITLSQLDPHYVRTLAYYQKILLQRNSLLR 182

Query: 175 EGYFDSSWCSSIEAQM-------AELGVKINIARVEMINALSSLIMEYVQK----ENFPH 223
                     +++A++       A  G  +   R+  +  LS+L     +K    E+   
Sbjct: 183 AWREQRRLPRNVDAELGYWDQELAAAGGYLLAERLRAVVELSALAGSIYRKISGGEHELQ 242

Query: 224 IKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSR-RTLIGPHRSDLIVDYCDKAI 282
           I+   +  LD   D    A   E  +  F  ++ D ++R +TL GPHR DL+ +     +
Sbjct: 243 IEYIASCDLDAARDAGSLA---ERLRLAFAAQRTDELARGQTLCGPHRDDLVFNVAGVNL 299

Query: 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG 342
              +GS G+Q+ + + + +  A L+    G AP+LLLD++ + LD  +R  L  ++    
Sbjct: 300 G-RYGSRGQQRTIALALKIGEAELMQQRGGDAPVLLLDDVLSELDNRRRMHLLDLILRPQ 358

Query: 343 SQIFMTGTDKSVFDS-LNETAKFMRISNHQ 371
            Q  +T T+ S F +     A+  R+ + Q
Sbjct: 359 QQTLLTATNLSDFSADFLAAARRFRVEDGQ 388


>gi|50915219|ref|YP_061191.1| recombination protein F [Streptococcus pyogenes MGAS10394]
 gi|73914003|sp|Q5X9A5|RECF_STRP6 RecName: Full=DNA replication and repair protein recF
 gi|533080|gb|AAA85783.1| RecF protein [Streptococcus pyogenes]
 gi|50904293|gb|AAT88008.1| RecF [Streptococcus pyogenes MGAS10394]
          Length = 368

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  F-DHSTVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLAGYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|302669378|ref|YP_003829338.1| DNA replication and repair protein RecF [Butyrivibrio
           proteoclasticus B316]
 gi|302393851|gb|ADL32756.1| DNA replication and repair protein RecF [Butyrivibrio
           proteoclasticus B316]
          Length = 372

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 173/365 (47%), Gaps = 33/365 (9%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +++FRNY ++++ F +   I  GDN  GKTNILEAI   +  +  + +   ++ R
Sbjct: 3   IKSLELADFRNYENVKIDFSSGTNILYGDNAQGKTNILEAIFVSATTKSHKGSKDKEIIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +   T    +  E   D+ ++         + + I+   I+   +L   L + + 
Sbjct: 63  FGKDEAHIRTILEKDNAEYRVDMHLR-----SSKTKGIAIDGQKIKRASDLIGMLNVVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY---FDSSW 182
            P    I      ERRRF+D  +  +D  +   +  + +L+  RN++L + Y    +S  
Sbjct: 118 SPEDLSIIKNGPSERRRFMDMELCQLDQIYLNSLSKYNKLVVERNKVLKDLYEHPENSVL 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG---FLDGKFDQS 239
               + Q+ E G  I   R + I  L+ +I    +K         LTG   FL   ++ +
Sbjct: 178 LDVQDKQLCEYGSVIIKTREKFIRDLNEIIRPIHEK---------LTGNKEFLSVYYEPN 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDY----CD---KAITI-AHGST 289
             A  +E+ KKL   R+ D+ +++T +GPH+ D   +V      CD   + I I  +GS 
Sbjct: 229 VSA--DEFEKKLRAARQKDTYAKQTTVGPHKDDFSFVVQKKKADCDEYGEGIDIRKYGSQ 286

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           G+Q+   + + L+   ++       P+LLLD++ + LD +++N L   + DI + +  TG
Sbjct: 287 GQQRTASLSLKLSEIEIVKRAKKENPVLLLDDVLSELDSNRQNYLLNTIGDIQTIVTCTG 346

Query: 350 TDKSV 354
            D+ V
Sbjct: 347 LDEFV 351


>gi|322392439|ref|ZP_08065899.1| recombination protein F [Streptococcus peroris ATCC 700780]
 gi|321144431|gb|EFX39832.1| recombination protein F [Streptococcus peroris ATCC 700780]
          Length = 363

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 170/377 (45%), Gaps = 32/377 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L+I +FRNY    + F+ +  +FVG N  GKTN+LE+I FL+  R  R  +  ++ +
Sbjct: 3   LKNLSIKQFRNYRDTEIEFNPKLNVFVGRNAQGKTNLLESIYFLALTRSHRTKTDKNLIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F     +V G+      +I LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  -----FEEEKLQVSGILQKKTATIPLEIDLTQKGRITKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLVKGAPAIRRKFIDMELGQIKPIYLSDLSSYNHILKQRNTYLKSSQNIDDTFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC---- 241
           ++ Q+ E G ++ I R + I       ME   K+   H  +S     D   + S C    
Sbjct: 178 LDDQLVEYGCRVMIHRADFIQK-----MELFGKKK--HFDIS-----DQLEELSICYQPS 225

Query: 242 -------ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
                   L + +   L   R  D   + T +GPHR D+I  +    I  + GS G+ + 
Sbjct: 226 VNFIDKEHLADSFHTALQKSRSRDLFKKNTGVGPHRDDMI--FLINGIDASFGSQGQHRS 283

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           +++ I LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T    
Sbjct: 284 LVLSIKLAEIELMESITKESPILLLDDVMSELDNTRQLKLLETISH-NIQTFITTTSLDH 342

Query: 355 FDSLNETAKFMRISNHQ 371
             +L +T     ++N Q
Sbjct: 343 LQNLPDTLSVFTVNNGQ 359


>gi|166157052|emb|CAO79509.1| DNA replication and repair protein RecF [uncultured candidate
           division WWE3 bacterium EJ0ADIGA11YD11]
          Length = 352

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 95/341 (27%), Positives = 163/341 (47%), Gaps = 20/341 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI  L ++  RN+  L L+FD   T+  GDNG GK+ ILEAI  LS G+        D+
Sbjct: 1   MKILNLKLTNLRNHTKLSLIFDNNVTLITGDNGSGKSTILEAIHILSVGKSKISKYDRDL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADIS---IKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
            + G   F S  A +E  +   ++    IK E  ++ S++  +IN V  + +        
Sbjct: 61  IQYGK-KFCSINADIETKDDRFNMELQIIKNEDFENASIKKARINKVA-KSIQYFAGIFN 118

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL---TEGYF 178
                P   ++ +G   ERR+++D  +  +D  ++R + D+ + +R RN+LL    +G+ 
Sbjct: 119 SVLFSPQDIQLITGSPSERRKYVDETLSQVDIEYKRSLNDYLKAVRQRNKLLEKINQGFG 178

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
                     QM + G  I   R +M   +  +++E  +  N    KL L      K + 
Sbjct: 179 GQGEIEFYTHQMLKNGEIIQRKREQMFADIKPILLETGKILNDKKTKLELNY---KKNEI 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           S   L E      F  R++ +M+  +L+GPHR D  + + D  +T   GS GEQ+  ++ 
Sbjct: 236 SIERLNE------FKSREIAAMT--SLLGPHRDDFEIHFNDHNVT-NFGSRGEQRSCVLS 286

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT 339
           + +A    I       P+LLLD+I + LD+  + A+F ++ 
Sbjct: 287 LKIAEISFIEKKKNDKPVLLLDDIFSELDKKHQTAVFDVIN 327


>gi|290581413|ref|YP_003485805.1| putative RecF protein [Streptococcus mutans NN2025]
 gi|254998312|dbj|BAH88913.1| putative RecF protein [Streptococcus mutans NN2025]
          Length = 363

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 169/374 (45%), Gaps = 20/374 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ +N+  +RNY ++   F     +FVG N  GKTN LEAI FLS  R  R  S  ++ +
Sbjct: 3   IEKINLKHYRNYTAIESEFSQSLNVFVGQNAQGKTNFLEAIYFLSLTRSHRTRSDKELIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G          V G+    +  I LE       R  +IN +    + +    + +    
Sbjct: 63  FGQKEL-----NVSGLLNRVNGKIPLEINLSNKGRTTKINYLKQPKLSDYIGTMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +E   D+ +   
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIDLGQIKPIYLSDLSNYNHVLKQRNAYLKSEKKVDTDFLFV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEY-----VQKENFPHIKLSLTGFLDGKFDQSF 240
           ++ Q+ + G K+   R++ I  L+    +Y      Q+E   H+K+S    +  KFD   
Sbjct: 178 LDEQLVDYGSKVIEHRLDFIQNLTKEADKYHFSISNQQE---HLKISYLSSV--KFDHK- 231

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +++ +   L   R+ D   + T +GPHR DL   +    +    GS G+ + +++ + 
Sbjct: 232 KNIRDNFLNLLQKNRQGDIFKKNTSVGPHRDDLA--FFINQMNANFGSQGQHRSLILSLK 289

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA   LI   TG  PILLLD++ + LD  ++  L   + D   Q F+T T       L +
Sbjct: 290 LAEIELIKTVTGDYPILLLDDVMSELDNYRQIKLLEGIKD-NVQTFITTTSLEHLQQLPK 348

Query: 361 TAKFMRISNHQALC 374
             K   I+  + L 
Sbjct: 349 KLKLFTINQGKVLS 362


>gi|169351629|ref|ZP_02868567.1| hypothetical protein CLOSPI_02410 [Clostridium spiroforme DSM 1552]
 gi|169291851|gb|EDS73984.1| hypothetical protein CLOSPI_02410 [Clostridium spiroforme DSM 1552]
          Length = 365

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 97/351 (27%), Positives = 171/351 (48%), Gaps = 20/351 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K LN+  FRNY+   + F     I +G+NG GKTN++EAI  LS G+ FR  S+ +   
Sbjct: 3   VKSLNLYNFRNYSHFVIDFSQDINILIGNNGQGKTNLIEAIYLLSVGKSFR--SHVNKQM 60

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           I    F + FAR++G          LE     + +  +I++  I  + E    L +   +
Sbjct: 61  I---MFDNEFARIKGKVISNSKQRNLEIILGSNFKNAKIDNQDIHKISEFVGLLNVVVFI 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL----TEGYFDSSW 182
           P    +  G    RRRF+D  +  I P +   +  +  L++ RN+ L     +      +
Sbjct: 118 PDDLYLVKGNPSNRRRFIDLEISKISPIYVFNLSKYSNLLKERNKYLKILNKKNSSGDEY 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALS---SLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
              ++ Q+++L V++   R++ I+ L    SLI + + +++   IKL  + FL  K D +
Sbjct: 178 LEVLDEQLSKLQVELIKKRLQFISRLDQKVSLIYQKIAQKDNEAIKLRYSCFL--KDDLN 235

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           +  +   Y K      + D    ++ IG H+ DL + Y +      + S G+Q+ V++ +
Sbjct: 236 YENILNLYKK----NHRRDIKYMQSHIGIHKDDLKI-YMNDNDACLYASQGQQRTVVLSL 290

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
            +A   LI    G  P+LLLD++ + LD+ ++N L  I+     Q F+T T
Sbjct: 291 KIALIELIKEEIGEYPVLLLDDVLSELDKTRKNMLLDILNQ-KIQTFITTT 340


>gi|326407512|gb|ADZ64583.1| DNA replication and repair protein RecF [Lactococcus lactis subsp.
           lactis CV56]
          Length = 358

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 157/330 (47%), Gaps = 19/330 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K + +  FRNY  L+L F     IF+G N  GKTNILEAI FL+  R  R +   ++
Sbjct: 1   MKLKAIELKNFRNYEELKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                 S+     +V G+   A  ++ LE +     R  + N +    + +    L+I  
Sbjct: 61  I-----SWSQQEMKVSGVVEKAHATVPLEVQLSPKGRIAKANHLKENRLADYIGQLKILM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT--EGYFDSSW 182
             P    +  G    RR+F+D  +  I   +    + + R ++ RN  L   +   D ++
Sbjct: 116 FAPENLELVKGSPATRRKFMDIELGQIHAVYLYDSMRYNRALKERNAYLKFDKDKIDKNF 175

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            S ++ Q+AE G KI + R   I+ L   +      E   H K +L       ++Q+   
Sbjct: 176 LSVLDGQLAEHGNKIMLERQNFIDKLE--VHAKKIHEQLTHGKENLKII----YNQN--- 226

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVGIFL 301
           +K +++K+L   +  D    +T +GPHR DL   +    I +A  GS G+Q+ V + I L
Sbjct: 227 VKTDFSKELLIRQDHDIFRHQTSVGPHRDDL--QFFINEINVADFGSQGQQRTVALSIKL 284

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKR 331
           A   LI   TG  PILLLD++ + LD  ++
Sbjct: 285 AEIDLIFEETGEYPILLLDDVMSELDNHRQ 314


>gi|251783552|ref|YP_002997857.1| recombination protein F [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242392184|dbj|BAH82643.1| recombination protein F [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 368

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKYYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRVSGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGTRVMEHRIDFINALEKEANTHHQAISNGLENLSLSYQSSVVFDKR-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|303240060|ref|ZP_07326581.1| DNA replication and repair protein RecF [Acetivibrio cellulolyticus
           CD2]
 gi|302592329|gb|EFL62056.1| DNA replication and repair protein RecF [Acetivibrio cellulolyticus
           CD2]
          Length = 372

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 172/355 (48%), Gaps = 12/355 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L +  FRNY    + F   + I  G+N  GKTNI+EAI   + GR  R +   ++  
Sbjct: 3   IDSLQLRNFRNYKENVIDFSKNYNIIYGENAQGKTNIVEAIFLCASGRSHRTSKDIELVN 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           I S S+       +  E   +I I  E R+ + V  ++IN++ ++ +  L  +L      
Sbjct: 63  INSNSYDIKLDATKNQEK-TNIEISYE-REKKKV--IKINEIPLKKMGNLMGNLLAVIFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    + +    +RRRF+D  +  I P +   +  + +++  RN LL E   +     ++
Sbjct: 119 PEDLSVINEGPSQRRRFIDITLSQIKPSYFYDLQLYNKILLQRNSLLKELQNNRGLIDTL 178

Query: 187 ---EAQMAELGVKINIARVEMINAL--SSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
              + ++A++G +I  AR E IN L  ++     +  +N  +I+++ +  ++    +   
Sbjct: 179 DIWDEKIADIGSRIIKARHEFINRLNKAAKYNHSILSDNNENIEINYSSSVETDNYEDID 238

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            +K          R ++     TL GPHR D  + + +     + GS G+++ V++ I L
Sbjct: 239 KIKANILMDFKRYRYIELKRNTTLKGPHRDDYEI-FINNLDVKSFGSQGQKRTVILSIKL 297

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           +  ++I   TG  P+LLLD++ + LD  +R  LF  +  I  Q F+T T+K +FD
Sbjct: 298 SELQIIKEETGEYPVLLLDDVMSELDYKRREILFDNINHI--QTFITCTEKDIFD 350


>gi|291561641|emb|CBL40440.1| DNA replication and repair protein RecF [butyrate-producing
           bacterium SS3/4]
          Length = 361

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 165/358 (46%), Gaps = 30/358 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +S++RNY+ L + F     +  GDN  GKTNILEA+   S  +  R +   ++ R
Sbjct: 3   IESIELSDYRNYSHLHIDFHKGTNVLYGDNAQGKTNILEAVYVCSTTKSHRGSKDKEIIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  S      R +G+    D+ +K         + + +N V I+   EL   + + + 
Sbjct: 63  FGADESHIKMMVRRDGIPYRIDMHLK-----KNKAKGVAVNGVPIKKASELFGIVNVIFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  ++  +   +  + + +  RN+LL +  +++S   +
Sbjct: 118 SPEDLNIIKNGPAERRRFVDLELCQLNRLYVYNLAQYNKTVIQRNKLLKDIDYNTSLKET 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC- 241
           +     Q+ + G ++ I R E I  L+ LI E         I   L+G   GK   S   
Sbjct: 178 LPMWNEQLLKYGTELIIMRSEFIKELNPLIAE---------IHAGLSG---GKETLSIAY 225

Query: 242 ---ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGSTGEQKVVL 296
                 E + ++L   +  +   R+TL GPHR DL  IV+  D       GS G+Q+   
Sbjct: 226 EPNVSPENFREQLAKNQFQEIRQRQTLTGPHRDDLNFIVNGTD---IRRFGSQGQQRTAA 282

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           + + LA   L+       P+LLLD++ + LD  ++  L   +T I + I  TG D+ V
Sbjct: 283 LSLKLAEIELVKKIVKDYPVLLLDDVLSELDSKRQEHLLSEITHIQTLITCTGLDEFV 340


>gi|158319063|ref|YP_001511570.1| DNA replication and repair protein RecF [Alkaliphilus oremlandii
           OhILAs]
 gi|166918719|sp|A8MEA3|RECF_ALKOO RecName: Full=DNA replication and repair protein recF
 gi|158139262|gb|ABW17574.1| DNA replication and repair protein RecF [Alkaliphilus oremlandii
           OhILAs]
          Length = 365

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 164/346 (47%), Gaps = 9/346 (2%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L +  +RNY  + L F  +  +F+GDN  GKTN++E+I   S G+ FR     ++  
Sbjct: 3   VEELKLINYRNYEQMNLKFHPRLNVFIGDNAQGKTNLIESIYLCSAGKSFRTNHDQELIN 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           +        +  V+  +  +D+ I++    +R  + L++N + +  + EL  +L +    
Sbjct: 63  MNKK---QAYIHVKVKKVHSDVHIEVRLNSERK-KDLKVNQIPLVKMGELLGNLNVVLFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P   ++      ERRRF+DR +  I  +    +  + ++++ RN+LL             
Sbjct: 119 PEDLKLVKEGPSERRRFMDREISQISTKFYYTLSQYNKILQHRNKLLKYNKGKEIDIEVW 178

Query: 187 EAQMAELGVKINIARVEMINALSSL--IMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
           + Q+A  G  + + R   I  +S L  +M     E+  ++++     +  K +     +K
Sbjct: 179 DEQLAAAGAWLIVYRRNFIKKISILAKLMHRKITESIENLEVIYEPNVKVKENDEVDVIK 238

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E+  + L +   +D     T  GPHR D+I+      +   +GS G+Q+  ++ + LA  
Sbjct: 239 EKILQNLKENFNVDKQRGLTTCGPHRDDMILKINGLDVK-TYGSQGQQRTAVLSLKLAEL 297

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
            L+    G  PILLLD++ + LD  +++ L   +  +  Q F+T T
Sbjct: 298 ELVKGEVGEYPILLLDDVMSELDSKRQHYLIHNLKSV--QTFITTT 341


>gi|24380484|ref|NP_722439.1| recombination protein F [Streptococcus mutans UA159]
 gi|51316462|sp|Q8DRR3|RECF_STRMU RecName: Full=DNA replication and repair protein recF
 gi|24378515|gb|AAN59745.1|AE015036_4 putative RecF protein, ATPase involved in DNA repair [Streptococcus
           mutans UA159]
          Length = 363

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 169/374 (45%), Gaps = 20/374 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ +N+  +RNY ++   F     +FVG N  GKTN LEAI FLS  R  R  S  ++ +
Sbjct: 3   IEKINLKHYRNYTAIESEFSQSLNVFVGQNAQGKTNFLEAIYFLSLTRSHRTRSDKELIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G          V G+    +  I LE       R  +IN +    + +    + +    
Sbjct: 63  FGQKEL-----NVSGLLNRVNGKIPLEINLSNKGRTTKINYLKQPKLSDYIGTMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +E   D+ +   
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIDLGQIKPIYLSDLSNYNHVLKQRNAYLKSEKKVDTDFLFV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEY-----VQKENFPHIKLSLTGFLDGKFDQSF 240
           ++ Q+ + G K+   R++ I  L+    +Y      Q+E   H+K+S    +  KFD   
Sbjct: 178 LDEQLVDYGSKVIEHRLDFIQNLTKEADKYHFSISNQQE---HLKISYLSSV--KFDHK- 231

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +++ +   L   R+ D   + T +GPHR DL   +    +  + GS G+ + +++ + 
Sbjct: 232 KNIRDNFLNLLQKNRQGDIFKKNTSVGPHRDDLA--FFINQMNASFGSQGQHRSLILSLK 289

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA   L    TG  PILLLD++ + LD  ++  L   + D   Q F+T T       L +
Sbjct: 290 LAEIELTKTVTGDYPILLLDDVMSELDNYRQIKLLEGIKD-NVQTFITTTSLEHLQQLPK 348

Query: 361 TAKFMRISNHQALC 374
             K   I+  + L 
Sbjct: 349 KLKLFTINQGKVLS 362


>gi|326802620|ref|YP_004320438.1| DNA replication and repair protein RecF [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650777|gb|AEA00960.1| DNA replication and repair protein RecF [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 372

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 89/350 (25%), Positives = 159/350 (45%), Gaps = 13/350 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L + +FRNY  + + FD    +F+GDN  GKTN++EAI  LS  R  R A   +V R
Sbjct: 3   LKSLYLKDFRNYDQVTMDFDPGINVFIGDNAQGKTNLIEAIYMLSLARSHRTAKEREVIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G     + FAR+EG     +  I L     +  +  ++N +    + +      +    
Sbjct: 63  FG-----ADFARIEGRVAKKNGEIPLSLTMTKKGKIAKLNRLQQERLSDYIGAFNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDSSW 182
           P    +  G    RR F+DR +  ++P +     +++ L++ RN  L +       D  +
Sbjct: 118 PEDLELVKGAPQLRRTFIDRELSQMNPTYLYDSSNYQHLLKQRNTYLKQLQRREAHDKLY 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
            + +  Q+ +   ++ + R + I  L +       + +     L+L        D++   
Sbjct: 178 LNVLTEQLVDFASRMMVQRFQFIQKLEAYAKPIHAQLSMDKETLTLAYQASLTVDETSTV 237

Query: 243 --LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             LK E   K    ++ +     T IGP R DL +   DK +   +GS G+Q+  ++ + 
Sbjct: 238 DQLKTELMDKFQSIQEREIEVGSTQIGPQRDDLKLMINDKVVQ-QYGSQGQQRTTVLSLK 296

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           LA    +  T G  PILLLD++ + LD+ ++  L + + +   Q F+T T
Sbjct: 297 LAEIECMHETLGEYPILLLDDVLSELDDQRQTHLLKTI-EKKVQTFLTTT 345


>gi|239624130|ref|ZP_04667161.1| DNA replication and repair protein RecF [Clostridiales bacterium
           1_7_47_FAA]
 gi|239520516|gb|EEQ60382.1| DNA replication and repair protein RecF [Clostridiales bacterium
           1_7_47FAA]
          Length = 361

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 94/354 (26%), Positives = 160/354 (45%), Gaps = 22/354 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY  L + F+    I  GDN  GKTNILEA+      +  + A   D+ R
Sbjct: 3   IESIELKNYRNYQELHMEFNQGTNILYGDNAQGKTNILEAVYVCCTSKSHKSAKDRDIIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                S      R   +    D+ +K         + + IN V IR   EL     + + 
Sbjct: 63  FDQDESHIKLQIRKNNVPYRIDMHLK-----KNKPKGIAINGVPIRKASELFGIANVVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  ++  +   ++ + +++  RN+LL E +F   +  +
Sbjct: 118 SPEDLNIIKNGPSERRRFIDMELCQLNKLYVHSLVQYNKVLLQRNKLLKELFFKPEYEET 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG-KFDQSFC 241
           ++    Q+   G ++   R E I+ L+ +I +         I LSL+G  +  +      
Sbjct: 178 LDVWDMQLVNYGKEVIRFRREFIDRLNEIIQD---------IHLSLSGNKEAIRISYEPY 228

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVGIF 300
            L++++ + L   R  D   + TL GPHR D  + +    I I   GS G+Q+   + + 
Sbjct: 229 TLEDQFEQTLKKNRPQDMKQKTTLSGPHRDD--ISFIVNGIDIRRFGSQGQQRTAALSLK 286

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           L+   L+   +   PILLLD++ + LD  ++N L   + DI + I  TG D  V
Sbjct: 287 LSELELVKAVSRDNPILLLDDVLSELDSSRQNHLLSAIQDIQTMITCTGLDDFV 340


>gi|227432903|ref|ZP_03914847.1| recombination protein F [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|227351336|gb|EEJ41618.1| recombination protein F [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 374

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 91/352 (25%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++++ L +  +RNY+ L L F +   +F+G+N  GKTN+LE+I  L+  R  R +S  D+
Sbjct: 1   MELESLKLDHYRNYSDLTLEFSSGVNVFLGENAQGKTNLLESIYVLALARSHRTSSDKDL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +  +    +   RV+       +S+    +  ++    ++N +    +      L +  
Sbjct: 61  VQWQAKE-ATISGRVKRSISETPLSLHFSNKGKKA----RVNHLEQSKLSHYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN----RLLTEGYFDS 180
             P    +  G    RRRF+D     ++P +      ++++++ RN    RL  +   D+
Sbjct: 116 FAPEDLELVKGAPSVRRRFIDMEFGQMNPLYLYNTTQYKQILKERNAYLKRLQLKQTTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKE---NFPHIKLSLTGFLDGKFD 237
            +   +  Q+ ++G +I IAR E +N L  L  + +  E       +KL     +D   D
Sbjct: 176 VFLDVLSEQLVDVGSQILIARQEFLNKL-ELAAQPIHAEISNQREALKLRYMSSVDFASD 234

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            S   +K  +A  L   R  + M   T++GPHR +L  D     + I  GS G+Q+   +
Sbjct: 235 ASLEEVKSVFADALSRQRSREIMQGSTMVGPHRDELQFDVNGNNVAI-FGSQGQQRTTAL 293

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
            I LA   L+   TG  P+LLLD++ + LD  ++  L   + D   Q F+T 
Sbjct: 294 AIKLAEIDLMQQETGEYPVLLLDDVLSELDASRQTHLLLAIQD-KVQTFITA 344


>gi|148656558|ref|YP_001276763.1| DNA replication and repair protein RecF [Roseiflexus sp. RS-1]
 gi|148568668|gb|ABQ90813.1| DNA replication and repair protein RecF [Roseiflexus sp. RS-1]
          Length = 398

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 95/382 (24%), Positives = 179/382 (46%), Gaps = 32/382 (8%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           M   + +  L++ +FRNY  L L  +    +  G N  GKT +LEAI FL+  R  R  +
Sbjct: 1   MVAGMHVSHLSLRDFRNYERLDLTLEPGVILLYGPNAAGKTTVLEAIYFLATTRSPRAGA 60

Query: 61  YADVTR------IGSPSFFSTFARVEGMEGLADISIKLETRDDR--------SVRCLQIN 106
             ++ R      IG P F      V   +G   + + ++ R D         +++ ++++
Sbjct: 61  DRELVRFEAQGDIGVPPFARLVCDVVRADGRVRLEVVVQRRSDEESPGSISPTIKTVRVD 120

Query: 107 DVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLM 166
              +R +D L  +LR+    P+   + +G   ERRR+LD  +  I+ R+ R +  +++++
Sbjct: 121 RKTVRALD-LVGNLRVVLFTPADIALVTGAPAERRRYLDVTLSQIEGRYVRTLAHYQKVV 179

Query: 167 RGRNRLLTEGY-------FDSSWCSSIEAQMAELGVKINIARVEMI---NALSSLIMEYV 216
           + RN LL           +     +  + ++A  G  +   R+  +   NAL+  +   +
Sbjct: 180 QQRNSLLRAWRDGRRPLRYAGDELAFWDRELAMAGAYLLRERLRAVVDLNALAGPLYCRM 239

Query: 217 QKENFPHI---KLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL 273
              + P +   + S+ G +D   D     +++ +   L   R  +    +TLIGPHR DL
Sbjct: 240 SGSDTPLVVTYQSSVAG-IDPASDSRM--IEQAFLAHLVHLRDDEIGRGQTLIGPHRDDL 296

Query: 274 IVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNA 333
           ++   +  +  A+GS G+Q+   + + L  A L+   TG  P+LLLD++ + LD ++R  
Sbjct: 297 LITVGNIPMG-AYGSRGQQRSATLALKLGEAELMRARTGDTPVLLLDDVLSELDAERRAY 355

Query: 334 LFRIVTDIGSQIFMTGTDKSVF 355
           +  ++   G Q  +T T    F
Sbjct: 356 VQDVIERPGQQTIVTATGTDDF 377


>gi|15675937|ref|NP_270111.1| recombination protein F [Streptococcus pyogenes M1 GAS]
 gi|71911668|ref|YP_283218.1| recombination protein F [Streptococcus pyogenes MGAS5005]
 gi|81171138|sp|P0C0D1|RECF_STRP1 RecName: Full=DNA replication and repair protein recF
 gi|13623177|gb|AAK34832.1| RecF protein [Streptococcus pyogenes M1 GAS]
 gi|71854450|gb|AAZ52473.1| DNA replication and repair protein [Streptococcus pyogenes
           MGAS5005]
          Length = 368

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR +L   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDELA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|239993752|ref|ZP_04714276.1| Recombinational DNA repair ATPase [Alteromonas macleodii ATCC
           27126]
          Length = 362

 Score =  115 bits (289), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 167/352 (47%), Gaps = 17/352 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  + I++FRN  S+ L      TI  G+NG GK++++EA+ +L  GR FR   ++ V
Sbjct: 1   MKLDRVQITQFRNLTSVSLSPSPALTIIKGENGSGKSSLIEALYYLGFGRSFRTNKHSSV 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +    S FS FA  +  EG  ++ +  +   + +  C  IN      + +L   + +  
Sbjct: 61  IQNEKDS-FSVFASCKTEEG-DELKLGFQRSRNETFTC-SINGEHSNKLSDLVSLVPLQL 117

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWC 183
             P    +  G   ERRRF D  +F ++ + +     + + ++ RN LL  +    +   
Sbjct: 118 FTPQSTDLIIGSPSERRRFCDWGLFHVEHQFQSLANQYGKFLKHRNALLKQQANLSAPQN 177

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
              E+Q +ELG  ++  R E ++ L+ +  +Y Q E  P+  + L+ +   + D     L
Sbjct: 178 QYWESQFSELGESLSATRQEYVDTLTPIFKQYAQ-EFLPNFDVELSYYKGWEKD---VGL 233

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            E   KK    R+ D     T  GPH++D  L V+  +    +   S G+ ++ +  + +
Sbjct: 234 SESLVKK----REYDGKIGHTSSGPHKADLRLKVNGVNAQELL---SRGQLRMAVAALQM 286

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
           +  +L +  T    I LLD++ A LD DKR      +  + +Q+F+T  + +
Sbjct: 287 SQTKLFNKATQRKSIFLLDDVGAELDADKREQFIDGLLKMDTQVFVTAIEST 338


>gi|228474213|ref|ZP_04058950.1| DNA replication and repair protein RecF [Staphylococcus hominis
           SK119]
 gi|228271908|gb|EEK13245.1| DNA replication and repair protein RecF [Staphylococcus hominis
           SK119]
          Length = 371

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 167/379 (44%), Gaps = 29/379 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  +RNY ++ L    +  I +G+N  GKTN+LE+I  L+  +  R A+  ++
Sbjct: 1   MKLKTLQLENYRNYEAVTLNCHPEVNILIGENAQGKTNLLESIYVLALAKSHRTANDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNSEYAKIEGELSYRHGTMPLTMYITKKGKQVKVNHLEQSRLTQYVGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKTDK 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q A+  + + + R + I  L +L            E +     P IKLS T 
Sbjct: 176 TMLEVLNQQFAQYALNVTLRREQFIEELEALAQPIHAGITNQRETLSLTYLPSIKLSDTS 235

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
               +       L  EY +     R+MD      L GPHR DL  +  D      +GS G
Sbjct: 236 KNKSELLDEVITLLNEYQQ-----REMDRAV--CLYGPHRDDLGFNVNDMDAQ-TYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTI-QYKVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRIS 368
                D  +   AK  RI+
Sbjct: 347 SVDGIDHEIMNNAKLYRIN 365


>gi|139474624|ref|YP_001129340.1| recombination protein F [Streptococcus pyogenes str. Manfredo]
 gi|166221873|sp|A2RH21|RECF_STRPG RecName: Full=DNA replication and repair protein recF
 gi|134272871|emb|CAM31153.1| DNA replication and repair protein RecF [Streptococcus pyogenes
           str. Manfredo]
          Length = 368

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 88/345 (25%), Positives = 159/345 (46%), Gaps = 9/345 (2%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  F-DHSTVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLAGYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTT 339


>gi|171912992|ref|ZP_02928462.1| recombination protein F [Verrucomicrobium spinosum DSM 4136]
          Length = 356

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 96/346 (27%), Positives = 159/346 (45%), Gaps = 24/346 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++++ + +FR +   RL    + T+ VG NG GKT++LEA   L   +  R ++ +D+ R
Sbjct: 3   LEWMQVRDFRCFTEARLALHPETTLLVGKNGQGKTSLLEAACVLMRLQSPRTSTRSDLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQIND-VVIRVVDELNKHLRISWL 125
            G+ +  +     EG+ G      KL      + R + +ND V  R  D L +  R+ W+
Sbjct: 63  FGAQTCVT-----EGVVG----GRKLRVAQSPTARRVAVNDSVCPRAGDYLIQSARVVWM 113

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
             S   +  G +  RRR+LD     + P +   +  +ER +R RN LL       SW   
Sbjct: 114 DHSDMNLARGGAEHRRRYLDFAAAQLFPEYLNALKSYERALRSRNFLLKRDAV-ISW-RQ 171

Query: 186 IEAQ---MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           ++A    +AE G  I   R E++  +   + E        H+ LS  G   G        
Sbjct: 172 VDAYGRILAEHGAAIRRCRDELVQRVQEPVTE-------AHLGLS-AGVEPGAVAYVPGY 223

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             E+    L + R  ++  R T +G HR DL +    +    A  S G+Q+ + + + LA
Sbjct: 224 PGEDLEAALMEVRDSEARLRTTQVGVHRDDLALTIHGRPAG-AFASEGQQRTLCLALKLA 282

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            AR++    G  P+LL+D+I   LD+ +R AL   +   G +I  T
Sbjct: 283 QARVLEEAQGEPPLLLIDDIFGELDKTRRQALLAYLPAHGQKIITT 328


>gi|94989496|ref|YP_597597.1| recombination protein F [Streptococcus pyogenes MGAS9429]
 gi|166221870|sp|Q1JJC0|RECF_STRPC RecName: Full=DNA replication and repair protein recF
 gi|94543004|gb|ABF33053.1| DNA replication and repair protein [Streptococcus pyogenes
           MGAS9429]
          Length = 368

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR +L   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLYQLEKNHQKDFFRKNTSVGPHRDELA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|160941458|ref|ZP_02088793.1| hypothetical protein CLOBOL_06349 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435604|gb|EDP13371.1| hypothetical protein CLOBOL_06349 [Clostridium bolteae ATCC
           BAA-613]
          Length = 361

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 95/354 (26%), Positives = 156/354 (44%), Gaps = 28/354 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY  L + F+    I  GDN  GKTNILEA+      +  + A   D+ R
Sbjct: 3   IESIELKNYRNYKELHMEFNQGTNILYGDNAQGKTNILEAVYVCCTSKSHKSAKDRDIIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                S      R   +    D+ +K         + + IN V IR   EL     + + 
Sbjct: 63  FNQDESHIKLQIRKNNVPYRIDMHLK-----KNKPKGIAINGVPIRKASELFGIANVVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  ++  +   ++ + +++  RN+LL E +F   +  +
Sbjct: 118 SPEDLNIIKNGPSERRRFIDMELCQLNKLYVHSLVQYNKVLLQRNKLLKELFFRPEYEET 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC- 241
           ++    Q+   G ++   R E I  L+ +I           I LSLTG   G+ D S   
Sbjct: 178 LDVWDMQLVNYGREVIKFRREFIKQLNEIIHA---------IHLSLTG---GREDISISY 225

Query: 242 ---ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLV 297
                +++    L   R  D   + TL GPHR D  + +    I I   GS G+Q+   +
Sbjct: 226 EPFTREDQMEDILKKNRAQDMKQKTTLSGPHRDD--ISFIVNGIDIRRFGSQGQQRTAAL 283

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            + L+  +L+   +   PILLLD++ + LD  ++N L   +  I + I  TG D
Sbjct: 284 SLKLSELQLVKQLSHDDPILLLDDVLSELDSSRQNHLLSAIKHIQTMITCTGLD 337


>gi|71904550|ref|YP_281353.1| recombination protein F [Streptococcus pyogenes MGAS6180]
 gi|94993383|ref|YP_601482.1| recombination protein F [Streptococcus pyogenes MGAS2096]
 gi|97180999|sp|Q48QL2|RECF_STRPM RecName: Full=DNA replication and repair protein recF
 gi|166221869|sp|Q1J973|RECF_STRPB RecName: Full=DNA replication and repair protein recF
 gi|71803645|gb|AAX72998.1| DNA replication and repair protein recF [Streptococcus pyogenes
           MGAS6180]
 gi|94546891|gb|ABF36938.1| DNA replication and repair protein recF [Streptococcus pyogenes
           MGAS2096]
          Length = 368

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 167/362 (46%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLASFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  F-DHSTVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R++ INAL      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLAGYGARVMEHRIDFINALEKEANTHHQAISNGLESLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR +L   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDNLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKALTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|167629174|ref|YP_001679673.1| DNA replication and repair protein recf [Heliobacterium
           modesticaldum Ice1]
 gi|226737804|sp|B0TAL0|RECF_HELMI RecName: Full=DNA replication and repair protein recF
 gi|167591914|gb|ABZ83662.1| DNA replication and repair protein recf [Heliobacterium
           modesticaldum Ice1]
          Length = 372

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 170/357 (47%), Gaps = 14/357 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I+ + ++ FRNY  L++ F     IFVG NG GKTN+LE+I+ LS G   R A  A++
Sbjct: 1   MQIQAIELAHFRNYRGLQVDFMPGVNIFVGANGQGKTNLLESIALLSGGGSHRDARDAEM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLAD---ISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
            +     +   + R++ M G AD   + I+L    +R  +  ++N+  +R + +L++ + 
Sbjct: 61  VQ-----WQEAYYRIKAM-GTADGQPVVIELAFGGERR-KLAKVNNRRLRRIADLSETMN 113

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN---RLLTEGYF 178
                P    +  G   +RRR+LDR +    P +   +  + R++  RN   R L EG  
Sbjct: 114 TVVFSPEDLSLVKGSPAQRRRYLDRELSQASPAYGDVLSRYARVLTQRNSLLRRLREGSA 173

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
            ++     + Q+A L V+    R++ +  ++    +  +  +    ++ LT         
Sbjct: 174 TAAELELWDDQLAPLAVETLARRLDGLARIAPYARQIYRGLSRDKEQIELTYRSSFPLPD 233

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
                 E Y K L + R  +   + TL GPHR DL +    +   I +GS G+Q+ + + 
Sbjct: 234 DRSRWLEAYRKALQERRAEEIARQATLTGPHRDDLQLFLNGRDARI-YGSQGQQRSIALS 292

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           + LA    I       PI+LLD++ + LD D+R  L   +     Q+F+T T    F
Sbjct: 293 LKLAEIAFIHQIKKEYPIVLLDDVMSELDPDRRQQLLSELESKNIQVFITTTHLHAF 349


>gi|167759581|ref|ZP_02431708.1| hypothetical protein CLOSCI_01938 [Clostridium scindens ATCC 35704]
 gi|167662808|gb|EDS06938.1| hypothetical protein CLOSCI_01938 [Clostridium scindens ATCC 35704]
          Length = 363

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 105/365 (28%), Positives = 162/365 (44%), Gaps = 38/365 (10%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI+ L +  FRNY  L+L FD    IF GDN  GKTNILEA+      +  R A   D+
Sbjct: 1   MKIESLKLKNFRNYDLLKLEFDEATNIFYGDNAQGKTNILEAVYLSGTTKSHRGAKDRDL 60

Query: 65  TRIG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            +   + S         G+    D+ +K       S + + IN + IR   EL   + + 
Sbjct: 61  IKFDQNESHIEAIVERNGINYQIDMHLK-----KNSPKGIAINKMPIRKASELFGIVNLV 115

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS-- 181
           +  P    I      ERRRF+D  +  +D  +   + ++ R++  RN LL +  F     
Sbjct: 116 FFSPEDLNIIKNGPSERRRFVDLELSQLDKVYLNDLSNYNRIVNQRNHLLKDMGFGKQQD 175

Query: 182 -------WCSSIEAQMAELGVKINIAR---VEMINALSSLIMEYVQ--KENFPHIKLSLT 229
                  W    + Q+ + G +I   R   VE IN + S I   +   KEN   I     
Sbjct: 176 LMDTLDIW----DLQLIQYGTRIIDRRKKIVEEINKIISSIHGKLTGGKENLQVIYEPSN 231

Query: 230 GFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
           G L          L++  A+ L    +M S S    +GPHR D+     D  I   +GS 
Sbjct: 232 GSL---------TLEQALARNLERDLRMKSTS----VGPHRDDICFMAGDLDIR-RYGSQ 277

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           G+Q+   + + L+   L+       P+LLLD++ + LD+ ++N L   + DI + I  TG
Sbjct: 278 GQQRTAALSLKLSEIELVKQAIHDTPVLLLDDVLSELDKHRQNYLLDSIHDIQTLITCTG 337

Query: 350 TDKSV 354
            D+ V
Sbjct: 338 VDEFV 342


>gi|153815426|ref|ZP_01968094.1| hypothetical protein RUMTOR_01661 [Ruminococcus torques ATCC 27756]
 gi|317500888|ref|ZP_07959100.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331089210|ref|ZP_08338112.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847285|gb|EDK24203.1| hypothetical protein RUMTOR_01661 [Ruminococcus torques ATCC 27756]
 gi|316897768|gb|EFV19827.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330405762|gb|EGG85291.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 362

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 161/353 (45%), Gaps = 19/353 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L L FD +  I  GDN  GKTNILEA+      +  R     DV +
Sbjct: 3   IKSLKLKNYRNYDLLDLKFDPKTNILYGDNAQGKTNILEALYLSGTTKSHRGTKDRDVIQ 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   S   T      ++   D+ +K       S + + I+ V IR   EL   +   + 
Sbjct: 63  FGYDESHIETIIEKRNIDFQIDMHLK-----KNSPKGIAIDKVPIRRAGELFGIVHFVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I       RRRF+D  +  +D  +   + ++ R++  RN LL + Y   +   +
Sbjct: 118 SPEDLNIIKEGPAGRRRFIDLELSQLDKIYLNNLSNYNRIINQRNSLLKDIYGQRNLIET 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + Q+AE G KI   R + I  ++ +I +   K      +++LT      ++ S   
Sbjct: 178 LDIWDMQLAEYGKKILERRKQFIKQVNDIIADIHYKLTGGKERITLT------YESSLGN 231

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGIFL 301
           +  E A  L   R+ D   + T +GPHR D+     D  + I   GS G+Q+   + + L
Sbjct: 232 ITFETA--LSKYRERDLRMKSTTVGPHRDDICF-TTDAGLDIRKFGSQGQQRTAALSLKL 288

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           +   L+       PILLLD++ + LD+ ++N L   + +I + I  TG D+ V
Sbjct: 289 SEIELVKEELNDTPILLLDDVLSELDKHRQNYLLDSIDNIQTIITCTGLDEFV 341


>gi|309791752|ref|ZP_07686242.1| DNA replication and repair protein RecF [Oscillochloris trichoides
           DG6]
 gi|308226245|gb|EFO79983.1| DNA replication and repair protein RecF [Oscillochloris trichoides
           DG6]
          Length = 390

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 103/387 (26%), Positives = 180/387 (46%), Gaps = 31/387 (8%)

Query: 11  NISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR---- 66
           ++ +FRNY  + L      T+F G N  GKT++LEA+ +L+  R  R  S  D+ R    
Sbjct: 5   SLRDFRNYQRIDLQLAPGITLFYGSNASGKTSLLEALFYLATTRSPRSRSDHDLVRWDAQ 64

Query: 67  --IGSPSFFSTFARVEGMEGLADISIKLETRDDR-------SVRCLQINDVVIRVVDELN 117
              G   F    A VE   G   + + ++ R D        + + ++++    R +D L 
Sbjct: 65  GEAGVLPFARVAAEVERRMGRVRLEVLVQRRADEDGQLTNGAQKLVRVDKRPARALD-LV 123

Query: 118 KHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY 177
             LR+    P    +  G   ERRR++D  +  +DPR+ R +  ++R+++ RN +L    
Sbjct: 124 GQLRVVLFTPVDLALVDGPPAERRRYIDITLSQLDPRYVRTLAQYQRIVQQRNSMLRAWR 183

Query: 178 FDSSWCSSIEAQMAELGVKINIA-------RVEMINALSSLIME-YVQKENFPHIKLSLT 229
                   I+ ++A    +++ A       R+  IN L+ ++   +      PH  LS+T
Sbjct: 184 ERRRPLRGIDDELAYWDQELSQAGGFLLAERLRAINELNQIVGPLFGAISGEPH-PLSIT 242

Query: 230 GFLDGKFDQSFCA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIA-H 286
                + D +  A  L +  + +L   R+ +    +TLIGPHR D+   +    I +  +
Sbjct: 243 YRASIELDAALTAPDLSQRLSAELRRLRQDEVARGQTLIGPHRDDM--SFSVAGIDLGRY 300

Query: 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIF 346
           GS G+Q+ V + + L  A L+   +G  P+LLLD++ + LD  +R  L   +     Q  
Sbjct: 301 GSRGQQRSVTLALKLGEAELMRQRSGETPVLLLDDMLSELDTQRRTHLIAAIRRPAQQTV 360

Query: 347 MTGTDKSVFDS--LNETAKFMRISNHQ 371
           +T TD   F +  L E ++ MR+   Q
Sbjct: 361 LTATDLGDFGATFLAEISR-MRVEGGQ 386


>gi|322412900|gb|EFY03808.1| recombination protein F [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 368

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 165/362 (45%), Gaps = 12/362 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L   F +   +F+G+N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IKELELKHYRNYDHLLTSFSSGLNVFIGNNAQGKTNFLEAIYFLSLTRSHRTRADKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               S  S   +++ + G  D+ I L  +     R  +IN +    + +    + +    
Sbjct: 63  FDH-STVSLTGKIQRISGTVDLEINLSDKG----RVTKINALKQAKLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D+++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSELSHYNHVLKQRNSYLKSAQQIDAAFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+A  G ++   R+  IN L      + Q  +     LSL+      FD+    + +
Sbjct: 178 LDEQLASYGTRVMEHRINFINTLEKEANTHHQAISNGLENLSLSYQSSVVFDKK-TNIYQ 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++  +L    + D   + T +GPHR DL   +    +     S G+ + +++ + +A   
Sbjct: 237 QFLHQLEKNHQKDFFRKNTSVGPHRDDLA--FYINGMNANFASQGQHRSLILSLKMAEVS 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T     D L++  + +
Sbjct: 295 LMKVLTGDNPILLLDDVMSELDNTRQTKLLETVIKENVQTFITTTS---LDHLSQLPEGI 351

Query: 366 RI 367
           RI
Sbjct: 352 RI 353


>gi|89892749|ref|YP_516236.1| DNA replication and repair protein recF [Desulfitobacterium
           hafniense Y51]
 gi|219666074|ref|YP_002456509.1| DNA replication and repair protein RecF [Desulfitobacterium
           hafniense DCB-2]
 gi|122484263|sp|Q252K0|RECF_DESHY RecName: Full=DNA replication and repair protein recF
 gi|254790474|sp|B8FXW8|RECF_DESHD RecName: Full=DNA replication and repair protein recF
 gi|89332197|dbj|BAE81792.1| DNA replication and repair protein recF [Desulfitobacterium
           hafniense Y51]
 gi|219536334|gb|ACL18073.1| DNA replication and repair protein RecF [Desulfitobacterium
           hafniense DCB-2]
          Length = 365

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 94/354 (26%), Positives = 169/354 (47%), Gaps = 21/354 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++IK+L++  FRNY    + F    TI  G+NG GKTNILE I +L  G+ +R     ++
Sbjct: 1   MEIKWLHLKSFRNYQDQEVDFRPGLTILQGENGQGKTNILEGIYYLLTGKSYRVHREQEL 60

Query: 65  TRIGSPSF--FSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
            R G   F  +  F        +    ++LE+      + ++IN +  R + E    + +
Sbjct: 61  ARWGENEFHLYGDFI-------VQRRKLRLESHYQDKRKIIKINQIPCRKLSEYVGTINV 113

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS-S 181
            +  P    +  G   ERRRFLD  +     +H + +  + ++++ +N LL +G   S S
Sbjct: 114 VFFSPDDLVMVKGGPAERRRFLDLHIAQHHSKHIQLLNAYNKVLQQKNALLKQGQGGSKS 173

Query: 182 WCSSIE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK--F 236
             + IE    Q+  +G +I   R E    LS    E   + +    +L++     GK   
Sbjct: 174 QIAQIELWNEQILRIGSEIIRNRWEFTGLLSRKGQEIYGQISSGKEELTMDYHALGKNNL 233

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           +++  A  +  A+K+     ++   +  LIGPHR D++    +++  + +GS G+Q+ ++
Sbjct: 234 EEALAAFPKLLAEKM----SLEMERKMVLIGPHRDDILFKLNERSARL-YGSQGQQRSIV 288

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +   LA   +I    G  P+LLLD++ + LD  +R+ L      +  Q  MT T
Sbjct: 289 LSTKLAELEVIRQEKGDYPLLLLDDVLSELDRFRRDYLLDYTKSL-QQTIMTMT 341


>gi|78185894|ref|YP_373937.1| RecF protein [Chlorobium luteolum DSM 273]
 gi|123730146|sp|Q3B6Y7|RECF_PELLD RecName: Full=DNA replication and repair protein recF
 gi|78165796|gb|ABB22894.1| RecF protein [Chlorobium luteolum DSM 273]
          Length = 369

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 170/363 (46%), Gaps = 25/363 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++K + +  FRN+ SL    +   T+  G NG GKT++LEAI + +  +    A  ++ 
Sbjct: 1   MRLKNIQVENFRNHHSLAFQPEEGITVLYGPNGSGKTSVLEAIHYCALTKSLLGAPESEC 60

Query: 65  TRIGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
                  F     F    G      +S+K+    DR  + +Q+N   ++   +    +  
Sbjct: 61  LAFSEEYFIISGEFVSTRG----TSLSVKVSYGKDRG-KLVQLNQSEVKPFSQHVGTIPC 115

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
               PS   I +G   ERRRFLD  +   D R+   ++D+ R+++ RN LL +    SS 
Sbjct: 116 ITFSPSEIAIVNGSPGERRRFLDNALSQSDRRYLDELLDYRRVLQQRNALLLQ--LASSS 173

Query: 183 CSSIE------AQMAELGVKINIARVEMINALSSLIMEYVQKE---NFPHIKLSLTGFLD 233
             S E        +A+L   + + R+  +  LS +  E +Q        H+    + F  
Sbjct: 174 GGSREMLDLWTENLADLAAGVTLRRISFLGELS-VYFEPLQTSLAGKGSHLVTYRSSF-- 230

Query: 234 GKFDQSFC--ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
           G  D       L++ Y K+  + ++ + +  +T+ GPHR DL+     + I   +GS G+
Sbjct: 231 GTIDSGLSRDELRDRYIKRFKETQRQELLRTQTMSGPHRDDLLFLSNGREIK-KYGSQGQ 289

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           Q+  L+ + LA  R  S+    +PI L D++ + LD ++ + +F I+ D G Q  +T TD
Sbjct: 290 QRAFLISLKLALFRYFSHRLPESPICLFDDMFSELDAERTSEIFNILEDCG-QTILTTTD 348

Query: 352 KSV 354
            S+
Sbjct: 349 GSL 351


>gi|326692338|ref|ZP_08229343.1| DNA replication and repair protein RecF [Leuconostoc argentinum
           KCTC 3773]
          Length = 375

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 167/354 (47%), Gaps = 19/354 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L ++ +RNYA L L F A   +F+G+N  GKTN+LE+I  L+  R  R +S  D+
Sbjct: 1   MELTSLTLTNYRNYADLTLDFSAGVNVFLGENAQGKTNLLESIYVLALARSHRTSSDKDL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  + S  +   RV+       +++   T+  ++    ++N +    + +    L +  
Sbjct: 61  IRWQANS-ATISGRVKKNVSETPLALHFSTKGKKA----RVNHLEQSKLSQYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN----RLLTEGYFDS 180
             P    +  G    RRRF+D     ++P +      + R+++ RN    RL  +   D 
Sbjct: 116 FAPEDLDLVKGAPSVRRRFIDMEFGQMNPLYLYNTTQYRRILKDRNAYLKRLQMKQTTDK 175

Query: 181 SWCSSIEAQMAELGVKINIAR---VEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD 237
            + S + AQ+ ++G ++ +AR   +E +   +  I   +  +    + L+    +  K D
Sbjct: 176 VFLSVLTAQLVDVGAQVFLARRRFLERLQVAAQPIHAEISNQQ-ETLTLAYQTGVAFKRD 234

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGSTGEQKVV 295
                +K  +   L      + M   TL+GPHR D+  IV+  D A+    GS G+Q+  
Sbjct: 235 DDLETVKAAFEAALARQEAREIMQGTTLVGPHRDDIKFIVNENDVAV---FGSQGQQRTT 291

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
            + + LA   L+   TG  P+LLLD++ + LD +++  L   + D   Q F+T 
Sbjct: 292 ALAVKLAEIDLMQEETGEYPVLLLDDVLSELDANRQTHLLLAIQD-KVQTFITA 344


>gi|331083522|ref|ZP_08332634.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330404215|gb|EGG83763.1| DNA replication and repair protein recF [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 361

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 94/353 (26%), Positives = 162/353 (45%), Gaps = 26/353 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY SL L FD    IF GDN  GKTNILEA    S  +  R +   ++ +
Sbjct: 3   IESIELKNYRNYNSLALEFDKGTNIFYGDNAQGKTNILEAAYLCSTTKSHRGSKDKEMIK 62

Query: 67  I-GSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                +    F   +G+    D+ +K         + + I+ + IR   EL   L I + 
Sbjct: 63  FDADEAHIRMFVNKDGISRKIDMHLK-----KSKPKGIAIDGIPIRKASELFGLLNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   +  +  ++  RN+LL +  F  S   +
Sbjct: 118 SPEDLNIIKNGPGERRRFMDLELCQLDKLYLSNLSSYNHVLNQRNKLLKDIAFQESLKDT 177

Query: 186 IE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGF---LDGKFDQS 239
           +E    Q  + G +I   R   I+ ++  IME +          S+TG    ++  ++ S
Sbjct: 178 LEIWDEQFVQYGKEIIETRRRFIDEING-IMEKIHS--------SITGNREKIELVYEPS 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVG 298
                E + ++L   R+ D   ++T +GPHR D  V      I I  +GS G+Q+   + 
Sbjct: 229 VS--DENFYQELSKNREKDCRFKQTSVGPHRDDFSVKV--NGIDIRRYGSQGQQRTAALS 284

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           + L+   ++       P+LLLD++ + LD +++N L   ++ + + I  TG D
Sbjct: 285 LKLSEIYMVKKVIKDMPVLLLDDVLSELDSNRQNYLLNSISHVQTMITCTGLD 337


>gi|253681218|ref|ZP_04862016.1| DNA replication and repair protein RecF [Clostridium botulinum D
           str. 1873]
 gi|253562456|gb|EES91907.1| DNA replication and repair protein RecF [Clostridium botulinum D
           str. 1873]
          Length = 360

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/370 (24%), Positives = 176/370 (47%), Gaps = 23/370 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY +L L F     +F+G+N  GKTNILE+I + S G+  R     ++ +
Sbjct: 3   IKNLQLVNFRNYENLVLEFSEGINVFIGNNAQGKTNILESIYYCSIGKSHRTNKDKELIK 62

Query: 67  IGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            GS  ++ S +     ++   DI +  E +     + +++N + ++ + +L     +   
Sbjct: 63  WGSKNAYVSIYVCKNRLDKKIDIKVFKEGK-----KGIKVNSIKLKTISDLIGTFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I     + RR+FLD  +  ++ ++   ++ + +++  RN +L     +      
Sbjct: 118 SPEDLKIVKESPLYRRKFLDIELSKLNKKYYYSLVRYNKVLNERNAILRRWNSNKDVTEV 177

Query: 186 IEAQMAELGVKINIARVEMINALS---SLIMEYV--QKENFPHIKLSLTGFLDGKFDQSF 240
            + Q+++ G  I   R++ I +LS     I + +  QKEN     ++          ++F
Sbjct: 178 YDQQLSKYGSFIIKERLKYIESLSIKGKRIHDEITSQKENIEFKYITCI--------KNF 229

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             ++ E+ + L    + D     T  GPHR D I++  +   T   GS G+Q+  ++ I 
Sbjct: 230 NNIESEFFEILRKNLEKDFEKGSTSFGPHRDDFIIN-INNTDTRTFGSQGQQRTAILTIK 288

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD-KSVFDSLN 359
           LA   +I   TG  P+LLLD++ + LD +++  +   +     Q  +TGT   ++ D L+
Sbjct: 289 LASLEIIKEQTGEYPVLLLDDVLSELDINRQKYILNSIKKF--QTIITGTGILNIKDYLD 346

Query: 360 ETAKFMRISN 369
              K   ++N
Sbjct: 347 NHVKLFEVTN 356


>gi|15612567|ref|NP_240870.1| recombination protein F [Bacillus halodurans C-125]
 gi|13959499|sp|Q9RC99|RECF_BACHD RecName: Full=DNA replication and repair protein recF
 gi|5672650|dbj|BAA82688.1| 63%-identity [Bacillus halodurans]
 gi|10172616|dbj|BAB03723.1| DNA repair and genetic recombination [Bacillus halodurans C-125]
          Length = 371

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 89/352 (25%), Positives = 167/352 (47%), Gaps = 12/352 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I+ L + +FRNY  L + F+    + +G+N  GKTN++EAI FL+  +  R A   ++
Sbjct: 1   MHIERLTLKQFRNYDELDVSFEPNVNVIIGENAQGKTNVIEAIYFLALAKSHRTARDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            +  +P     FAR+EG     +  + L        + +++N +  R + +    + +  
Sbjct: 61  IQWEAP-----FARIEGAFQKQNGPLSLHVVLSGKGKKVKVNGLEQRRLSDYIGAVNVVM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P    +  G    RRRFLD  +  + P +  ++  +++++  RN LL + +  ++   
Sbjct: 116 FGPEDLNLVKGSPQIRRRFLDMELGQMSPVYLHQLAMYQKILLQRNHLLKQLFGKANSDP 175

Query: 185 SIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ--S 239
            ++    Q+ E+ V++   R E I  L     E  Q  +    KL +T        +  +
Sbjct: 176 MLDVLTDQLIEVAVEVTKKRFEFIQLLQRWAEEIHQAISRGKEKLVITYEPSVHVSEQLN 235

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L+E + +     ++ +     TL GPHR DL+    DK +   +GS G+Q+   + +
Sbjct: 236 LSKLREGFYQAYEQKKERERQRGTTLFGPHRDDLVFFVNDKDVQ-TYGSQGQQRTTALSL 294

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            LA   L+  T G  PILLLD++ + LD+ +++ L   +     Q F+T T+
Sbjct: 295 KLAEIELMKETVGDYPILLLDDVLSELDDYRQSHLLHAIQH-RVQTFVTTTN 345


>gi|319940193|ref|ZP_08014546.1| DNA replication and repair protein recF [Streptococcus anginosus
           1_2_62CV]
 gi|319810664|gb|EFW06994.1| DNA replication and repair protein recF [Streptococcus anginosus
           1_2_62CV]
          Length = 365

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 161/372 (43%), Gaps = 30/372 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  FRNY +  + F +   IF+G N  GKTNILEAI FL+  R  R  S  D+  
Sbjct: 3   LKNLQIQHFRNYEATEIDFHSGLNIFLGQNAQGKTNILEAIYFLALTRSHRTRSDKDLIY 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               +      ++ G       +I LE       R  ++N +    + +   ++ +    
Sbjct: 63  FSKDTL-----KISGQLVKQTGNISLEIDLTPKGRITKVNHLKQSKLSDYVGNMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L T    D ++ + 
Sbjct: 118 PEDLQLIKGAPALRRKFIDIELGQIKPIYLSDLSHYHHVLKQRNTYLKTAKTMDETFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIK-LSLTGFLDGKFDQSFCA-- 242
           ++ Q+ E G ++   R+E +  L          E+F   K L L+  L+      +C+  
Sbjct: 178 LDDQLVEFGCRVMQHRIEFLKKL----------EHFGQQKHLELSSHLEN-LTIKYCSSV 226

Query: 243 -------LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
                  LKE +   L   R  D   + T +GPHR D+     D  +    GS G+ + V
Sbjct: 227 PLSDSNKLKESFQIALKQSRSRDLFKKNTGVGPHRDDIAFYIND--MNANFGSQGQHRSV 284

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           ++ + LA   L+   T   PILLLD++ + LD  ++  L   ++    Q FMT T     
Sbjct: 285 VLSLKLAEIELMETVTKEKPILLLDDVMSELDNSRQLNLLETISQ-NIQTFMTTTTLEHL 343

Query: 356 DSLNETAKFMRI 367
            S+    K   I
Sbjct: 344 QSMPSNIKIFSI 355


>gi|229829521|ref|ZP_04455590.1| hypothetical protein GCWU000342_01613 [Shuttleworthia satelles DSM
           14600]
 gi|229791952|gb|EEP28066.1| hypothetical protein GCWU000342_01613 [Shuttleworthia satelles DSM
           14600]
          Length = 365

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 106/376 (28%), Positives = 165/376 (43%), Gaps = 31/376 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +S +RNY SL + FD    I  GDN  GKTNILE+I      R  R A   ++ R
Sbjct: 3   IQSIELSNYRNYRSLEMEFDRGTNILFGDNAQGKTNILESIYLSGTSRSHRTARDRELIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +   T  R   +    DI I+         + + IN V ++   +L   L I + 
Sbjct: 63  FGQEEAHIRTNVRKNDLSYCIDIHIR-----QAKSKGIAINGVPVKKASDLFGLLGIIFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I     +ERR F++  +  ID  +   + ++ + +  RN LL +G  D      
Sbjct: 118 SPEDLNIVKNGPVERRHFINAELSQIDRIYLSDLSNYNKALNQRNSLL-KGILDHPELRE 176

Query: 186 I----EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-----LTGFLDGKF 236
                + Q+   G ++   R E I  L  ++ E        H KLS     L    +   
Sbjct: 177 TLDVWDGQLVSYGKRLIARRREFIADLIPIVREI-------HRKLSGGIEDLLLAYEPNI 229

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           D +F      +  +LF  R  D     T +GPHR DL +      I    GS G+Q+   
Sbjct: 230 DDTF------FEDELFRARDRDMRMGTTTVGPHRDDLKLSIASVDIR-RFGSQGQQRTCA 282

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + + LA  +++    G  PILLLD++ + LD +++N L   + DI + I  TG D+ V +
Sbjct: 283 LSLKLAEIQMMEAKRGEKPILLLDDVLSELDSNRQNYLLESINDIQTIISCTGLDEFVKN 342

Query: 357 SLNETAKFMRISNHQA 372
             +   +   ISN QA
Sbjct: 343 KFS-VHRVYEISNGQA 357


>gi|325265439|ref|ZP_08132162.1| DNA replication and repair protein RecF [Clostridium sp. D5]
 gi|324029297|gb|EGB90589.1| DNA replication and repair protein RecF [Clostridium sp. D5]
          Length = 361

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 161/358 (44%), Gaps = 30/358 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  +RNY  L L FD +  I  GDN  GKTN+LEA+      +  R     D+ +
Sbjct: 3   IKSLKLKNYRNYELLDLTFDPKTNILYGDNAQGKTNVLEALYLSGTTKSHRGTKDRDLIQ 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                +   T     G+E   D+ +K       S + + IN + IR   EL   +   + 
Sbjct: 63  FERDEAHLETIVEKRGIEYQIDMHLK-----KNSPKGIAINKIPIRKASELFGIIHFVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I       RRRF+D  +  +D  +   + ++ R++  RN LL + Y   +   +
Sbjct: 118 SPEDLNIIKDGPSGRRRFIDLELSQLDKVYLSNLSNYNRIINQRNSLLKDIYKQENLRET 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG---KFDQS 239
           +   + Q+ E G K+  +R   I  ++ +I          +I   LTG  +     ++ S
Sbjct: 178 LDIWDMQLVEYGTKVMESRKRFIEDVNEII---------SNIHYKLTGGKENITLSYECS 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI---AHGSTGEQKVVL 296
              L  E A K    R+ D   + T +GPHR DL    C  A ++     GS G+Q+   
Sbjct: 229 VGNLTLEQALK--KNRERDMRLKSTSVGPHRDDL----CFMAGSLDIRKFGSQGQQRTAA 282

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           + + L+   L+ +     P+LLLD++ + LD+ ++N L   + DI + I  TG D+ V
Sbjct: 283 LSLKLSEIELVRSLIRDTPVLLLDDVLSELDKHRQNYLLDSIHDIQTVITCTGLDEFV 340


>gi|224477953|ref|YP_002635559.1| recombination protein F [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254790488|sp|B9DPX1|RECF_STACT RecName: Full=DNA replication and repair protein recF
 gi|222422560|emb|CAL29374.1| DNA repair and genetic recombination protein [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 370

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 101/381 (26%), Positives = 168/381 (44%), Gaps = 34/381 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNALQLENYRNYEEVVLDCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG        + L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNAEYAKIEGELSYRHGKMPLTMFITKKGKKVKVNHLEQHRLTQYVGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQVRRRFIDMELGQISAVYLNDLSQYQRILKQKNNYLKQLQMKQKTDR 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q AE  +KI + RV  IN L +L            E +  E  P +KLS   
Sbjct: 176 TMLEVLNQQFAEYALKITLKRVHFINELETLAKPIHSSITDERETLDLEYRPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGS 288
                 +     L EE  K L D  + +      L GPHR DL   V+  D      +GS
Sbjct: 233 -----EETDEAKLYEEVQKLLQDNMEREIERGVALYGPHRDDLGFKVNEMDAQ---TYGS 284

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            G+Q+   + I LA   LI+   G  PILLLD++ + LD+ ++  L   + D   Q F+T
Sbjct: 285 QGQQRTTALSIKLAEIELINIEVGEYPILLLDDVLSELDDSRQTHLLSTIQD-KVQTFVT 343

Query: 349 GTDKSVFD-SLNETAKFMRIS 368
            T     D  + + AK  RI+
Sbjct: 344 TTSVEGIDHEIMKHAKLYRIN 364


>gi|262277740|ref|ZP_06055533.1| putative DNA replication and repair protein RecF [alpha
           proteobacterium HIMB114]
 gi|262224843|gb|EEY75302.1| putative DNA replication and repair protein RecF [alpha
           proteobacterium HIMB114]
          Length = 363

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 98/367 (26%), Positives = 181/367 (49%), Gaps = 20/367 (5%)

Query: 10  LNISEFRNYA--SLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRI 67
           +NI  F+++   +L +  D QH I  GDNGVGKTN++E++SF S  +G R  +   +   
Sbjct: 7   INIKNFKSHKQYNLEISKDYQHIIIYGDNGVGKTNLIESLSFFSNSKGLRGDTLDKLLPE 66

Query: 68  GSPSFFSTF--ARVEGMEGLADISIKLETRDDRSVR---CLQINDVVIRVVDELNKHLRI 122
              +   T   A++       + S K+ T+D  +++    L+   + +  + E+   L  
Sbjct: 67  QETNIIDTNIQAKILSNSNQFNFSFKI-TKDQENLKKTFFLEEKKISLPKIKEI---LSF 122

Query: 123 SWLVPSMDRI-FSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
            WL P MD+I + G S+ +R F+D+++   +      +  +++ +  R ++L     D  
Sbjct: 123 IWLSPYMDKIMYEGQSI-KRDFIDKLISQNEKNFNLSVSSYKKNIAERLQILKNTK-DEK 180

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
           W   IE ++AE   +I + R    N ++ +I + ++  NF  I +     L    ++   
Sbjct: 181 WLDIIEKRLAENIYEIFLMRRNYANKINKIISDKLK--NFREINIKYNNDLFEDLNEKKI 238

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            + E + +KL   R++D +++RT  G ++  +      K       STGEQK  L+ I L
Sbjct: 239 KI-EIFFEKLKSNRELDEITKRTNFGINKDQIFFFDKIKNRNTDACSTGEQKSSLLTIIL 297

Query: 302 AHA-RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           A+  +L      F  ILLLDE ++H+D+     L   +   G+QI+ TGT K++F ++  
Sbjct: 298 ANCWKLKIEKKDF--ILLLDEATSHIDDQNFGRLVTEIEKFGTQIWYTGTSKNLFQAIEN 355

Query: 361 TAKFMRI 367
              F+ +
Sbjct: 356 KGFFIHL 362


>gi|116512900|ref|YP_811807.1| recombination protein F [Lactococcus lactis subsp. cremoris SK11]
 gi|123025165|sp|Q02WH8|RECF_LACLS RecName: Full=DNA replication and repair protein recF
 gi|116108554|gb|ABJ73694.1| DNA replication and repair protein RecF [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 359

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 96/333 (28%), Positives = 156/333 (46%), Gaps = 25/333 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K + +  FRNY  L+L F     IF+G N  GKTNILEAI FL+  R  R +   ++
Sbjct: 1   MKLKQIELKNFRNYEDLKLDFHPNLNIFLGQNAQGKTNILEAIHFLALTRSHRTSHDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                  +     +V G+   A  ++ LE +     R  + N +    + +    L+I  
Sbjct: 61  I-----CWSGQEMKVSGLVEKAHATVPLEVQLSSKGRIAKANHLKENRLADYIGQLKILM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT--EGYFDSSW 182
             P    +  G    RRRF+D  +  I   +    + + R ++ RN  L   +   D ++
Sbjct: 116 FAPENLELVKGSPATRRRFMDIELGQIHAVYLYDSMRYNRALKERNAYLKFDQAKIDKNF 175

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG---KFDQS 239
            + ++ Q+AE G KI   R   I  L      + +K     I   LT  L+     ++Q+
Sbjct: 176 LTVLDEQLAEHGNKIMFERKTFIEKLEI----HAKK-----IHEQLTHGLETLKITYNQN 226

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLVG 298
              +K +++K+L   +  D    +T +GPHR DL   +    I +A  GS G+Q+ V + 
Sbjct: 227 ---VKTDFSKELLSRQDHDIFRHQTTVGPHRDDL--QFFINEINVADFGSQGQQRTVALS 281

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKR 331
           I LA   LI   TG  PILLLD++ + LD  ++
Sbjct: 282 IKLAEIDLIFEETGEYPILLLDDVMSELDNHRQ 314


>gi|313885421|ref|ZP_07819171.1| DNA replication and repair protein RecF [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619151|gb|EFR30590.1| DNA replication and repair protein RecF [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 327

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 91/335 (27%), Positives = 150/335 (44%), Gaps = 16/335 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K +++S +RNY++L+L  +   TI VG+N  GKTN+LEAI  LS  +  R     ++
Sbjct: 1   MKLKSIHLSHYRNYSNLQLELNDGLTILVGNNAQGKTNLLEAIFLLSVTKSHRTNHDQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            + G       FA VEG     + S  L  +     +  + N +    +      L +  
Sbjct: 61  IQWG-----QDFALVEGQVQTENYSYPLSLQISSKGKQAKFNYIDQAKLSSFIGKLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P   +I  G    RR+F+D  +    P + + ++ + RL++ RNR L +      FD 
Sbjct: 116 FAPEDLQIIKGAPGLRRKFIDTELGQSHPVYLQELLTYHRLLKQRNRYLKDYGRSTKFDD 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--- 237
            +   +  Q  E  VK+   R + +  L+ L  E   +E     K  LT   D       
Sbjct: 176 LYFEVLSQQFIEQAVKVIGYRTKFVQDLARLAQEI--QEELSGQKDQLTISYDASHSRLN 233

Query: 238 -QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
            Q    L + +       ++ +     TL GPHR DL   Y D       GS G+Q+ ++
Sbjct: 234 YQEIDQLAQAFTDLFAANQQREKDQGVTLYGPHRDDLSF-YLDGKPAQFFGSQGQQRTIV 292

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKR 331
           + + LA   LI    G  P+LLLD++ + LD  ++
Sbjct: 293 LSLKLAEIELIKELKGHYPVLLLDDVLSELDAHRQ 327


>gi|297200943|ref|ZP_06918340.1| recombination protein F [Streptomyces sviceus ATCC 29083]
 gi|197716886|gb|EDY60920.1| recombination protein F [Streptomyces sviceus ATCC 29083]
          Length = 373

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 102/358 (28%), Positives = 162/358 (45%), Gaps = 21/358 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA + +  D   T FVG NG GKTN++EAI +L+     R AS A +
Sbjct: 1   MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAIGYLATLGSHRVASDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R +  +G     ++LE    ++ R        +R  D L   +R   
Sbjct: 61  VRMGA---DRAIVRAQVRQGERQQLVELELNPGKANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF------ 178
             P    +  G   ERRRFLD ++ A  PR      D+ER+++ RN LL           
Sbjct: 117 FAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYERVLKQRNTLLKSAALARRHGG 176

Query: 179 ---DSSWCSSIEAQMAELGVKINIARVEMINALSSLI---MEYVQKENFPHIKLSLTGFL 232
              D S     +  +A +G ++   R+++I AL  L     E +     P I L      
Sbjct: 177 RSMDLSTLDVWDQHLARVGAELLAQRLDLIAALQPLTDKAYEQLAPGGGP-IALEYKPSA 235

Query: 233 DGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
            G+   +  AL E+    L + RK +     TL+GPHR DL +    +     + S GE 
Sbjct: 236 PGEA-HTREALHEQLMAALAEARKQEIERGVTLVGPHRDDLNLK-LGQLPAKGYASHGES 293

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
               + + LA   L+    G  P+L+LD++ A LD  +R  L  +V   G Q+ +T  
Sbjct: 294 WSYALALRLASYDLL-RAEGNEPVLILDDVFAELDTRRRERLAELVAP-GEQVLVTAA 349


>gi|254784276|ref|YP_003071704.1| DNA replication and repair protein RecF [Teredinibacter turnerae
           T7901]
 gi|259563674|sp|C5BKM1|RECF_TERTT RecName: Full=DNA replication and repair protein recF
 gi|237686556|gb|ACR13820.1| DNA replication and repair protein RecF [Teredinibacter turnerae
           T7901]
          Length = 378

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 161/346 (46%), Gaps = 18/346 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L+ISEFRN  S  L       +  G+NG GKT+ILE+IS L+ GR FR   +  +     
Sbjct: 7   LDISEFRNLRSATLQPGEGINLISGENGSGKTSILESISVLAHGRSFRTHKFRRLINNDE 66

Query: 70  PSFFSTFARVEGMEGLA-DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
            SF + F ++   EG   +I +   +  D  +R   I+        EL + L +  +  +
Sbjct: 67  KSF-TLFGQI--FEGTTRNIGLSRASNGDIQIR---IDSKAAHTATELAECLPLLVMNSA 120

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
             ++  G    RR+F D +VF +    +     + R ++ RN LL       S     + 
Sbjct: 121 SFQLLEGSGQVRRKFFDWLVFHVKQEFKHYWKLYARCIKQRNSLLRRDKITRSELLPWDQ 180

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQKENFPHI---KLSLTGFLDGKFDQSFCALKE 245
           ++ +    I   R E+     +  +  + + +F      +LS T ++ G       +   
Sbjct: 181 ELTKAAQHIESMRSEVFELFQTHFLNEIGQFDFTETLGAELSCT-YVSG------WSKTG 233

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
            Y ++L D  + D  +  T IG H+SD+ ++   +   +   S G+QK V+V +FLA A 
Sbjct: 234 NYNEQLEDQFERDVAAGYTHIGSHKSDVKINLA-RVPAVEELSRGQQKSVIVALFLAEAL 292

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           +   TTG  P+ LLD++ A LDE     + + + ++GSQ+F T  D
Sbjct: 293 VFRTTTGRTPVFLLDDLPAELDEKNLRIVGKALKNLGSQVFATAID 338


>gi|323705851|ref|ZP_08117423.1| DNA replication and repair protein RecF [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534847|gb|EGB24626.1| DNA replication and repair protein RecF [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 362

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 163/350 (46%), Gaps = 13/350 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  F+N    +++F A   +  G N  GK+N+LE I  LS G+ FR +   D+  
Sbjct: 3   LKELIVDNFKNLKHQKVIFSAGTNVIYGSNAQGKSNLLECIRLLSIGKSFRNSKNRDMVC 62

Query: 67  IGSPSFF-STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                ++      V+G E   +   KL        R  ++N+  I+ + EL   +  +  
Sbjct: 63  FDVDYYYIKGVFDVDGEEVTVETGYKLNQN-----RFFKVNNNKIKNISELIGVILTTIF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF---DSSW 182
            P    I  G    RRR++D  +  I   +   +I + +++  RN++L +  F    +  
Sbjct: 118 SPDDLNIVKGSPSLRRRYMDASISMIKRNYLYDIIQYNKVLANRNKVLKDVKFKKESARL 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
              ++ Q++  G KI + R + IN L  ++ + VQ  +   + L     +  K D    +
Sbjct: 178 LDIMDEQLSFFGSKIIMYRRQYINNLDLIVKKIVQDISCEKVDLIYWNNVTDKID-DIKS 236

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           +K+    KL   R +D     T  GPHR D+ + + +   +    S G+Q+ + + + LA
Sbjct: 237 IKDLLLNKLILNRDVDIKYGDTKYGPHRDDVKI-FINGHDSRIFASQGQQRTIALCLKLA 295

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
              +I +  G  PILLLD++ + LDE++R  +   V   G Q F+T T+K
Sbjct: 296 EYEVIRSENGENPILLLDDVMSELDENRRKYILNKVE--GCQTFITHTEK 343


>gi|94502203|ref|ZP_01308698.1| recombination protein F [Oceanobacter sp. RED65]
 gi|94425664|gb|EAT10677.1| recombination protein F [Oceanobacter sp. RED65]
          Length = 357

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 92/349 (26%), Positives = 162/349 (46%), Gaps = 17/349 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I+ L +   RN +   +       +  G+NG GKT+ LEAI +L+  + FR     ++
Sbjct: 1   MAIELLMLQGVRNLSPTNVSPSPLVNLIYGENGSGKTSFLEAIYYLAYCKSFRTHKQKNL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            + G  +       + G   L    + +E R+    R +++N V +    EL   L I  
Sbjct: 61  IQHGQNT-------MTGFCQLPHKQLGVE-RNQEGQRRIKLNGVCLNSAAELASVLPIQL 112

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
           L P+M R+  G    RR ++D  VF ++P+       F+R  + RN LL  G    S   
Sbjct: 113 LDPTMFRLLEGSPQLRREYIDWGVFHVEPQFFGIWKQFKRAHQTRNALLRAGGASESERK 172

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
              + +++L  +I   R+  +  L  L   Y+ + N   + ++++ +   K DQ +  L 
Sbjct: 173 IWHSSLSDLANQITSMRIAYLERLKPLFDHYMARLN-DGLGVTMSFYQGWKKDQDYYELL 231

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
           E          K D  S  T  GP R+DL +   +    +   S G+QK+V+  + LA A
Sbjct: 232 E-------SSWKSDIESGYTKSGPQRADLRIK-AENVPAMDVLSRGQQKMVVCALKLAQA 283

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            L    +G   I L+D+++A LD + R AL R++ ++  Q+F+T  + +
Sbjct: 284 DLYKQVSGSPCIFLVDDLAAELDINHRKALCRLLEELKCQVFVTAVEST 332


>gi|306826174|ref|ZP_07459509.1| recombination protein F [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|304431650|gb|EFM34631.1| recombination protein F [Streptococcus sp. oral taxon 071 str.
           73H25AP]
          Length = 363

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 93/372 (25%), Positives = 167/372 (44%), Gaps = 22/372 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKETKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLLQKKTGSIPLEIDLTPKGRVTKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSSQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+ E G ++   R++ I  L     ++ QK+   H+++S        F QS     +
Sbjct: 178 LDDQLVEYGCRVIKHRIKFIKDLE----KFGQKK---HLEISNQSEELSIFYQSSVNFTD 230

Query: 246 E------YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           E      +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 231 EEQLTNSFKMALDKSRSRDLFKKNTGVGPHRDD--ITFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITNESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQ 371
           E      I N Q
Sbjct: 348 ENLSIFNIQNGQ 359


>gi|291526543|emb|CBK92130.1| recF protein [Eubacterium rectale DSM 17629]
 gi|291529186|emb|CBK94772.1| recF protein [Eubacterium rectale M104/1]
          Length = 362

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 156/352 (44%), Gaps = 18/352 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK + +S FRNY  L + FD++  I  GDN  GKTNILEA       +  + +   ++ R
Sbjct: 3   IKSIQLSNFRNYEKLDISFDSETNIIYGDNAQGKTNILEAAYLSGTTKSHKGSKDKEMIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +   T       E   D+ ++         + + IN + I+   EL   L I + 
Sbjct: 63  FGEDEAHIRTIVEKNDKEYRIDMHLR-----KNGAKGVAINKMPIKKASELFGILNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   +  + + +  RNRLL +  +      +
Sbjct: 118 SPEDLNIIKNGPAERRRFIDLELCQLDKIYLSNLSKYNKTLVQRNRLLKDIAYRPDLIDT 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           ++    Q+ E G  +   R E +N L+ +I +     +    KL L    +   D  F  
Sbjct: 178 LQVWDMQLLEYGRHVIKKRREFVNELNEIIQDIHSNISGGREKLILK--YEPSIDDIF-- 233

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
               +  +L   R  D    +T +GPHR D++    D      +GS G+Q+   + + L+
Sbjct: 234 ----FEDELLKARSRDLKLCQTTVGPHRDDMLFS-VDGVDIRKYGSQGQQRTSALSLKLS 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
              L+       P+LLLD++ + LD +++N L   ++D  + I  TG D+ V
Sbjct: 289 EISLVKKNINSTPVLLLDDVLSELDGNRQNYLLNSLSDTQTIITCTGLDEFV 340


>gi|314935204|ref|ZP_07842557.1| DNA replication and repair protein RecF [Staphylococcus hominis
           subsp. hominis C80]
 gi|313656539|gb|EFS20278.1| DNA replication and repair protein RecF [Staphylococcus hominis
           subsp. hominis C80]
          Length = 371

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 96/379 (25%), Positives = 167/379 (44%), Gaps = 29/379 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  +RNY ++ L    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLKTLQLENYRNYEAVTLNCHPEVNILIGENAQGKTNLLESIYVLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNSEYAKIEGELSYRHGTMPLTMYITKKGKQVKVNHLEQSRLTQYVGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKTDK 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q A+  + + + R + I  L +L            E +     P IKLS T 
Sbjct: 176 TMLEVLNQQFAQYALNVTLRREQFIEELEALAQPIHAGITNQRETLSLTYLPSIKLSDTS 235

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
               +       L  EY +     R+MD      L GPHR DL  +  D      +GS G
Sbjct: 236 KNKSELLDEVITLLNEYQQ-----REMDRAV--CLYGPHRDDLGFNVNDMDAQ-TYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRIS 368
                D  +   AK  RI+
Sbjct: 347 SVDGIDHEIMNNAKLYRIN 365


>gi|260584260|ref|ZP_05852007.1| DNA replication and repair protein RecF [Granulicatella elegans
           ATCC 700633]
 gi|260157778|gb|EEW92847.1| DNA replication and repair protein RecF [Granulicatella elegans
           ATCC 700633]
          Length = 369

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 93/350 (26%), Positives = 165/350 (47%), Gaps = 19/350 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L ++ FRNY  L L F     IF+G+N  GKTN++E+I  L+  +  R     ++     
Sbjct: 6   LQLNHFRNYEELFLEFGKGVHIFIGENAQGKTNLMESIYTLAMTKSHRTNQDRELIMWNE 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
            +     A ++G       +I LE R     +  ++N +  + +      L +    P  
Sbjct: 66  DT-----ATIKGKVEKKISNIPLEIRFSNKGKIGRVNHLEQKKLSSYLGQLNVILFAPEN 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS----WCSS 185
             +  G    RR+F+D  +  ++P +   +++++RL++ RN  L +     S    +   
Sbjct: 121 LELVKGAPANRRKFMDMELGQMNPIYLHELVEYQRLIKQRNHYLKQLAIKKSSADLYLEV 180

Query: 186 IEAQMAELGVKINIARVEMINALSSL---IMEYVQ--KENFPHIKLSLTGFLDGKFDQSF 240
           +  Q+ E    I   R+E +  L +L   I E +   +E F  +K   +  ++    Q  
Sbjct: 181 LTEQVIEKATAILNHRLEFMEQLEALARPIHEQISLGREEFS-LKYQTSLSIEKGMSQD- 238

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +KE Y K+    +K +     TL+GPHR DLI    DK +    GS G+Q+  ++ + 
Sbjct: 239 -EVKELYQKQFEAVQKRELEQASTLVGPHRDDLIFYLNDKPVQ-NFGSQGQQRSTVLSLK 296

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           LA   L++  TG  PILLLD++ + LD+D++  L + + +   Q F+T T
Sbjct: 297 LAEIELMNIATGEYPILLLDDVLSELDDDRQTHLIKAIEN-KVQTFITTT 345


>gi|255535750|ref|YP_003096121.1| DNA recombination and repair protein RecF [Flavobacteriaceae
           bacterium 3519-10]
 gi|255341946|gb|ACU08059.1| DNA recombination and repair protein RecF [Flavobacteriaceae
           bacterium 3519-10]
          Length = 359

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 107/374 (28%), Positives = 174/374 (46%), Gaps = 30/374 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L + +F+N++   L F  Q   FVG+NGVGKTN+L+A+ +LS G+ F      D+  
Sbjct: 3   IQKLQLIQFKNHSQQTLEFSPQINCFVGNNGVGKTNVLDALHYLSVGKSF--LGNTDLNN 60

Query: 67  IGSPS-FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH---LRI 122
           I +   FF+   ++   E    I I++  RD +  + ++ ND   +  D +  H   L  
Sbjct: 61  IQTDGDFFAIEGKIYDGEKENIIKIQM-PRDAK--KLIKKND---KSYDRMADHIGFLPS 114

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL----TEGYF 178
             + P    + S     RR+FLD M+   D  +   +I +++ ++ RN LL       YF
Sbjct: 115 VIISPYDSNLISDSGESRRKFLDAMISQTDSDYLYNLIQYQKTIQQRNALLKSFAKNRYF 174

Query: 179 DSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
           D          +   G  I I R E ++++  LI  Y    +  + ++++    D K   
Sbjct: 175 DPENLEIYNEPLIRFGTAIFIKRTEFLDSILPLIQSYYSIISNGNEQVTVDYHSDLK-TS 233

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           SF  L  E   K       D +   T  G H+ DL+ +    ++    GS G+QK  L+ 
Sbjct: 234 SFEELLNENLDK-------DRVLTYTSKGIHKDDLVFEMNGNSLK-RTGSQGQQKSFLIA 285

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDK----S 353
           + L+    I   TG  P+LLLD+I   LD+ +   L  +V  +   QIF+T T+K    S
Sbjct: 286 LKLSQMNRIKELTGKTPVLLLDDIFDKLDDSRVLQLIELVNREHFGQIFITDTNKERTES 345

Query: 354 VFDSLNETAKFMRI 367
           V   +NE +K   I
Sbjct: 346 VVRKINEESKIFEI 359


>gi|331267332|ref|YP_004326962.1| recombination protein F [Streptococcus oralis Uo5]
 gi|326684004|emb|CBZ01622.1| recombination protein F [Streptococcus oralis Uo5]
          Length = 365

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 169/370 (45%), Gaps = 22/370 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKEAKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +        R+ G+      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDNEQL-----RLSGLLQKKTSSIPLEIDLTPKGRVTKVNYLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSSQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCALK 244
           ++ Q+ E G ++   R++ I  L     ++ QK+   H+++S     L   +  S     
Sbjct: 178 LDDQLVEYGCRVIRHRIKFIKDLE----KFGQKK---HLEISNKLEELSISYQSSVNFTD 230

Query: 245 EE-----YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           EE     +   L   R  D   + T +GPHR D  + +   AI  + GS G+ + +++ +
Sbjct: 231 EEQLTSSFKMALEKSRSRDLFKKNTGVGPHRDD--ITFYINAIDASFGSQGQHRSLVLSV 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITNESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISN 369
           E      I N
Sbjct: 348 ENLSIFNIQN 357


>gi|259047901|ref|ZP_05738302.1| DNA replication and repair protein RecF [Granulicatella adiacens
           ATCC 49175]
 gi|259035578|gb|EEW36833.1| DNA replication and repair protein RecF [Granulicatella adiacens
           ATCC 49175]
          Length = 375

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 167/352 (47%), Gaps = 13/352 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  FRNY S++L F     +F+G+N  GKTN++E+I  L+  +  R  +  D 
Sbjct: 1   MKLTNLQLQNFRNYESVQLEFTDGVHVFIGENAQGKTNLMESIYALAMTKSHRTTN--DK 58

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +   FA ++G          LE +  +  +  ++N +  + +     +L +  
Sbjct: 59  ELIG---WKKDFATIKGTIEKTATKTNLELQFSKKGKIAKVNYLEQKRLSSYLGNLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDS---- 180
             P    +  G    RR+F+D  +  +   +   ++++ R+++ RN  L +         
Sbjct: 116 FAPENLTLVKGSPQNRRKFVDMELGQMSSLYLYDLVEYNRVLKQRNTYLKQLAIKKKQPD 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
            +   +   ++EL  KI   R++ +  L +L +    + +    K S++       +   
Sbjct: 176 EYLEVLSEMLSELASKIVFHRLDFMKQLEALAIPIHDQLSLGREKFSVSYQATIPLEDGL 235

Query: 241 CA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
            A  +KE Y  +    +  ++    TLIGPHR DLI  Y ++     +GS G+Q+  ++ 
Sbjct: 236 TASQMKEIYMNQFKKNQTREADQATTLIGPHRDDLIF-YLNEVPVQTYGSQGQQRSTVLS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           + LA   L+  +TG  P+LLLD++ + LD+D++  L + + +   Q F+T T
Sbjct: 295 LKLAEIELMKLSTGEYPLLLLDDVLSELDDDRQTHLIKAIEN-KVQTFITTT 345


>gi|225869472|ref|YP_002745420.1| DNA replication and repair protein RecF [Streptococcus equi subsp.
           zooepidemicus]
 gi|259563673|sp|C0MGR5|RECF_STRS7 RecName: Full=DNA replication and repair protein recF
 gi|225702748|emb|CAX00903.1| DNA replication and repair protein RecF [Streptococcus equi subsp.
           zooepidemicus]
          Length = 369

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 90/347 (25%), Positives = 157/347 (45%), Gaps = 13/347 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK LN++ +RNY      F     +F+GDN  GKTN LEAI FLS  R  R  S  D+  
Sbjct: 3   IKELNLTHYRNYQQASAAFSPGLNVFIGDNAQGKTNFLEAIYFLSVTRSHRTKSDKDLIY 62

Query: 67  IGSP--SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                 S   T  R+ G        ++LE       R  +IN +    + +    + +  
Sbjct: 63  FDERDCSISGTLERLSG-------RVQLEILLSDKGRITKINTLKQAKLSDYIGAMMVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWC 183
             P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L   +  DS + 
Sbjct: 116 FAPEDLQLVKGSPSLRRKFMDIDLGQIKPVYLSDLSHYNHVLKQRNAYLKSVHQLDSDFL 175

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           S ++ Q+   G ++   R+  + +L+    ++ Q  +    KLS++      F+     +
Sbjct: 176 SVLDEQLVTYGSRVMAHRLAFVQSLAKEASKHHQAISNGLEKLSISYQASVSFEHQ-QEI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            +++  +L    + D + + T +GPHR DL+    D     A  S G+ + +++ + +A 
Sbjct: 235 YQQFMDQLKATHQRDFLRKNTGVGPHRDDLVFYINDMNANFA--SQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
             L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T
Sbjct: 293 VSLMKQLTGDNPILLLDDVMSELDNIRQTKLLEAVKKENVQTFITTT 339


>gi|295694691|ref|YP_003587929.1| DNA replication and repair protein RecF [Bacillus tusciae DSM 2912]
 gi|295410293|gb|ADG04785.1| DNA replication and repair protein RecF [Bacillus tusciae DSM 2912]
          Length = 370

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 169/365 (46%), Gaps = 25/365 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++++ L +  FRNY  L+L   A   +F+G+NG GKTN+LEAI  L+  +  R    A+ 
Sbjct: 1   MRLESLRLLHFRNYPHLQLDTRAPVNVFIGENGQGKTNVLEAIDILALTKSHRTHRLAEC 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            + G   F     RV+   G +++S+ L T   R+     +  +  + + +    L +  
Sbjct: 61  IQWGE-QFALIEGRVQRNTGSSELSVTLTTSGKRAA----VAGIERQRISDYVGMLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS--- 181
             P   ++  G    RRRFLD  +  I P + R +  + R +  RN+LL     + +   
Sbjct: 116 FTPEDLQLIKGSPQVRRRFLDMEIGQISPLYLRDLQQYVRALSQRNQLLKSANHNPTERI 175

Query: 182 ------WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK 235
                 W    + Q+A  G +I + R + +  L     E   + +     LSL+ +    
Sbjct: 176 TDTLDIW----DDQLARHGSRIILRRAQFVRTLERHAREIHSRVSGDREVLSLS-YAKVS 230

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
            +Q+   + + Y  +L   R +D     T +GPHR DL++   D+    A  S G+Q+  
Sbjct: 231 PEQTPEQVFQMYLHELRARRSLDLARGVTSVGPHRDDLVILLNDRE-AAAFASQGQQRTA 289

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQI--FMTGTDKS 353
            + + LA   LI    G  P+LLLD++ + LD  ++     +V+ +G+Q+  F+T T   
Sbjct: 290 ALSLKLAEIELIREEVGEYPVLLLDDVLSELDPVRQ---VHLVSAMGAQVQTFLTTTHLE 346

Query: 354 VFDSL 358
              SL
Sbjct: 347 GLGSL 351


>gi|332971207|gb|EGK10170.1| recombination protein F [Desmospora sp. 8437]
          Length = 372

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 105/377 (27%), Positives = 162/377 (42%), Gaps = 24/377 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L + +FRN   L+L    +  +FVG N  GKTNILE++  L+ G+  R  S+ ++ R
Sbjct: 3   VERLELKQFRNIEHLKLDCSGELHMFVGPNAQGKTNILESLYVLAIGKSHRTRSHRELIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                     A V G E    + I+L  R  R +R    N V  R + E    L      
Sbjct: 63  WEQTGALLK-AEVSGKESARRLEIRLTPRGKRVLR----NGVEQRRLSEYIGSLTAVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS- 185
           P    I  G    RRRFLD  +  + P +   +  + +L++ RN LL E      W    
Sbjct: 118 PEDLSIVKGSPQVRRRFLDMEIGQVSPAYIYHLTRYNQLLQQRNSLLKE--LGKGWGKQT 175

Query: 186 -----IEAQMAELGVKINIARVEMINALSSLIME----YVQKENFPHIKLSLTGFLDGKF 236
                +  Q+  L   +   R   +N LS    E      Q      ++      ++   
Sbjct: 176 ALLDVLNEQLVGLSTHLWSKRFSFVNILSRWAQEIHHSITQGSESLTLQYRPLAAVEPGM 235

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           D+S  +++E   ++L   R+ +     TLIGPHR DL +   +       GS G+Q+   
Sbjct: 236 DRS--SMEEALTRELMQVREQEIQRGTTLIGPHRDDLRI-AANGTDLHTFGSQGQQRTAA 292

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + + LA   LI   TG  PILLLD++ + LD+ ++  L   +     Q F+T T     D
Sbjct: 293 LSLKLAEIELIHQETGTYPILLLDDVLSELDDGRKTHLLEAIRG-RVQTFVTTTGLEGID 351

Query: 357 SLNETAKFMRISN-HQA 372
              ET +  RI   HQ 
Sbjct: 352 --RETLERARIRRVHQG 366


>gi|238922436|ref|YP_002935949.1| DNA replication and repair protein RecF [Eubacterium rectale ATCC
           33656]
 gi|259563365|sp|C4Z940|RECF_EUBR3 RecName: Full=DNA replication and repair protein recF
 gi|238874108|gb|ACR73815.1| DNA replication and repair protein RecF [Eubacterium rectale ATCC
           33656]
          Length = 362

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 92/352 (26%), Positives = 155/352 (44%), Gaps = 18/352 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK + +S FRNY  L + FD +  I  GDN  GKTNILEA       +  + +   ++ R
Sbjct: 3   IKSIQLSNFRNYEKLDISFDTETNIIYGDNAQGKTNILEAAYLSGTTKSHKGSKDKEMIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +   T       E   D+ ++         + + IN + I+   EL   L I + 
Sbjct: 63  FGEDEAHIRTIVEKNDKEYRIDMHLR-----KNGAKGVAINKMPIKKASELFGILNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   +  + + +  RNRLL +  +      +
Sbjct: 118 SPEDLNIIKNGPAERRRFIDLELCQLDKIYLSNLSKYNKTLVQRNRLLKDIAYRPDLIDT 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           ++    Q+ E G  +   R E +N L+ +I +     +    KL L    +   D  F  
Sbjct: 178 LQVWDMQLLEYGRHVIKKRREFVNELNEIIQDIHSNISGGREKLILK--YEPSIDDIF-- 233

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
               +  +L   R  D    +T +GPHR D++    D      +GS G+Q+   + + L+
Sbjct: 234 ----FEDELLKARSRDLKLCQTTVGPHRDDMLFS-VDGVDIRKYGSQGQQRTSALSLKLS 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
              L+       P+LLLD++ + LD +++N L   ++D  + I  TG D+ V
Sbjct: 289 EISLVKKNINSTPVLLLDDVLSELDGNRQNYLLNSLSDTQTIITCTGLDEFV 340


>gi|73661313|ref|YP_300094.1| recombination protein F [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581562|sp|Q4A177|RECF_STAS1 RecName: Full=DNA replication and repair protein recF
 gi|72493828|dbj|BAE17149.1| DNA repair and genetic recombination protein [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 371

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/379 (26%), Positives = 168/379 (44%), Gaps = 29/379 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  +RNY S+ L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLKTLQLQNYRNYESISLNCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG        + L     +  + ++IN +    + +   HL +  
Sbjct: 61  IR-----FDSDYAKIEGDLSYRYGEMPLTMYITKKGKQVKINHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +  +    DS
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLSQYQRILKQKNNYLKQLQYGQKTDS 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q AE  +KI + R   IN L SL            E +     P IKL    
Sbjct: 176 TMLEVLNQQFAEYALKITLRREHFINELESLAKPIHSGITNERETLSLNYLPSIKLE--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                 D+S     EE    L D  + +      L GPHR DL  +  +      +GS G
Sbjct: 233 ----NKDKSETERLEEVLTILNDNMEREKDRGVCLYGPHRDDLGFN-VNGMDAQTYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ +++ L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQSHLLSTIQH-KVQTFVTTT 346

Query: 351 D-KSVFDSLNETAKFMRIS 368
               +   + + AK  RI+
Sbjct: 347 SVDGIEHEIMKNAKLYRIN 365


>gi|225028835|ref|ZP_03718027.1| hypothetical protein EUBHAL_03122 [Eubacterium hallii DSM 3353]
 gi|224953831|gb|EEG35040.1| hypothetical protein EUBHAL_03122 [Eubacterium hallii DSM 3353]
          Length = 366

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 96/351 (27%), Positives = 160/351 (45%), Gaps = 22/351 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ + ++ +RN+ SL++ F     IF GDN  GKTN+LE+I      R  R +   D+ R
Sbjct: 3   VESIELNNYRNFDSLKVEFSPGVNIFFGDNAQGKTNLLESIYVSGTLRSHRGSRDKDLIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   +    F R + +    D+ +K         + + +N V +R   EL   + I + 
Sbjct: 63  FGEDEAHIRLFFRKDSLSHRLDVHLK-----KNKSKGVAVNGVPVRRSGELLGMMHIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I       RRRFLD  +  ID  + ++++ + +++  RN LL +     +   +
Sbjct: 118 SPEDLSIIKEGPAGRRRFLDMELSQIDKGYMQQLVAYSKILNERNNLLKQINLYPALIDT 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG-KFDQSFC 241
           ++    Q+   G  +   R E +         Y   E    I   LTG  +  K +    
Sbjct: 178 LDGWDEQLLAAGQFLIKKREEFV---------YFLDEMMAKIHGQLTGGKEQIKVEYEKN 228

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGIF 300
              E++ ++L+  R  D  S  T +GPHR DL   +    I I   GS G+Q+   + + 
Sbjct: 229 VEAEKFREQLYSKRNKDISSGTTSVGPHRDDL--RFKVGGIDIRKFGSQGQQRTAALSLK 286

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           L+  RLI   TG  PILLLD++ + LD  +++ L   + DI + I  TG D
Sbjct: 287 LSEIRLIEQVTGEKPILLLDDVLSELDAGRQSWLLESIQDIQTLISCTGLD 337


>gi|312866766|ref|ZP_07726979.1| DNA replication and repair protein RecF [Streptococcus
           parasanguinis F0405]
 gi|311097549|gb|EFQ55780.1| DNA replication and repair protein RecF [Streptococcus
           parasanguinis F0405]
          Length = 364

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 166/367 (45%), Gaps = 13/367 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L+I  FRNY  L + F     IF+G N  GKTNILE+I FL+  R  R  +  D+  
Sbjct: 3   LKQLSIQHFRNYQELEVEFHPGLNIFLGQNAQGKTNILESIYFLALTRSHRTRNDRDLIY 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S  F     +V G        + LE       R  ++N +    +     H+ +    
Sbjct: 63  FESTDF-----KVSGQLQRETGPLPLEISLTPKGRITKVNHLKQAKLSNYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  + P +   +  +  +++ RN  L      D+++   
Sbjct: 118 PEDLQLIKGSPAGRRKFIDIELGQMKPLYLSDLSQYNHVLKQRNSYLKNSEKIDATFLEV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +++Q+A  G ++   R+E I  L +   E   + +     LS+  +    F +    ++E
Sbjct: 178 LDSQLASFGSRVIHHRLEFIKKLEAKAEEKHTRLSDNKEDLSIQ-YQSTVFSEEGNDIEE 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++   L   R+ D   + T IGPHR DL   +    +    GS G+ + V++ + LA   
Sbjct: 237 QFLSMLEKNRQKDIFRKTTSIGPHRDDLA--FFINNMNATFGSQGQHRSVVLSLKLAEIE 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   T   PILLLD++ + LD  ++  L   +++   Q F+T T     D L +  + +
Sbjct: 295 LMEEITREKPILLLDDVMSELDNYRQLQLLETISN-NIQTFITTT---TLDHLKDLPEEL 350

Query: 366 RISNHQA 372
           +I   QA
Sbjct: 351 KIFTVQA 357


>gi|260588814|ref|ZP_05854727.1| RecF protein [Blautia hansenii DSM 20583]
 gi|260540593|gb|EEX21162.1| RecF protein [Blautia hansenii DSM 20583]
          Length = 361

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 94/352 (26%), Positives = 161/352 (45%), Gaps = 24/352 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY SL L FD    IF GDN  GKTNILEA    S  +  R +   ++ +
Sbjct: 3   IESIELKNYRNYNSLALEFDKGTNIFYGDNAQGKTNILEAAYLCSTTKSHRGSKDRELIK 62

Query: 67  I-GSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                +    F   +G+    D+ +K         + + I+ + IR   EL   L I + 
Sbjct: 63  FDADEAHIRMFVNKDGISRKIDMHLK-----KSKPKGIAIDGIPIRKASELFGLLNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   +  +  ++  RN+LL +  F  S   +
Sbjct: 118 SPEDLNIIKNGPGERRRFMDLELCQLDKLYLSNLSSYNHVLNQRNKLLKDIAFQESLKDT 177

Query: 186 IE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF-- 240
           +E    Q  + G +I   R   I+ ++  IME +          S+TG  + K +  +  
Sbjct: 178 LEIWDEQFVQYGREIIETRRRFIDEING-IMEKIHS--------SITGNRE-KIELVYEP 227

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGI 299
               E + ++L   R+ D   ++T +GPHR D  V      I I  +GS G+Q+   + +
Sbjct: 228 SVPDENFYQELSKNREKDCRFKQTSVGPHRDDFSVKV--NGIDIRRYGSQGQQRTAALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            L+   ++       P+LLLD++ + LD +++N L   ++ + + I  TG D
Sbjct: 286 KLSEIYMVKKVIKDMPVLLLDDVLSELDSNRQNYLLNSISHVQTMITCTGLD 337


>gi|322373988|ref|ZP_08048522.1| DNA replication and repair protein RecF [Streptococcus sp. C150]
 gi|321276954|gb|EFX54025.1| DNA replication and repair protein RecF [Streptococcus sp. C150]
          Length = 367

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 163/350 (46%), Gaps = 26/350 (7%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++I  FRNY+   + F     IF+G N  GKTNILEAI FL+  R  R  S  ++ +   
Sbjct: 6   IDIQHFRNYSEAYVTFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTRSDKELIQ--- 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F  +  ++ G        + LE       R  ++N +    + +   H+ +    P  
Sbjct: 63  --FQQSTLKLSGTVHRRSGKLPLEISLSNKGRITKVNHLKQAKLSDYIGHMTVVLFAPED 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D  + S ++ 
Sbjct: 121 LQLVKGSPSLRRKFIDIDLGQIKPVYLSDLSNYNHVLKQRNAYLKSTDKVDIDFLSVLDE 180

Query: 189 QMAELGVKINIARVEMINALS-------SLIMEYVQKENFPH-IKLSLTGFLDGKFDQSF 240
           Q+A+ G ++   R++ I  L        SL+   +++ N  +   +SL         Q+ 
Sbjct: 181 QLADFGARVIEHRLDFIKQLEVEADKHHSLLSNQIERLNISYESNISL---------QNH 231

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
            ++++ +   L    K D   + T +GPHR DL     D  +  + GS G+Q+ +++ + 
Sbjct: 232 KSIRQAFLITLRQNHKRDIFKKNTGVGPHRDDLTFYIND--MNASFGSQGQQRSLILSLK 289

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +A   LI N TG  PILLLD++ + LD  ++  L   + D   Q FMT T
Sbjct: 290 MAEIALIRNVTGEFPILLLDDVMSELDNHRQLKLLESI-DKEVQTFMTTT 338


>gi|229551100|ref|ZP_04439825.1| recombination protein F [Lactobacillus rhamnosus LMS2-1]
 gi|258538196|ref|YP_003172695.1| DNA replication and repair protein recF [Lactobacillus rhamnosus Lc
           705]
 gi|229315561|gb|EEN81534.1| recombination protein F [Lactobacillus rhamnosus LMS2-1]
 gi|257149872|emb|CAR88844.1| DNA replication and repair protein recF [Lactobacillus rhamnosus Lc
           705]
          Length = 372

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 167/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNYA++   F  +  + +G+N  GKTN+LEAI  L+  R  R  +  ++
Sbjct: 1   MKLDHLTLKNYRNYATVDTAFSPEINVLIGENAQGKTNLLEAIYVLALARSHRTNNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS      FARV G       + +LE       +  +I+ +    + +   H  +  
Sbjct: 61  IRFGSD-----FARVSGQISRQSGTHQLELIISHQGKRARIDRIEQSKLSQYLGHFNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D     + P++   +  ++  ++ RN  L +  +    D 
Sbjct: 116 FAPEDLAIVKGSPAGRRRFIDMEFGQMSPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHIKLSLTGFLD 233
            +   +   +A  G ++  AR +++  +S         I +  +K  F + +  +T  L 
Sbjct: 176 VYLDVLTDSLAAFGAELITARAKLLQTMSDYAAAIQQDITKGREKLQFAY-QTQVTADLR 234

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
              +Q + AL   +AK+    R+++  +  +L+GPHR D++    DK +    GS G+Q+
Sbjct: 235 QDSEQVYEALGALFAKQ--QSREIEQGT--SLVGPHRDDVLFIVNDKDVA-NFGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   L+ + TG  P+LLLD++ + LD  ++  L + +     Q F+T T
Sbjct: 290 TTALAVKLAEIDLMKDQTGEYPVLLLDDVLSELDAIRQTHLLKAI-QAKVQTFLTTT 345


>gi|312897425|ref|ZP_07756849.1| putative recombination protein F [Megasphaera micronuciformis
           F0359]
 gi|310621486|gb|EFQ05022.1| putative recombination protein F [Megasphaera micronuciformis
           F0359]
          Length = 370

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 162/353 (45%), Gaps = 16/353 (4%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           +I+ LNI   RNY    + F A   +  G+NG GKTN+LEA+     G+ +R  +  D+ 
Sbjct: 5   RIRLLNI---RNYEEADISFPATVIVLYGNNGQGKTNLLEALYTGCIGKSYRGVTDVDLL 61

Query: 66  RIGSP--SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           R  +   S    F R +  +   +I I     + + V    +ND  +R   EL   L+  
Sbjct: 62  RKSATNGSVIIDFIRNKTEQ---NIKIVFSLHEKKRV---SVNDTKVR-TRELFGILQEV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              P   ++  G    RRRFLD  +   +P + + ++ + + +  RN LL    ++    
Sbjct: 115 MFSPEDLQLIKGNPALRRRFLDMEISQTNPSYYKMLLQYNKAVSQRNILLKRMKYEKDIS 174

Query: 184 -SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
               + Q+A L   I   R E +  +S ++ E  +        + LT ++      +   
Sbjct: 175 LHEWDLQLARLAAYIVNKRKESLEKISVVVKEIYRNLTSEKEIVKLT-YIQPYKGSTVED 233

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
            ++ Y + L   R+ D   + T IGPHR D +V+  D       GS G+Q+  ++ + +A
Sbjct: 234 TEDVYYELLRKNREKDIYRQSTSIGPHRDDFVVE-NDLGELKKFGSQGQQRTAVLALKMA 292

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
               I    G  PILLLD++ + LDE++RNAL   V     Q F+T TD S F
Sbjct: 293 ELEFIKKENGEYPILLLDDVMSELDEERRNALLSFVQG-KVQTFITTTDDSFF 344


>gi|195979034|ref|YP_002124278.1| recombination protein F [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|226737837|sp|B4U113|RECF_STREM RecName: Full=DNA replication and repair protein recF
 gi|195975739|gb|ACG63265.1| DNA replication and repair protein RecF [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
          Length = 369

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 157/347 (45%), Gaps = 13/347 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK LN++ +RNY      F     +F+GDN  GKTN LEAI FLS  R  R  S  D+  
Sbjct: 3   IKELNLTHYRNYQQASAAFSPGLNVFIGDNAQGKTNFLEAIYFLSVTRSHRTKSDKDLIY 62

Query: 67  IGSP--SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                 S   T  R+ G        ++LE       R  +IN +    + +    + +  
Sbjct: 63  FDERDCSISGTLERLSG-------RVQLEILLSDKGRITKINTLKQAKLSDYIGAMMVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWC 183
             P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L   +  DS + 
Sbjct: 116 FAPEDLQLVKGSPSLRRKFMDIDLGQIKPVYLSDLSHYNHVLKQRNAYLKSVHQLDSDFL 175

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           S ++ Q+   G ++   R+  + +L+    ++ Q  +    KLS++      F+     +
Sbjct: 176 SVLDEQLVTYGSRVMAHRLAFVQSLAKEANKHHQAISNGLEKLSISYQASVSFEHQ-QEI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            +++  +L    + D + + T +GPHR DLI  +    +     S G+ + +++ + +A 
Sbjct: 235 YQQFMDQLKTTHQRDFLRKNTGVGPHRDDLI--FYINGMNANFASQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
             L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T
Sbjct: 293 VSLMKQLTGDNPILLLDDVMSELDNIRQTKLLEAVKKENVQTFITTT 339


>gi|330813295|ref|YP_004357534.1| DNA recombination and repair protein RecF [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327486390|gb|AEA80795.1| DNA recombination and repair protein RecF [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 362

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 176/378 (46%), Gaps = 36/378 (9%)

Query: 6   KIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVT 65
           KIK  N   F+++        + + +  G+NG+GKTN+LE++SF S  +G R     +  
Sbjct: 6   KIKLQN---FKSHTLFEKNIPSNNIVIHGNNGIGKTNLLESLSFFSNSKGMRANKLENFL 62

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETR--------------DDRSVRCLQINDVVIR 111
           +    +  S FA+ E     ++ S  +  +              D +    LQI ++V  
Sbjct: 63  Q-KQNNIQSEFAQAECQLKQSNYSTNISYKIYKQADQISKNFFIDSKKSSNLQIANLVNF 121

Query: 112 VVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNR 171
           +           WL P MD+I       +++F+D+++  ++    R + DF++L   R  
Sbjct: 122 I-----------WLSPHMDKIMYEEGSIKKKFIDKIISNLNQDFSRYLSDFKKLSEERIA 170

Query: 172 LLTEGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGF 231
           LLT  + D  W S +E++MA L   I I R + I  L+ L  E ++   F   K++++  
Sbjct: 171 LLTNSH-DIKWISIVESKMAILFYLILIERRKKIKDLNILAEEKLKL--FSRFKINISNE 227

Query: 232 LDGK-FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
           L+   FD+  C +  E  K  F+ R +D+  +R    P+   +      K +     STG
Sbjct: 228 LEKYLFDEKKCII--EIEKIFFNNRSLDTSIKRNTFSPNTDRVTFFNRTKNLNSELCSTG 285

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           EQK +L+ I LA   +         ILL DEIS+H+DE      F  V    +Q + TGT
Sbjct: 286 EQKSILLSIILAFGWMYK-QRNIQFILLFDEISSHIDEKNMENFFTEVAKFETQAWYTGT 344

Query: 351 DKSVFDSLNETAKFMRIS 368
            K++F  ++  A F+ ++
Sbjct: 345 KKNIFQVIDNKAFFIDLA 362


>gi|225871475|ref|YP_002747422.1| DNA replication and repair protein RecF [Streptococcus equi subsp.
           equi 4047]
 gi|254790489|sp|C0MBG1|RECF_STRE4 RecName: Full=DNA replication and repair protein recF
 gi|225700879|emb|CAW95638.1| DNA replication and repair protein RecF [Streptococcus equi subsp.
           equi 4047]
          Length = 369

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 157/347 (45%), Gaps = 13/347 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK LN++ +RNY      F     +F+GDN  GKTN LEAI FLS  R  R  S  D+  
Sbjct: 3   IKELNLTHYRNYQQASAAFSPGLNVFIGDNAQGKTNFLEAIYFLSVTRSHRTKSDKDLIY 62

Query: 67  IGSP--SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                 S   T  R+ G        ++LE       R  +IN +    + +    + +  
Sbjct: 63  FDERDCSISGTLERLSG-------RVQLEILLSDKGRITKINTLKQAKLSDYIGAMMVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWC 183
             P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L   +  D+ + 
Sbjct: 116 FAPEDLQLVKGSPNLRRKFMDIDLGQIKPVYLSDLSHYNHVLKQRNAYLKSVHQLDNDFL 175

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           S ++ Q+   G ++   R+  + +L+    ++ Q  +    KLS++      F+     +
Sbjct: 176 SVLDEQLVTYGSRVMAHRLAFVQSLAKEANKHHQAISNGLEKLSISYQASVSFEHQ-QEI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            +++  +L    + D + + T +GPHR DL+    D     A  S G+ + +++ + +A 
Sbjct: 235 YQQFMNQLKTTHQRDFLRKNTGVGPHRDDLVFYINDMNANFA--SQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
             L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T
Sbjct: 293 VSLMKQLTGDNPILLLDDVMSELDNTRQTKLLGAVKKENVQTFITTT 339


>gi|322388468|ref|ZP_08062071.1| recombination protein F [Streptococcus infantis ATCC 700779]
 gi|321140781|gb|EFX36283.1| recombination protein F [Streptococcus infantis ATCC 700779]
          Length = 363

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 93/371 (25%), Positives = 167/371 (45%), Gaps = 20/371 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L+I +FRNY  + + F+ +  +FVG N  GKTN+LE+I FL+  R  R  +  ++ +
Sbjct: 3   LKNLSIKQFRNYRDVEVNFNPKLNVFVGRNAQGKTNLLESIYFLALTRSHRTKTDKNLIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F     +V G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  -----FEEEQLQVSGILQKKTASIPLEIDLTQKGRITKVNYLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLVKGAPAIRRKFIDIELGQIKPIYLSDLSSYNHVLKQRNTYLKSTQNIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYV-----QKENFPHIKLSLTGFLDGKFDQSF 240
           ++ Q+ E G ++   R + I  +     +       Q EN          F+D K     
Sbjct: 178 LDDQLVEYGCRVMNHRADFIQKMELFGKKKHFDISDQLENLSIRYQPFVNFVDKK----- 232

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L E +   L   R  D   + T +GPHR D+I  +    +  + GS G+ + +++ I 
Sbjct: 233 -HLAESFHIALQKSRPRDLFKKNTGVGPHRDDMI--FMINGMEASFGSQGQHRSLVLSIK 289

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L +
Sbjct: 290 LAEIELMESITKESPILLLDDVMSELDNTRQLKLLETISH-NIQTFITTTSLDHLQNLPD 348

Query: 361 TAKFMRISNHQ 371
                 + N Q
Sbjct: 349 NLSVFTVDNGQ 359


>gi|227550643|ref|ZP_03980692.1| recombination protein F [Enterococcus faecium TX1330]
 gi|257896290|ref|ZP_05675943.1| recombination protein F [Enterococcus faecium Com12]
 gi|227180222|gb|EEI61194.1| recombination protein F [Enterococcus faecium TX1330]
 gi|257832855|gb|EEV59276.1| recombination protein F [Enterococcus faecium Com12]
          Length = 374

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 166/360 (46%), Gaps = 29/360 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WNDDQAMIQGEIAKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKL--SLTGF 231
            +   +  Q+A  G K+  AR + I       N+L   I  + ++    ++    SL   
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFIKRLEFWANSLHQQITHHKEQLEIEYLTAVDSLETH 235

Query: 232 LDGKFDQSFCALKEEYAKK-LFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
              +  + F AL  +  KK LF G         T +GPHR DL   + ++     +GS G
Sbjct: 236 TQEQIQEQFLALLNQNKKKDLFRG--------TTTVGPHRDDLSF-FINQKNVQTYGSQG 286

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   LI   TG  PILLLD++ + LD++++  L   + +   Q F+T T
Sbjct: 287 QQRTTALSIKLAEIDLIKEETGEYPILLLDDVMSELDDNRQLHLLETI-EGKVQTFLTTT 345


>gi|225575694|ref|ZP_03784304.1| hypothetical protein RUMHYD_03787 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037098|gb|EEG47344.1| hypothetical protein RUMHYD_03787 [Blautia hydrogenotrophica DSM
           10507]
          Length = 361

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 97/355 (27%), Positives = 158/355 (44%), Gaps = 24/355 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  FRNY SL L FD    I  GDN  GKTN+LEA+      +  + +   ++  
Sbjct: 3   IESVQLKNFRNYQSLELEFDQGTNILFGDNAQGKTNVLEAVYLCGTTKSHKGSKDREMIH 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                S      + E +    D+ +K         + + IN + I+   EL   +   + 
Sbjct: 63  FDEEESHIRMIVKKEHISYKIDMHLK-----KNKAKGIAINGIPIKKARELFGIVNFVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRFLD  +  +D  +   + ++ R++  RN+LL +  F      +
Sbjct: 118 SPEDLNIIKNGPGERRRFLDMELCQLDRIYLNDLANYNRIVNQRNKLLKDLAFQPELQDT 177

Query: 186 IE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           ++    Q+A  G KI   R   +  L+ LI +         I  +LTG  + K + ++  
Sbjct: 178 MDIWNQQLASHGKKIIEKRYSFVKELNELIQK---------IHQNLTGGTE-KLEVTYEP 227

Query: 243 LKE--EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGI 299
             E   +  +L    + D   R T +GPHR DL V      I I  +GS G+Q+   + +
Sbjct: 228 NVESNNFEGELQRQNRRDMQLRTTTVGPHRDDLCVTV--NGIDIRRYGSQGQQRTAALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            LA   L+       P+LLLD++ + LD +++N L   + DI + I  TG D  V
Sbjct: 286 KLAEIYLVKKLIKDTPVLLLDDVLSELDRNRQNYLLDSIHDIQTLITCTGLDDFV 340


>gi|296118606|ref|ZP_06837184.1| RecF protein [Corynebacterium ammoniagenes DSM 20306]
 gi|295968505|gb|EFG81752.1| RecF protein [Corynebacterium ammoniagenes DSM 20306]
          Length = 418

 Score =  112 bits (280), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 104/363 (28%), Positives = 169/363 (46%), Gaps = 33/363 (9%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L++ +FR++  L+L  D    +FVG NG GKTNI+EA+ +++     R    A + R
Sbjct: 3   IRELDLRDFRSWTELKLDLDPGIVLFVGRNGFGKTNIVEALGYVAHLSSHRVNQDAPLVR 62

Query: 67  IGSPSF-FSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+ S   S  A  +G E  A + IK       +    QIN    +   EL   ++    
Sbjct: 63  QGTASARVSATAVNQGRELTAHMLIK-----PHAANQAQINRTRCKSPRELLGVVKTVLF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------GYF 178
            P    +  G   ERRR+LD ++    PR      D+++++R RN LL         GY 
Sbjct: 118 SPEDLALVRGEPAERRRYLDDIIATRTPRLAGVKADYDKVLRQRNALLKSASAAMRRGYG 177

Query: 179 DSSWCSSI------EAQMAELGVKINIARVEMINALSSLI---MEYVQKENFP-HIKLSL 228
           D+   S++      + Q+A LG ++  AR+E+I+ LS LI    E +  E+ P HI    
Sbjct: 178 DTEGASALATLDVWDTQLATLGAQVINARLELIDELSDLIPAAYEGLAPESRPAHIAYKA 237

Query: 229 TGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRR-TLIGPHRSDLIVDYCDKAITIAHG 287
           T       D S   + E         ++   + R  +L+GPHR DL + +   A      
Sbjct: 238 T------IDTSDRDVLEAVMLAELGTKRQREIERGISLVGPHRDDLEL-HLGTAPAKGFA 290

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           S GE     + +  A  +L+ +     PIL+LD++ + LD  +R  L ++  D+  Q+F+
Sbjct: 291 SHGETWSYAIALRFAEFQLLRSEDS-DPILILDDVFSELDAKRREKLVKLAADV-EQVFI 348

Query: 348 TGT 350
           T  
Sbjct: 349 TAA 351


>gi|118443917|ref|YP_879295.1| recombination protein F [Clostridium novyi NT]
 gi|166220706|sp|A0Q3U3|RECF_CLONN RecName: Full=DNA replication and repair protein recF
 gi|118134373|gb|ABK61417.1| recF protein [Clostridium novyi NT]
          Length = 361

 Score =  112 bits (280), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 92/370 (24%), Positives = 177/370 (47%), Gaps = 23/370 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY  L L   +   +F+GDN  GKTNILE+I + S G+  R     ++ +
Sbjct: 3   IKNLELINFRNYEILSLKLHSGINVFIGDNAQGKTNILESIYYCSIGKSHRTNKDKELIK 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  ++ S +   E ++   DI I  E +     + +++N + ++ + +L     +   
Sbjct: 63  WGARDAYISVYISKERLDKKIDIKIFKEGK-----KGVRVNSIKLKTISDLIGVFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I       RR+FLD  +  ++ ++   ++ + +++  RN +L +   ++     
Sbjct: 118 SPEDLKIVKESPSYRRKFLDIELSKLNKKYYYSLVRYNKVLNERNTILRKWNSNTEVTEV 177

Query: 186 IEAQMAELGVKINIARVEMINALS---SLIMEYV--QKENFPHIKLSLTGFLDGKFDQSF 240
            + Q+++ G  I   R++ I +LS   + I + +  QKEN     ++    L+   +  +
Sbjct: 178 YDHQLSKYGSYIIKERLKYIESLSIRGNKIHKDITSQKENIEFKYITSIKDLNNIQNDFY 237

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L+E   K    G         T  GPHR D  V+  +   T   GS G+Q+  ++ I 
Sbjct: 238 NLLRENVKKDFEKG--------STSFGPHRDDFAVN-INNTDTRTFGSQGQQRTAVLTIK 288

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK-SVFDSLN 359
           LA   +I   TG  P+LLLD++ + LD +++  +   + +   Q  +TGT    + + L+
Sbjct: 289 LASLEIIKEQTGEYPVLLLDDVLSELDINRQKYILNSIREF--QTIITGTGLIDIREYLD 346

Query: 360 ETAKFMRISN 369
           +  K  +++N
Sbjct: 347 DHVKLFKVTN 356


>gi|182416742|ref|ZP_02624843.2| DNA replication and repair protein RecF [Clostridium butyricum
           5521]
 gi|237669606|ref|ZP_04529584.1| DNA replication and repair protein RecF [Clostridium butyricum E4
           str. BoNT E BL5262]
 gi|182379399|gb|EDT76894.1| DNA replication and repair protein RecF [Clostridium butyricum
           5521]
 gi|237654840|gb|EEP52402.1| DNA replication and repair protein RecF [Clostridium butyricum E4
           str. BoNT E BL5262]
          Length = 360

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 172/371 (46%), Gaps = 18/371 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD-VT 65
           IK + ++ +RNY +L L       +F+GDN  GKTN+LEAI + +  +  R +   + + 
Sbjct: 3   IKNIMLANYRNYETLSLELSKNVNVFIGDNAQGKTNVLEAIYYCAFAKSHRTSKDRELIN 62

Query: 66  RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                ++ S     + ++   DI+I    RD +  + +++N + +  + EL     +   
Sbjct: 63  WKNDKAYISLLVGKDRLDKRIDINI---LRDGK--KAIKVNSIKVAKIGELFGTFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   ++       RR+ LD  +  I+ ++   ++ + +++  RN LL    F+      
Sbjct: 118 SPEDLKVIKEAPNLRRKLLDMELSQINKKYYFNLVQYNKILNERNILLKSRNFNEDVLEV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKE---NFPHIKLSLTGFLDGKFDQSFCA 242
            + Q+ +    I   R+E I+ + +   E + +E   +   IK   +  +D         
Sbjct: 178 YDLQLVDYADYIISKRLEYIDKI-NFYGEKIHREITADKEEIKFKYSCNVD------LTN 230

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
            K  Y KKL D  K D     T +GPHR D  V + +       GS G+Q+  ++ +  +
Sbjct: 231 YKNNYLKKLQDNIKRDREKGLTSVGPHRDDFNV-FLNDIDAKTFGSQGQQRTAILTMKFS 289

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
             ++I   TG  P+LLLD++ + LD +++  +   +  I + I  TG +  + D L++ A
Sbjct: 290 SLKIIKEITGEYPVLLLDDVLSELDVNRKKYILSTIHGIQTIITCTGIE-VLSDYLDDNA 348

Query: 363 KFMRISNHQAL 373
           K   +S+ + L
Sbjct: 349 KIFNVSSGRIL 359


>gi|257878649|ref|ZP_05658302.1| recombination protein F [Enterococcus faecium 1,230,933]
 gi|257812877|gb|EEV41635.1| recombination protein F [Enterococcus faecium 1,230,933]
          Length = 374

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 166/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WTDDQAMIQGEITKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQTRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKLSLTGFLD 233
            +   +  Q+A  G K+  AR + +       N+L   I    QKE    +++     +D
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFVKRLEFWANSLHQQITH--QKE---QLEIEYLTAVD 230

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
                +   ++E++   L   +K D     T +GPHR DL   + ++     +GS G+Q+
Sbjct: 231 SLETHTQEQIQEQFLALLNQNKKKDLFRGTTTVGPHRDDLSF-FINQKNVQTYGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   LI   TG  PILLLD++ + LD++++  L   + +   Q F+T T
Sbjct: 290 TTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDNRQLHLLETI-EGKVQTFLTTT 345


>gi|257888092|ref|ZP_05667745.1| recombination protein F [Enterococcus faecium 1,141,733]
 gi|293379371|ref|ZP_06625515.1| DNA replication and repair protein RecF [Enterococcus faecium
           PC4.1]
 gi|257824146|gb|EEV51078.1| recombination protein F [Enterococcus faecium 1,141,733]
 gi|292641894|gb|EFF60060.1| DNA replication and repair protein RecF [Enterococcus faecium
           PC4.1]
          Length = 374

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 93/360 (25%), Positives = 166/360 (46%), Gaps = 29/360 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WNDDQAMIQGEIAKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKL--SLTGF 231
            +   +  Q+A  G K+  AR + I       N+L   I  + ++    ++    SL   
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFIKRLEFWANSLHQQITHHKEQLEIEYLTAVDSLETH 235

Query: 232 LDGKFDQSFCALKEEYAKK-LFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
              +  + F AL  +  KK LF G         T +GPHR DL   + ++     +GS G
Sbjct: 236 TQEQIQEQFLALLNQNKKKDLFRG--------TTTVGPHRDDLSF-FINQKNVQTYGSQG 286

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + + LA   LI   TG  PILLLD++ + LD++++  L   + +   Q F+T T
Sbjct: 287 QQRTTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDNRQLHLLETI-EGKVQTFLTTT 345


>gi|160946607|ref|ZP_02093810.1| hypothetical protein PEPMIC_00565 [Parvimonas micra ATCC 33270]
 gi|158446991|gb|EDP23986.1| hypothetical protein PEPMIC_00565 [Parvimonas micra ATCC 33270]
          Length = 366

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 168/358 (46%), Gaps = 33/358 (9%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++++ FRN   +   F     +FVG NG+GKTN+LEAI        FR+A   D    G 
Sbjct: 6   IHLTNFRNLKDISFEFKENINVFVGKNGIGKTNVLEAIYISLVASSFRQAKQEDFISFGE 65

Query: 70  P-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
             +   TF R +G E      I     DD+  +  +I+D+ I+ V+EL     +    P 
Sbjct: 66  NFTKVDTFVREKGFEN----KISFLYTDDKK-KVFKIDDIKIKSVNELYDFSNVIGFFPD 120

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
             +I +     RR F D  +  +   +++++  +  ++  RN LL      S +   + A
Sbjct: 121 ELKIITESPNFRRNFFDSFIMKMTKGYKQKLNLYRNVIFRRNLLLKGMNLSSFYKQEMNA 180

Query: 189 ---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFL--------DGKFD 237
              ++A L  +I++ R ++I+ ++  +       NF H +LS             + K  
Sbjct: 181 LTKKLALLCYEISMERKKLIDLINKEV-------NFIHQQLSGETLYIEYESILSNHKRS 233

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAHGSTGEQKVV 295
           ++ C   +E  +      K+DS ++ T  G H+ +   I++  D     +  S G+++ +
Sbjct: 234 ENECL--KEILENFSKSYKIDSENKITSFGIHKENFKFILNGNDAK---SFSSQGQKRNI 288

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
           ++ I +    +     G  PI+LLD++ + LDED+R  +   +TD  +Q+F+T TDKS
Sbjct: 289 IITIKMCQKNIFEEYKGVKPIILLDDLFSELDEDRRYEILEYLTD--NQVFITTTDKS 344


>gi|315640353|ref|ZP_07895469.1| recombination protein F [Enterococcus italicus DSM 15952]
 gi|315483889|gb|EFU74369.1| recombination protein F [Enterococcus italicus DSM 15952]
          Length = 373

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 95/364 (26%), Positives = 166/364 (45%), Gaps = 38/364 (10%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  FRNY  L+L F     IF+G+N  GKTN+LE+I  L+  R  R  +  ++
Sbjct: 1   MRLNSLTLRHFRNYDELQLPFAKDLIIFLGENAQGKTNLLESIYVLAMTRSHRTTNEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                       A + G+      +I LE    +  R  ++N +  + +      L +  
Sbjct: 61  IEWDCAE-----AYLAGVVEKKQQTIPLELGLSKKGRKTKVNHIEQKKLSSYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  ID  +   ++ ++++++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGTPQLRRKFLDMEIGQIDSVYLYNLVQYQQVLKQRNQYLKQLAEKKQTDP 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKLSLTGF-- 231
            +   +  Q+   G KI   R+  +       N L  LI +  +KE       +   F  
Sbjct: 176 LYLDILTEQLVTFGSKILWTRINFVKKLEYWANQLHQLISQ--EKETLTLHYDATVAFEE 233

Query: 232 -----LDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH 286
                ++  + Q+F A++   AK+LF  R+M      TLIGPHR +L+     K +   +
Sbjct: 234 ANLADIEAAYSQAFAAIR---AKELF--RQM------TLIGPHRDELVFFINGKNVQ-TY 281

Query: 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIF 346
           GS G+Q+   + + LA   L+   TG  PILLLD++ + LD+ ++  L   + +   Q F
Sbjct: 282 GSQGQQRTTALSVKLAEIDLMKAETGEYPILLLDDVMSELDDSRQVHLLEAI-EGKVQTF 340

Query: 347 MTGT 350
           +T T
Sbjct: 341 LTTT 344


>gi|116493578|ref|YP_805312.1| recombination protein F [Lactobacillus casei ATCC 334]
 gi|227533503|ref|ZP_03963552.1| recombination protein F [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|122264959|sp|Q03D52|RECF_LACC3 RecName: Full=DNA replication and repair protein recF
 gi|116103728|gb|ABJ68870.1| DNA replication and repair protein RecF [Lactobacillus casei ATCC
           334]
 gi|227188832|gb|EEI68899.1| recombination protein F [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
          Length = 371

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 168/357 (47%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNYA++   F  +  + +G N  GKTN+LE+I  L+  R  R  +  ++
Sbjct: 1   MKLDHLVLKNYRNYAAVDTTFSPEINVLIGANAQGKTNLLESIYVLALARSHRTNNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS      FARV G       S +LE       +  +I+ +    + +   H  +  
Sbjct: 61  IRFGSE-----FARVSGQVSRQSGSHQLELIISHQGKRARIDRIEQPKLSQYLGHFNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D     + P++   +  ++  ++ RN  L +  +    D 
Sbjct: 116 FAPEDLAIVKGSPAGRRRFIDMEFGQMSPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALS---SLIMEYVQKE----NFPHIKLSLTGFLD 233
            +   +   +A  G ++  AR +++  +S   + I + + K     +F + +  +   L 
Sbjct: 176 VYLDVLTDSLAAFGAELITARAKLLETMSDYAATIQQDITKGRESLHFSY-QTQVDPSLR 234

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
           G  +Q + AL E +AK+    R+++  +  +L+GP R D++    DK +    GS G+Q+
Sbjct: 235 GNSEQVYTALGEMFAKQ--QAREIEQGT--SLVGPQRDDVLFIVNDKDVA-NFGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   L+ + TG  P+LLLD++ + LD  ++  L + +     Q F+T T
Sbjct: 290 TTALAVKLAEIDLMKDQTGEYPVLLLDDVLSELDAARQTHLLKAI-QTKVQTFLTTT 345


>gi|229826861|ref|ZP_04452930.1| hypothetical protein GCWU000182_02245 [Abiotrophia defectiva ATCC
           49176]
 gi|229788479|gb|EEP24593.1| hypothetical protein GCWU000182_02245 [Abiotrophia defectiva ATCC
           49176]
          Length = 364

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 93/363 (25%), Positives = 171/363 (47%), Gaps = 36/363 (9%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++IK L +++FRN  ++ + FD    I  GDN  GKTNILE+I      R  + +   ++
Sbjct: 1   MRIKSLALNDFRNIENISIEFDKGLNIIYGDNAQGKTNILESIYVAGTTRSHKGSKDKEM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRD-DRSV---------RCLQINDVVIRVVD 114
            ++G              E  A I I LE  D DR +         + + ++ + +    
Sbjct: 61  IKLG--------------EDEAHIRIILEKDDLDRKIDMHLKKSKSKGVAVDGIPVHKSA 106

Query: 115 ELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT 174
           ++   +++ +  P    +      ERRRF+D  +  I+  +   +  + +++  RN LL 
Sbjct: 107 DIFGIVQLIFFSPEDLSMIKDGPAERRRFIDMELSQIEKIYLYNLSKYNKILTQRNNLLK 166

Query: 175 EGYFDSSWCSSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGF 231
           +  +D+    +++    Q+   G++I  +R + I+ L+ +I          H KL+  G 
Sbjct: 167 QISYDTGLSDTLDVWDEQLVSTGLEIIKSRRKFISELNEIIKPI-------HEKLT-GGK 218

Query: 232 LDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
            + + + +    +E++  KL  GR  D   + TL GP R D+   Y +K     +GS G+
Sbjct: 219 EELEIEYNPNVTEEDFKDKLKSGRNSDIYQKTTLTGPQRDDITF-YINKNDVRKYGSQGQ 277

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
           Q+   + + L+   L    TG  PILLLD++ + LD  ++N L   + DI + I  TG +
Sbjct: 278 QRSTALSLKLSEIELFKKKTGDNPILLLDDVLSELDRSRQNYLIESIGDIQTIITCTGLE 337

Query: 352 KSV 354
           + V
Sbjct: 338 EFV 340


>gi|219853347|ref|YP_002470469.1| hypothetical protein CKR_0004 [Clostridium kluyveri NBRC 12016]
 gi|219567071|dbj|BAH05055.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 367

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 95/364 (26%), Positives = 172/364 (47%), Gaps = 29/364 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK+L +  FRNY  L + FD    IFVGDN  GKTNILE++ + S G+  R +   ++  
Sbjct: 6   IKYLKLINFRNYKELDIEFDKNINIFVGDNAQGKTNILESMYYCSIGKSPRTSKDKELIN 65

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +     ++ +V  ++ L +  I+++   +   + + IN + +  + EL   L +    
Sbjct: 66  WDNKE---SYIKVHILKKLFNKKIEIKIFKEGK-KGININSIKVSKLSELMGVLNVVMFS 121

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDSSW 182
           P   +I     + RR+FLD  +     ++   ++ + +++  RN +L +     Y D   
Sbjct: 122 PEDLKIIKESPVYRRKFLDIELCKFSKKYYYGLVQYNKVLTARNIILKKWNKGNYID--I 179

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC- 241
               + Q+A+ G  I   R   +  LS       +K    H  ++ +G  + +F    C 
Sbjct: 180 LQVYDKQLAKYGEVIIKLRNNYLKKLS-------EKGKVIHSDIT-SGIENIEFKYMTCL 231

Query: 242 ----ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVL 296
                ++++  K L   RK D     TL GPHR D IV+     + + + GS G+Q+  +
Sbjct: 232 TNFDNIEDDLFKILEFNRKKDIYKGITLYGPHRDDFIVNI--NGVNVRNFGSQGQQRTSI 289

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KS 353
           + +  A   +I    G  P+LLLD++ + LD++++  +   + DI + I  TG D   KS
Sbjct: 290 LTMKFASLEIIKEIIGEYPVLLLDDVLSELDKNRQKYILSSIKDIQTFITCTGIDDIKKS 349

Query: 354 VFDS 357
           + D 
Sbjct: 350 IIDE 353


>gi|153952674|ref|YP_001393439.1| recombination protein F [Clostridium kluyveri DSM 555]
 gi|189039621|sp|A5N460|RECF_CLOK5 RecName: Full=DNA replication and repair protein recF
 gi|146345555|gb|EDK32091.1| RecF [Clostridium kluyveri DSM 555]
          Length = 364

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 95/364 (26%), Positives = 172/364 (47%), Gaps = 29/364 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK+L +  FRNY  L + FD    IFVGDN  GKTNILE++ + S G+  R +   ++  
Sbjct: 3   IKYLKLINFRNYKELDIEFDKNINIFVGDNAQGKTNILESMYYCSIGKSPRTSKDKELIN 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +     ++ +V  ++ L +  I+++   +   + + IN + +  + EL   L +    
Sbjct: 63  WDNKE---SYIKVHILKKLFNKKIEIKIFKEGK-KGININSIKVSKLSELMGVLNVVMFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDSSW 182
           P   +I     + RR+FLD  +     ++   ++ + +++  RN +L +     Y D   
Sbjct: 119 PEDLKIIKESPVYRRKFLDIELCKFSKKYYYGLVQYNKVLTARNIILKKWNKGNYID--I 176

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC- 241
               + Q+A+ G  I   R   +  LS       +K    H  ++ +G  + +F    C 
Sbjct: 177 LQVYDKQLAKYGEVIIKLRNNYLKKLS-------EKGKVIHSDIT-SGIENIEFKYMTCL 228

Query: 242 ----ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVL 296
                ++++  K L   RK D     TL GPHR D IV+     + + + GS G+Q+  +
Sbjct: 229 TNFDNIEDDLFKILEFNRKKDIYKGITLYGPHRDDFIVNI--NGVNVRNFGSQGQQRTSI 286

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KS 353
           + +  A   +I    G  P+LLLD++ + LD++++  +   + DI + I  TG D   KS
Sbjct: 287 LTMKFASLEIIKEIIGEYPVLLLDDVLSELDKNRQKYILSSIKDIQTFITCTGIDDIKKS 346

Query: 354 VFDS 357
           + D 
Sbjct: 347 IIDE 350


>gi|205371909|ref|ZP_03224729.1| recombination protein F [Bacillus coahuilensis m4-4]
          Length = 372

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 171/370 (46%), Gaps = 23/370 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L++  +RNY +  L F+ +  +F+G N  GKTNI+E+I  L+  +  R ++  D+ R
Sbjct: 3   IQELSVENYRNYETESLEFENRVNVFLGQNAQGKTNIMESIYVLAMAKSHRTSNDKDLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                + S +AR++G     + SI LE    +  +  ++N +    + +   ++ +    
Sbjct: 63  -----WDSEYARIKGRIQKRNGSIPLELTISKKGKKAKLNHLEQSKLSQYIGNMNVVMFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY----FDSSW 182
           P    +  G    RRRF+D  +  + P +   +  + ++++ RN  L +       D + 
Sbjct: 118 PEDLNLVKGSPQVRRRFIDMEIGQVSPVYLHDINQYNKILQQRNSYLKQAQQRKKVDETM 177

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ------KENFPHIKLSLTGFLDGKF 236
              +  Q  ++ VKI   R + ++    L+ E+ +        N   + +S    +    
Sbjct: 178 LDVLTDQFIQVAVKIVQKRFQFVH----LLEEWAKPIHSGISRNLEELTISYKPSVHVSE 233

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
           DQ +  + E + ++  + R+ +     TL GPHR DL      + +    GS G+Q+   
Sbjct: 234 DQDWSKMIEVFEERTKEVREREKERGVTLFGPHRDDLEFRVNGRDVQ-TFGSQGQQRTTA 292

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + + LA   LI +  G  PILLLD++ + LD+ +++ L   +     Q F+T T     D
Sbjct: 293 LSVKLAEIELIHSEIGEYPILLLDDVLSELDDYRQSHLLNTIQG-KVQTFVTTTSTEGID 351

Query: 357 --SLNETAKF 364
             +L E A F
Sbjct: 352 HQTLKEAATF 361


>gi|191636828|ref|YP_001985994.1| recombination protein F [Lactobacillus casei BL23]
 gi|301065130|ref|YP_003787153.1| recombinational DNA repair ATPase [Lactobacillus casei str. Zhang]
 gi|226737807|sp|B3W6Q9|RECF_LACCB RecName: Full=DNA replication and repair protein recF
 gi|190711130|emb|CAQ65136.1| DNA replication and repair protein recF [Lactobacillus casei BL23]
 gi|300437537|gb|ADK17303.1| Recombinational DNA repair ATPase (RecF pathway) [Lactobacillus
           casei str. Zhang]
 gi|327380866|gb|AEA52342.1| DNA replication and repair protein recF [Lactobacillus casei LC2W]
 gi|327384031|gb|AEA55505.1| DNA replication and repair protein recF [Lactobacillus casei BD-II]
          Length = 371

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 168/357 (47%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNYA++   F  +  + +G N  GKTN+LE+I  L+  R  R  +  ++
Sbjct: 1   MKLDHLVLKNYRNYAAVDTTFSPEINVLIGANAQGKTNLLESIYVLALARSHRTNNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS      FARV G       S +LE       +  +I+ +    + +   H  +  
Sbjct: 61  IRFGSE-----FARVSGQVSRQSGSHQLELIISHQGKRARIDRIEQPKLSQYLGHFNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D     + P++   +  ++  ++ RN  L +  +    D 
Sbjct: 116 FAPEDLAIVKGSPAGRRRFIDMEFGQMSPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALS---SLIMEYVQKE----NFPHIKLSLTGFLD 233
            +   +   +A  G ++  AR +++  +S   + I + + K     +F + +  +   L 
Sbjct: 176 VYLDVLTDSLAAFGAELITARAKLLETMSDYAATIQQDITKGRESLHFSY-QTQVDPSLR 234

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
           G  +Q + AL E +AK+    R+++  +  +L+GP R D++    DK +    GS G+Q+
Sbjct: 235 GDSEQVYTALGEMFAKQ--QAREIEQGT--SLVGPQRDDVLFIVNDKDVA-NFGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   L+ + TG  P+LLLD++ + LD  ++  L + +     Q F+T T
Sbjct: 290 TTALAVKLAEIDLMKDQTGEYPVLLLDDVLSELDAARQTHLLKAI-QTKVQTFLTTT 345


>gi|325280925|ref|YP_004253467.1| DNA replication and repair protein recF [Odoribacter splanchnicus
           DSM 20712]
 gi|324312734|gb|ADY33287.1| DNA replication and repair protein recF [Odoribacter splanchnicus
           DSM 20712]
          Length = 364

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 165/359 (45%), Gaps = 23/359 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K LNI  F+N A   L F +    FVG+NGVGKTN+L+AI  LS  + +         R
Sbjct: 3   LKELNIINFKNIAEATLTFTSGFNCFVGNNGVGKTNVLDAIYHLSMCKSYFNLPDLQNIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
              P FF    + E   G  ++++    +  +  +  + N    +  D+L++H+ +  LV
Sbjct: 63  HEEP-FFVVQGKYE--RGGEELTVYCGVKRGQK-KVFKKNQ---KAYDKLSEHIGLIPLV 115

Query: 127 ---PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG---YFDS 180
              P    +  G S ERR+ +D ++   D  +  R+I + + +  RN LL      + D 
Sbjct: 116 MISPEDFILIDGGSEERRKLVDGIISQCDRVYLHRLIRYNKALTQRNMLLKSAAGKFLDP 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
                   Q+AE G  I   R+  +    S+   Y ++ +    ++ L      K     
Sbjct: 176 EMLEVWNEQLAEHGEAIRQKRIAFLKEFRSVFQTYYERLSLGREEVCLEYKPSVKEGNFL 235

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
            ALK+   +        D +   T +G HR DL+++  D A+    GS G++K  L+ + 
Sbjct: 236 TALKQAADR--------DRLLTYTTVGIHRDDLVLNIGDYAVRKI-GSQGQKKTFLIALK 286

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIV-TDIGSQIFMTGTDKSVFDSL 358
           LA    +   +   P+LLLD+I   LD D+   + +IV  ++  Q+F+T T++   D +
Sbjct: 287 LAQYHWLHQMSEVKPLLLLDDIFDKLDADRVEQIVKIVGGEMFGQVFITDTNRGHIDDI 345


>gi|306828609|ref|ZP_07461803.1| recombination protein F [Streptococcus mitis ATCC 6249]
 gi|304429217|gb|EFM32303.1| recombination protein F [Streptococcus mitis ATCC 6249]
          Length = 363

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 92/370 (24%), Positives = 167/370 (45%), Gaps = 22/370 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKETKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + GM      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGMLQKKTGSIPLEIDLTPKGRVTKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSSQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCALK 244
           ++ Q+ E G ++   R++ I  L     ++ QK+   H+++S  +  L   +  +     
Sbjct: 178 LDDQLVEYGCRVIKHRIKFIKDLE----KFGQKK---HLEISNQSEELSISYQSTVNFTN 230

Query: 245 EE-----YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           EE     +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 231 EEVLMDSFKMALEKSRSRDLFKKNTGVGPHRDD--IAFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITNESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISN 369
           E      I N
Sbjct: 348 ENLSIFNIQN 357


>gi|255530448|ref|YP_003090820.1| DNA replication and repair protein RecF [Pedobacter heparinus DSM
           2366]
 gi|255343432|gb|ACU02758.1| DNA replication and repair protein RecF [Pedobacter heparinus DSM
           2366]
          Length = 367

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 104/380 (27%), Positives = 168/380 (44%), Gaps = 38/380 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K + +  F+NY    + F      FVGDNG GKTN+L+AI +L   +G+         +
Sbjct: 3   LKNITLLNFKNYTDANVSFSKTVNAFVGDNGAGKTNLLDAIHYLCLCKGYFNPIDTQQIK 62

Query: 67  IGSPSFF--STFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            G   F     F R E  E    I+  ++    +  +  +      +  D+L  H+ +  
Sbjct: 63  AGQDLFLIQGDFDRQEKNEK---ITCGVKRNQKKQFKRNK------KEYDKLANHIGLFP 113

Query: 125 LV---PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GY 177
           LV   P    I    S ERRRF+D ++   D  +   +I + R +  RN LL +      
Sbjct: 114 LVMISPYDTNIIMEGSEERRRFMDNVISQTDTNYLDELILYNRHLLNRNALLKQIAVTRS 173

Query: 178 FDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGK 235
           +D +       Q+   G+KI   R + +     L  +Y Q   E+   + L     L+  
Sbjct: 174 YDPTLLEIYNDQLVASGLKIYAKRQQFMIEFIPLFDKYYQFLTEDQERVSLQYQSQLN-- 231

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
            D +F  L ++  +K       D +  RT  G H+ +LI    D A+    GS G+QK  
Sbjct: 232 -DAAFEQLLQQSVEK-------DKVLERTTTGIHKDELIFTISDMALK-KFGSQGQQKSF 282

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT--DIGSQIFMTGTDK- 352
           L+ + LA    +    GF P+LLLD+I   LD+ + + L  +V+  D G QIF+T T K 
Sbjct: 283 LIALKLAQYAYLQKYKGFKPLLLLDDIFDKLDDKRMHKLMEMVSHHDFG-QIFITDTGKE 341

Query: 353 ---SVFDSLNETAKFMRISN 369
              +VF+ +        ++N
Sbjct: 342 RVLAVFNKIQVPVTLFEVNN 361


>gi|76787191|ref|YP_330704.1| recombination protein F [Streptococcus agalactiae A909]
 gi|77406514|ref|ZP_00783567.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           H36B]
 gi|77411774|ref|ZP_00788110.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           CJB111]
 gi|97180994|sp|Q3JYE9|RECF_STRA1 RecName: Full=DNA replication and repair protein recF
 gi|76562248|gb|ABA44832.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           A909]
 gi|77162165|gb|EAO73140.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           CJB111]
 gi|77174886|gb|EAO77702.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           H36B]
          Length = 369

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/366 (25%), Positives = 165/366 (45%), Gaps = 14/366 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  +RNY   ++ F     IF+G N  GKTN LEAI FL+  R  R  S  ++  
Sbjct: 3   IKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   T   V    G   + I+L  +     R  ++N +    + +    + +    
Sbjct: 63  FKHHDVQIT-GEVIRKSGHLSLDIQLSEKG----RITKVNHLKQAKLSDYIGAMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+FLD  +  I P +   + ++  +++ RN  L T    D ++ S 
Sbjct: 118 PEDLQLVKGAPSLRRKFLDIDIGQIKPTYLAELSNYNHVLKQRNTYLKTTNNVDKTFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R + I AL+       Y+      H+ +     ++   D+S  ++
Sbjct: 178 LDEQLADYGSRVIEHRFDFIQALNDEADKHHYIISTELEHLSIHYKSSIEFT-DKS--SI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E +  +L      D   + T IGPHR D+     D  I    GS G+Q+ +++ + LA 
Sbjct: 235 REHFLNQLSKSHSRDIFKKNTSIGPHRDDITFFIND--INATFGSQGQQRSLILSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             LI   T   PILLLD++ + LD  ++  L   + +   Q F+T T      +L +  K
Sbjct: 293 IELIKTVTNDYPILLLDDVMSELDNHRQLKLLEGIKE-NVQTFITTTSLEHLSALPDQLK 351

Query: 364 FMRISN 369
              +S+
Sbjct: 352 IFNVSD 357


>gi|296875531|ref|ZP_06899603.1| recombination protein F [Streptococcus parasanguinis ATCC 15912]
 gi|296433455|gb|EFH19230.1| recombination protein F [Streptococcus parasanguinis ATCC 15912]
          Length = 364

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/367 (26%), Positives = 166/367 (45%), Gaps = 13/367 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L+I  FRNY  L + F     IF+G N  GKTNILE+I FL+  R  R  +  D+  
Sbjct: 3   LKQLSIQHFRNYQELEVEFHPGLNIFLGQNAQGKTNILESIYFLALTRSHRTRNDRDLIY 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S  F     +V G        + LE       R  ++N +    +     H+ +    
Sbjct: 63  FESTDF-----KVSGQLQRETGPLPLEISLTPKGRITKVNHLKQAKLSNYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  + P +   +  +  +++ RN  L      D+++   
Sbjct: 118 PEDLQLIKGSPAGRRKFIDIELGQMKPLYLSDLSQYNHVLKQRNSYLKNSEKIDATFLEV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +++Q+A  G ++   R+E I  L +   E   + +     LS+  +    F +    ++E
Sbjct: 178 LDSQLASFGSRVIYHRLEFIKKLEAKAKEKHTRLSDNKEDLSIQ-YQSTVFSEDGNDIEE 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++   L   R+ D   + T IGPHR DL   +    +    GS G+ + V++ + LA   
Sbjct: 237 QFLSMLEKNRQKDIFRKTTSIGPHRDDLA--FFINNMNATFGSQGQHRSVVLSLKLAEIE 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   T   PILLLD++ + LD  ++  L   +++   Q F+T T     D L E  + +
Sbjct: 295 LMEEITREKPILLLDDVMSELDNYRQLQLLETISN-NIQTFITTT---TLDHLKELPEEL 350

Query: 366 RISNHQA 372
           +I   QA
Sbjct: 351 KIFTIQA 357


>gi|293364503|ref|ZP_06611228.1| recombination protein F [Streptococcus oralis ATCC 35037]
 gi|307702791|ref|ZP_07639741.1| DNA replication and repair protein recF [Streptococcus oralis ATCC
           35037]
 gi|291317011|gb|EFE57439.1| recombination protein F [Streptococcus oralis ATCC 35037]
 gi|307623647|gb|EFO02634.1| DNA replication and repair protein recF [Streptococcus oralis ATCC
           35037]
          Length = 363

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 166/380 (43%), Gaps = 42/380 (11%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKEAKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +         + G+      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDNEQL-----HLSGLLQKKTSSIPLEIDLTPKGRVTKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSSQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMI---------------NALSSLIMEYVQKENFPHIKLSLTG 230
           ++ Q+ E G ++   R++ I               N L  L + Y    NF         
Sbjct: 178 LDDQLVEYGCRVIKHRIKFIKDLEKFGQKKHLEISNKLEELSISYQSSVNFTD------- 230

Query: 231 FLDGKFDQSF-CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
             D +   SF  AL++  ++ LF         + T +GPHR D  + +    +  + GS 
Sbjct: 231 --DEQLTNSFKIALEKSRSRDLF--------KKNTGVGPHRDD--IAFYINGMDASFGSQ 278

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           G+ + +++ I LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T 
Sbjct: 279 GQHRSLVLSIKLAEIELMESITNESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITT 337

Query: 350 TDKSVFDSLNETAKFMRISN 369
           T      +L E      I N
Sbjct: 338 TSLDHLQNLPENLSIFNIQN 357


>gi|302390801|ref|YP_003826621.1| DNA replication and repair protein RecF [Acetohalobium arabaticum
           DSM 5501]
 gi|302202878|gb|ADL11556.1| DNA replication and repair protein RecF [Acetohalobium arabaticum
           DSM 5501]
          Length = 374

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 165/346 (47%), Gaps = 13/346 (3%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           +  FRNY +L L  +    IF+GDN  GKTNILEAI  LS G   R    +++      S
Sbjct: 8   LKNFRNYHTLELKLNRNLNIFIGDNAEGKTNILEAIYLLSTGDSHRTNITSEMVNWQQDS 67

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
           F+     +  +    +   K+E       + ++IND  ++ +++L  ++      P    
Sbjct: 68  FY-----ISSLVNRKEQEFKIEFLFKNRKKEVKINDNKLQKLEDLLGYINAIIFSPEDLE 122

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFDSSWCSSIEA 188
           +  G   +RR+F++  +  ++  +   + ++ R+++ RN LL    EG            
Sbjct: 123 LVKGSPSKRRKFINLEISQVNSYYYHNLQEYRRIVKQRNNLLKEIREGKSSKDMLVVWNQ 182

Query: 189 QMAELGVKINIARVEMINALSSL--IMEYVQKENFPHIKLSLTGFLDGKFDQSFC-ALKE 245
           Q+ ELG KI   R+  ++ LS L  +M     +    ++LS    LD   + S    ++ 
Sbjct: 183 QLIELGSKIITKRLNALDKLSILARLMHRKITDGLETLELSYQSSLDLNGNNSTTEEIET 242

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
            + KKL   ++ +     ++ GPHR D+I +  D   T   GS G+Q+   + + LA   
Sbjct: 243 VFTKKLKANQQKEIDRGVSIFGPHRDDIIFEIND-INTRKFGSQGQQRTAALALKLAELE 301

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            + +  G  PILLLD++ + LD +++  L +++ +   Q F+T T+
Sbjct: 302 FMKSEIGEYPILLLDDVFSELDNNRQQYLLKVIEN-RIQTFITSTE 346


>gi|168187274|ref|ZP_02621909.1| DNA replication and repair protein RecF [Clostridium botulinum C
           str. Eklund]
 gi|169294762|gb|EDS76895.1| DNA replication and repair protein RecF [Clostridium botulinum C
           str. Eklund]
          Length = 361

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 94/372 (25%), Positives = 178/372 (47%), Gaps = 27/372 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY  L L   +   +F+GDN  GKTNILE+I + S G+  R     ++ +
Sbjct: 3   IKNLELINFRNYERLSLNLHSGINVFIGDNAQGKTNILESIYYCSIGKSHRTNKDKELIK 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  ++ S +   E ++   DI I  E +     + +++N + ++ + +L     +   
Sbjct: 63  WGARDAYISIYVSKERLDKKIDIKIFKEGK-----KGVRVNSIKLKTISDLIGVFNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   +I       RR+FLD  +  ++ ++   ++ + +++  RN +L +   +      
Sbjct: 118 SPEDLKIIKESPSYRRKFLDIELSKLNKKYYHSLVIYNKVLNERNTILRKWNSNKEVTEV 177

Query: 186 IEAQMAELGVKINIARVEMINALS---SLIMEYV--QKEN--FPHIKLSLTGFLDGKFDQ 238
            + Q+++ G  I   R++ I +LS   + I + +  QKEN  F +I    T   D     
Sbjct: 178 YDYQLSKYGSYIIKERLKYIESLSLRGNKIHKDITSQKENIEFKYI----TSIKD----- 228

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
               ++ ++   L    K D     T  GPHR D  V+  +   T  +GS G+Q+  ++ 
Sbjct: 229 -LSNIQNDFYNILRQNIKKDFEKGSTSFGPHRDDFAVN-INATDTRIYGSQGQQRTAVLT 286

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK-SVFDS 357
           I LA   +I   TG  P+LLLD++ + LD +++  +   + +   Q  +TGT    + + 
Sbjct: 287 IKLASLEIIKEQTGEYPVLLLDDVLSELDINRQKYILNSIREF--QTIITGTGLIDIREY 344

Query: 358 LNETAKFMRISN 369
           L++  K  +++N
Sbjct: 345 LDDHVKLFKVTN 356


>gi|257899274|ref|ZP_05678927.1| recombination protein F [Enterococcus faecium Com15]
 gi|293572721|ref|ZP_06683685.1| DNA replication and repair protein RecF [Enterococcus faecium E980]
 gi|257837186|gb|EEV62260.1| recombination protein F [Enterococcus faecium Com15]
 gi|291607213|gb|EFF36571.1| DNA replication and repair protein RecF [Enterococcus faecium E980]
          Length = 374

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/360 (25%), Positives = 166/360 (46%), Gaps = 29/360 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WNDDQAMIQGEITKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKL--SLTGF 231
            +   +  Q+A  G K+  AR + I       N+L   I  + ++    ++    SL   
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFIKRLEFWANSLHQQITHHKEQLEIEYLTAVDSLETH 235

Query: 232 LDGKFDQSFCALKEEYAKK-LFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
              +  + F AL  +  KK LF G         T +GPHR DL   + ++     +GS G
Sbjct: 236 TQEQIQEQFLALLNQNKKKDLFRG--------TTTVGPHRDDLSF-FINQKNVQTYGSQG 286

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + + LA   LI   TG  PILLLD++ + LD++++  L   + +   Q F+T T
Sbjct: 287 QQRTTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDNRQLHLLETI-EGKVQTFLTTT 345


>gi|116668572|ref|YP_829505.1| recombination protein F [Arthrobacter sp. FB24]
 gi|166220698|sp|A0JQT5|RECF_ARTS2 RecName: Full=DNA replication and repair protein recF
 gi|116608681|gb|ABK01405.1| DNA replication and repair protein RecF [Arthrobacter sp. FB24]
          Length = 401

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 103/386 (26%), Positives = 177/386 (45%), Gaps = 39/386 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++++FR+YA + L  +   T+ VG NG+GKTN++EAI +L+     R +S A + R
Sbjct: 3   LEKLSLTDFRSYAQVDLTLEPGVTVLVGYNGIGKTNLMEAIGYLATLSSHRVSSDAPLLR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G+        R + + G     ++LE    R+ R        +R  D L    +     
Sbjct: 63  FGTE---RALIRAKLVRGGQSTVLELEINGSRANRGRINRSNPVRARDILGI-CQTVLFA 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFDSSWC 183
           P    +  G    RRRFLD ++ ++ PRH     D++R+++ RN LL     G F +   
Sbjct: 119 PEDLALVKGDPSNRRRFLDELLVSLMPRHSATRTDYDRVLKQRNALLKSGRSGKFTAGHE 178

Query: 184 SSIEA---QMAELGVKINIARVEMINAL-SSLIMEYVQ-----KENFPHIKLSLTGFLDG 234
           ++++     MA  G ++  AR+E++  +   L   Y Q     KE     + +L G LD 
Sbjct: 179 ATLDVWDQHMARAGAELLYARLELVERIRPHLKAAYAQLTDGSKEADAIYRSTLQGILDD 238

Query: 235 KFDQSFCALKEEYAKKLFDGRKMD------------SMSRR-------TLIGPHRSDLIV 275
               +  A +    +++ D R +             + SRR       +L+GPHR D+ +
Sbjct: 239 DGAGAGYAAEPAAVERVEDLRALSVEELTQRYVQAFAASRRKELERGISLVGPHRDDVEL 298

Query: 276 DYCDKAITIAHGSTGEQKVVLVGIFLAHARLI---SNTTGFAPILLLDEISAHLDEDKRN 332
               +A    + S GE   + + + LA   ++   + T G APIL+LD++ A LD  +R 
Sbjct: 299 -ILGEAPAKGYASHGETWSMCLSLRLASYYVMLDDARTGGSAPILILDDVFAELDVQRRR 357

Query: 333 ALFRIVTDIGSQIFMTGTDKSVFDSL 358
            L  IV+     +     D  + D L
Sbjct: 358 KLAAIVSGAEQVLVTAAVDADIPDEL 383


>gi|258506999|ref|YP_003169750.1| DNA replication and repair protein recF [Lactobacillus rhamnosus
           GG]
 gi|257146926|emb|CAR85899.1| DNA replication and repair protein recF [Lactobacillus rhamnosus
           GG]
 gi|259648369|dbj|BAI40531.1| recombination protein RecF [Lactobacillus rhamnosus GG]
          Length = 372

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/357 (24%), Positives = 166/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNYA++   F  +  + +G+N  GKTN+LEAI  L+  R  R  +  ++
Sbjct: 1   MKLDHLTLKNYRNYATVDTAFSPEINVLIGENAQGKTNLLEAIYVLALARSHRTNNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS      FARV G       + +LE       +  +I+ +    + +   H  +  
Sbjct: 61  IRFGSD-----FARVSGQISRQSGTHQLELIISHQGKRARIDRIEQSKLSQYLGHFNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D     + P++   +  ++  ++ RN  L +  +    D 
Sbjct: 116 FAPEDLAIVKGSPAGRRRFIDMEFGQMSPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHIKLSLTGFLD 233
            +   +   +A  G ++  AR +++  +S         I +  +K  F + +  +   L 
Sbjct: 176 VYLDVLTDSLAAFGAELITARAKLLQTMSDYAAAIQQDITKGREKLQFAY-QTQVAADLR 234

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
              +Q + AL   +AK+    R+++  +  +L+GPHR D++    DK +    GS G+Q+
Sbjct: 235 QDSEQVYEALGALFAKQ--QSREIEQGT--SLVGPHRDDVLFIVNDKDVA-NFGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   L+ + TG  P+LLLD++ + LD  ++  L + +     Q F+T T
Sbjct: 290 TTALAVKLAEIDLMKDQTGEYPVLLLDDVLSELDAIRQTHLLKAI-QAKVQTFLTTT 345


>gi|227541368|ref|ZP_03971417.1| recombination protein F [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227182919|gb|EEI63891.1| recombination protein F [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 374

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/361 (26%), Positives = 161/361 (44%), Gaps = 14/361 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L + +FR++  L L      T+F G NG GKTNI+E+I +L+     R    A + R
Sbjct: 3   VRHLTLKDFRSWPELDLELGPGVTVFTGANGFGKTNIVESIYYLANLSSHRVKHDAPLVR 62

Query: 67  IGSP-SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  +  +      G E +  +++K       +    Q+N   +R   EL   +R    
Sbjct: 63  AGADVAQLAATVVSGGRELVVRMTVK-----PHAANLAQLNRTRLRHPRELLGGVRCVLF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG---YFDS-- 180
            P    + +G    RRR +D ++    PR      ++ER+++ RN LL +    ++ S  
Sbjct: 118 SPEDLHLVTGEPEGRRRLIDSVISQETPRFSATKAEYERVLKQRNALLKQAKANFYPSMH 177

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSF 240
                 ++Q+A LG ++  AR  +I  L  L+ E    E  PH +     +L     ++ 
Sbjct: 178 GMLDVWDSQLASLGAELVTARSALITRLHPLV-EAAYLEIAPHSRPPAISYLTRDQAETT 236

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
              +      L + R  +  + RTLIGPH+ DL + Y  +A      S GE     + + 
Sbjct: 237 ADTEALLLTSLAEIRPREIDAGRTLIGPHKDDLGL-YLGEAPAKGFASHGETWSFAIALK 295

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           +A  RL S T G  PIL+LD++ A LD  +R AL  ++      +  T     +   L  
Sbjct: 296 IAVFRLFS-TGGHIPILILDDVFAELDNPRRQALTSMIRSAEQVLITTAVPTDIPTDLTH 354

Query: 361 T 361
           T
Sbjct: 355 T 355


>gi|116332685|ref|YP_794212.1| recombination protein F [Lactobacillus brevis ATCC 367]
 gi|122270619|sp|Q03UE1|RECF_LACBA RecName: Full=DNA replication and repair protein recF
 gi|116098032|gb|ABJ63181.1| DNA replication and repair protein RecF [Lactobacillus brevis ATCC
           367]
          Length = 384

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 160/372 (43%), Gaps = 51/372 (13%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L + +FRNY + +L F     + +G+N  GKTN+LEAI  L+  R  R A+  D+  
Sbjct: 3   LQELQLQQFRNYPTAKLTFGQGINVLLGENAQGKTNLLEAIYVLALTRSHRTANDHDLV- 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               ++ +  A+V G    A  ++ LE    R  +  ++N +    + +    L +    
Sbjct: 62  ----NWQAKTAKVSGRVVKAAGAVPLELTFSRQGKRARVNHLEQARLSQYVGQLNVILFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DSSW 182
           P    I  G    RRRF+D     ++PR+   +  +  L++ RNR L +       D  +
Sbjct: 118 PEDLAIVKGAPTVRRRFMDMEFGQMNPRYLYNLSQYRTLLKQRNRYLKDLQHKQNKDLLF 177

Query: 183 CSSIEAQMAELGVKINIARVEMINAL---------------SSLIMEYV------QKENF 221
            S +  Q+A  G +I   R+ M+  L                 L   Y       Q  + 
Sbjct: 178 LSVLSDQLAAFGAEIIAQRLAMLQKLEHWAQAIHGEISQQREELTFHYATQVADDQLTDV 237

Query: 222 PHIKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKA 281
           P I  +L+     + D           K+L+ G         TL+GPHR DL      K 
Sbjct: 238 PTITAALSALYAKQQD-----------KELYQG--------TTLVGPHRDDLHFQVNGKN 278

Query: 282 ITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDI 341
           +    GS G+Q+   + + LA   L+   TG  P+LLLD++ + LD+ ++  L   + D 
Sbjct: 279 VQ-TFGSQGQQRTTALSVKLAEIDLMKEETGEYPVLLLDDVLSELDDARQTHLLTAIQD- 336

Query: 342 GSQIFMTGTDKS 353
             Q F+T T  S
Sbjct: 337 KVQTFITTTSLS 348


>gi|313894734|ref|ZP_07828295.1| DNA replication and repair protein RecF [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312976643|gb|EFR42097.1| DNA replication and repair protein RecF [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 373

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 106/368 (28%), Positives = 166/368 (45%), Gaps = 31/368 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  L +  +RNY  L L FD    IF+G N  GKTNI+EA+ + S GR  R  S A++
Sbjct: 1   MRITRLELHSYRNYEILDLRFDPGVQIFLGANAQGKTNIIEALYYASFGRSHRTTSDAEL 60

Query: 65  TRIGSPS--FFSTFAR--VEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
            R+G  +     +F R  V G     ++S   E    R  R L+  + + +   EL   L
Sbjct: 61  IRMGESAGRIDLSFLRHDVPG-----ELSFTFERGHRR--RILRAGEPLRQ--RELVGLL 111

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGY 177
            +    P    +  G    RRR+LD  +    P +   ++ +  ++R R  +L    E  
Sbjct: 112 PMVLFSPEDLFLVKGAPALRRRYLDAELSQASPAYYGELLRYTHILRQRGAILKDIRERL 171

Query: 178 FDSSWCSSIEAQMAELGVKI---NIARVEMINALSSLIM-------EYVQKENFPHIKLS 227
                    + Q+A    +I    IA  E + ALS  +        E        H+   
Sbjct: 172 VPVDALEPWDVQLARSAARIVTRRIAAAERLGALSGRVQAVLAAGEELTISYEIAHVPDD 231

Query: 228 LTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
           L G  DG  D+    L+  Y K L + R  D     T +GPH  DL++     ++  ++G
Sbjct: 232 LPGEKDGMADR----LEVWYNKALSEFRFRDIARGSTGVGPHLDDLVLSVGGMSLR-SYG 286

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           S G+Q+   + + LA    + ++ G APILLLD++ + LD D+R AL   +     Q F+
Sbjct: 287 SQGQQRTGALALKLAELFYLRDSVGEAPILLLDDVMSELDADRRAALLSFIRSEHIQTFI 346

Query: 348 TGTDKSVF 355
           T TD + F
Sbjct: 347 TATDAAYF 354


>gi|302872926|ref|YP_003841559.1| DNA replication and repair protein RecF [Clostridium cellulovorans
           743B]
 gi|307687879|ref|ZP_07630325.1| recombination protein F [Clostridium cellulovorans 743B]
 gi|302575783|gb|ADL49795.1| DNA replication and repair protein RecF [Clostridium cellulovorans
           743B]
          Length = 364

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/368 (23%), Positives = 171/368 (46%), Gaps = 28/368 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L +  FRNY  L +   +   +F GDN  GKTN+LEAI + S G+  R     ++  
Sbjct: 3   IENLKLRNFRNYKELNIDLYSGVNVFTGDNAQGKTNVLEAIYYCSLGKSHRTNKDKELI- 61

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSV---------RCLQINDVVIRVVDELN 117
                        + + G  ++++  +TR ++ +         + + IN + ++ + EL 
Sbjct: 62  -----------LWDALSGQLEVTVN-KTRLNKKIKIDILKEGKKAISINSIKLKKISELI 109

Query: 118 KHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY 177
               +    P   +I       RR+FLD  +  ++ ++   ++ + +++  RN +L    
Sbjct: 110 GICNVVMFSPEDLKIVKDSPSYRRKFLDIELCKLNSKYYFNLVQYNKVLNERNVVLKSNN 169

Query: 178 FDS-SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF 236
            ++       + Q+A+ G  I   RV+ IN L+    E  +       K+S +   D K 
Sbjct: 170 GNNLDIIEVYDMQLAKFGSHIVKDRVDYINKLNRYGQEIHKDITVSKEKISFSYITDAK- 228

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVL 296
             +   ++ E    L   R+ D + + T +GPHR D  ++  D   T ++GS G+Q+  +
Sbjct: 229 --NLNGIEVELINLLKKNRQRDFIKKSTTVGPHRDDFSIEIND-IDTRSYGSQGQQRTSI 285

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + I  A  ++I    G  PILLLD++ + LD +++  +   + D+ + I  TG ++ + +
Sbjct: 286 LTIKFASLKIIKELIGEYPILLLDDVLSELDTNRQKYILNSIKDVQTVITCTGMNE-INN 344

Query: 357 SLNETAKF 364
            LN+  K 
Sbjct: 345 YLNDDYKL 352


>gi|168484319|ref|ZP_02709271.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           CDC1873-00]
 gi|172042411|gb|EDT50457.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           CDC1873-00]
 gi|332198850|gb|EGJ12932.1| DNA replication and repair protein recF [Streptococcus pneumoniae
           GA47368]
          Length = 365

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSVQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I N +A
Sbjct: 348 ENLSIFTIQNGKA 360


>gi|168335261|ref|ZP_02693362.1| DNA replication and repair protein RecF [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 359

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 169/375 (45%), Gaps = 27/375 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I  L+++ FRNY  L L       IF GDN  GKTN+LEAI   +  R  R  S  +V +
Sbjct: 3   ISTLSLTNFRNYQHLSLSLSKGINIFFGDNAQGKTNVLEAIYLCATARSHRTTSEKEVIK 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S +       +     L+ I   +  R     + + +N + I  + +L   L + +  
Sbjct: 63  WDSENALVNLM-LTKQYSLSTIDFIISKR----YKSVLVNKLPINKLTKLFGVLNVVFFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY--FDSSWCS 184
           P    +      +RRRF+D  +  +D  +  ++  + ++++ RN  L +     +  +  
Sbjct: 118 PENLDLIKKSPKDRRRFIDIELCQLDSMYVSQLSSYHKILKQRNCYLKQNVNNINYEFLD 177

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-----LTGFLDGKFDQS 239
            ++  + +   KI   R E I  L++       K    H++LS     L    +   D +
Sbjct: 178 ILDENLYKYAKKIFYKRSEFIENLNT-------KAAAIHLELSGGKEHLKLIYEPNVDIN 230

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
                  +  +L   R  D  ++ T  GPHR D+     D ++ +  GS G+Q+  ++ I
Sbjct: 231 I------FKSRLKFNRDRDIRTKTTNSGPHRDDINFLMNDHSLKL-FGSQGQQRTCILSI 283

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
             A   +I+  TG  PILLLD+I + LD +++  LF+ + ++ + I  TG D ++F + N
Sbjct: 284 KFAQIDIITEITGETPILLLDDILSELDINRQKYLFKYINNLQTMITCTGVDPNLF-TWN 342

Query: 360 ETAKFMRISNHQALC 374
           ++ K   +     +C
Sbjct: 343 DSIKVFIVEKANIIC 357


>gi|152985186|ref|YP_001345399.1| recombination protein F [Pseudomonas aeruginosa PA7]
 gi|166220723|sp|A6UX64|RECF_PSEA7 RecName: Full=DNA replication and repair protein recF
 gi|150960344|gb|ABR82369.1| RecF protein [Pseudomonas aeruginosa PA7]
          Length = 369

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 163/349 (46%), Gaps = 18/349 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++++  RN   + L    +  I  GDNG GKT++LEAI  L   R FR A    V +   
Sbjct: 6   VSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQY-E 64

Query: 70  PSFFSTFARVEGMEGLA-DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
            +  + F +V    G+A ++ I  E + + ++R   I+    R   +L + L +  + P 
Sbjct: 65  EAACTVFGQVMLANGIASNLGISRERQGEFTIR---IDGQNARSAAQLAETLPLQLINPD 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
             R+  G    RR+FLD  VF ++PR        ++ +R RN  L  G  D +  ++ + 
Sbjct: 122 SFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRNSWLRHGKLDPASQAAWDR 181

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK-ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           +++    +I+  R   I AL  +  E + +  +   + LS     D   D     L++  
Sbjct: 182 ELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSYYRGWDKDRD-----LQDVL 236

Query: 248 AKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC-DKAITIAHGSTGEQKVVLVGIFLAHARL 306
           A  L   ++M      T  GP R+DL +      A  I   S G+QK+V+  + +A   L
Sbjct: 237 ASSLLRDQQMG----HTQAGPQRADLRIRLAGHNAAEIL--SRGQQKLVVCALRIAQGHL 290

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           I+       + L+D++ + LDE  R AL R++ D+G Q+F+T  D  + 
Sbjct: 291 INRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLL 339


>gi|298490844|ref|YP_003721021.1| DNA replication and repair protein RecF ['Nostoc azollae' 0708]
 gi|298232762|gb|ADI63898.1| DNA replication and repair protein RecF ['Nostoc azollae' 0708]
          Length = 371

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 175/369 (47%), Gaps = 36/369 (9%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L++ +FRNY   ++ F A  TI VG+N  GK+N LEA+  L+  R  R A   D+ R
Sbjct: 3   LKTLHLRQFRNYQDQKIEFTAPKTILVGNNAQGKSNFLEAVELLATLRSHRLARDHDLIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQIN-DVVIRVVDELNKHLRISWL 125
            G  +     A +E   G++D+++ L     RSV    IN ++V R +D L     + + 
Sbjct: 63  DGD-AIAQINATLERALGISDLTLTLHRHARRSV---AINSEIVRRQMDFLGVLNAVEF- 117

Query: 126 VPSMD-RIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-----FD 179
             S+D  +  G    RR +LD ++  ++P +   +  + +++R RN  L +         
Sbjct: 118 -SSLDLELVRGSPENRRNWLDTLLIQLEPVYAHILQQYNQVLRQRNAFLKKSQESGVRSQ 176

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLI----------MEYVQKENFPHIKLSLT 229
            S  S  +AQ+   G ++ I R   I  L+ +            E +Q +  P++ L+  
Sbjct: 177 ESQLSIWDAQLVTAGTRLIIRRDRAIQRLAPIAAGWHASISGSTEVLQIQYAPNVPLAKN 236

Query: 230 GFLDGKFDQSFCA-LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
                +  Q+F   +++  A +L            TL+GPHR ++ +    K     +GS
Sbjct: 237 HA--EEVQQAFLGKIQQRTASELHRS--------TTLVGPHRDEVKLSINQKPAR-QYGS 285

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            G+Q+ +++ + LA  +LI      +P+LLLD++ A LD  ++N L   + +   Q  +T
Sbjct: 286 QGQQRTLVLALKLAELQLIEEVINESPLLLLDDVLAELDPFRQNQLLDAIQE-RFQTLIT 344

Query: 349 GTDKSVFDS 357
            T    FDS
Sbjct: 345 TTHLGAFDS 353


>gi|225377588|ref|ZP_03754809.1| hypothetical protein ROSEINA2194_03238 [Roseburia inulinivorans DSM
           16841]
 gi|225210564|gb|EEG92918.1| hypothetical protein ROSEINA2194_03238 [Roseburia inulinivorans DSM
           16841]
          Length = 363

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 163/352 (46%), Gaps = 18/352 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK + +  FRNY  L + FD    IF GDN  GKTNILEA       +  + +   ++ R
Sbjct: 3   IKSIELQNFRNYEDLNISFDEGTNIFYGDNAQGKTNILEAAYLSGTTKSHKCSKDKEMIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G      +  R   ++   +  I +  + +RS + + IN V I+   EL   L + +  
Sbjct: 63  FGEQ---ESHIRTVVVKKEKEYQIDMHLKHNRS-KGIAINKVPIKKASELFGILNMVFFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I      ERRRFLD  +  +D  +   +  + +++  RN+LL +  +      ++
Sbjct: 119 PEDLNIIKNGPAERRRFLDSELCQLDKIYLSDLTTYNKILNQRNKLLKDMVYRPDLKDTL 178

Query: 187 ---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
              + Q+ E G KI   R + ++ L+ ++ +         I   ++G  +    Q   ++
Sbjct: 179 PVWDMQLVETGRKIIRRRKQFVDELNEIVHD---------IHYRISGEKEDLLLQYEPSI 229

Query: 244 KEE-YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           ++  +  +L   ++ D     T +GPHR DL+    +  I    GS G+Q+   + + L+
Sbjct: 230 EDIFFEDELSRVKERDMRQCMTSVGPHRDDLLFSIGEVDIR-KFGSQGQQRTSALSLKLS 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
              L+  +    P+LLLD++ + LD +++N L   + D  + I  TG D+ V
Sbjct: 289 EIELVKRSIHDTPVLLLDDVLSELDSNRQNYLLNSIHDTQTLITCTGLDEFV 340


>gi|49086132|gb|AAT51330.1| PA0003 [synthetic construct]
          Length = 370

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/349 (27%), Positives = 162/349 (46%), Gaps = 18/349 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++++  RN   + L    +  I  GDNG GKT++LEAI  L   R FR A    V +   
Sbjct: 6   VSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVVQY-E 64

Query: 70  PSFFSTFARVEGMEGLA-DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
            +  + F +V    G+A ++ I  E + + ++R   I+    R   +L + L +  + P 
Sbjct: 65  EAACTVFGQVMLANGIASNLGISRERQGEFTIR---IDGQNARSAAQLAETLPLQLINPD 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
             R+  G    RR+FLD  VF ++PR        ++ +R RN  L  G  D +  ++ + 
Sbjct: 122 SFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRNSWLRHGKLDPASQAAWDR 181

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK-ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           +++    +I+  R   I AL  +  E + +  +   + LS     D   D     L E  
Sbjct: 182 ELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSYYRGWDKDRD-----LLEVL 236

Query: 248 AKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC-DKAITIAHGSTGEQKVVLVGIFLAHARL 306
           A  L   ++M      T  GP R+DL +      A  I   S G+QK+V+  + +A   L
Sbjct: 237 ASSLLRDQQMG----HTQAGPQRADLRIRLAGHNAAEIL--SRGQQKLVVCALRIAQGHL 290

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           I+       + L+D++ + LDE  R AL R++ D+G Q+F+T  D  + 
Sbjct: 291 INRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLL 339


>gi|257885590|ref|ZP_05665243.1| recombination protein F [Enterococcus faecium 1,231,501]
 gi|257821446|gb|EEV48576.1| recombination protein F [Enterococcus faecium 1,231,501]
          Length = 374

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 166/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WTDDQAMIQGEITKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKLSLTGFLD 233
            +   +  Q+A  G K+  AR + +       N+L   I    QKE    +++     +D
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFVKRLEFWANSLHQQITH--QKE---QLEIEYLTAVD 230

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
                +   ++E++   L   +K D     T +GPHR DL   + ++     +GS G+Q+
Sbjct: 231 SLETHTQEQIQEQFLALLNQNKKKDFFRGTTTVGPHRDDLSF-FINQKNVQTYGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   LI   TG  PILLLD++ + LD++++  L   + +   Q F+T T
Sbjct: 290 TTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDNRQLHLLETI-EGKVQTFLTTT 345


>gi|78173107|gb|ABB29470.1| RecF [Streptomyces argillaceus]
          Length = 373

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 100/361 (27%), Positives = 162/361 (44%), Gaps = 27/361 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA + +  D   T FVG NG GKTN++EA+ +L+     R AS A +
Sbjct: 1   MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVASDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R +  +G     ++LE    ++ R        +R  D L   +R   
Sbjct: 61  VRMGA---DRAVVRAQVRQGERQQLVELELNPGKANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF------ 178
             P    +  G   ERRRFLD ++ A  PR      D+ER++R RN LL           
Sbjct: 117 FAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYERVLRQRNTLLKSAALARRHGG 176

Query: 179 ---DSSWCSSIEAQMAELGVKINIARVEMINALSSL---IMEYVQKENFP---HIKLSLT 229
              D S     +  +A +G ++  AR++++ A+  L     E +     P     K S  
Sbjct: 177 RTMDLSTLDVWDQHLARVGAELLAARLDLVAAVQPLADKAYEQLAPGGGPVALEYKASAP 236

Query: 230 GFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
           G    + D     L E+    L + RK +     TL GPHR D+++    +     + S 
Sbjct: 237 GEAHARED-----LYEQLMGALAEVRKQEIERGVTLAGPHRDDVLLK-LGQLPAKGYASH 290

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           GE     + + LA   L+    G  P+L+LD++ A LD  +R  L  +V   G Q+ +T 
Sbjct: 291 GESWSYALALRLASYDLL-RAEGNEPVLILDDVFAELDSRRRERLAELVAP-GEQVLVTA 348

Query: 350 T 350
            
Sbjct: 349 A 349


>gi|69246709|ref|ZP_00604077.1| RecF protein [Enterococcus faecium DO]
 gi|257881315|ref|ZP_05660968.1| recombination protein F [Enterococcus faecium 1,231,502]
 gi|257890532|ref|ZP_05670185.1| recombination protein F [Enterococcus faecium 1,231,410]
 gi|257893107|ref|ZP_05672760.1| recombination protein F [Enterococcus faecium 1,231,408]
 gi|258615267|ref|ZP_05713037.1| recombination protein F [Enterococcus faecium DO]
 gi|260558230|ref|ZP_05830426.1| RecF protein [Enterococcus faecium C68]
 gi|261206920|ref|ZP_05921609.1| RecF protein [Enterococcus faecium TC 6]
 gi|289566503|ref|ZP_06446927.1| DNA replication and repair protein recF [Enterococcus faecium
           D344SRF]
 gi|293563254|ref|ZP_06677706.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1162]
 gi|293569156|ref|ZP_06680462.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1071]
 gi|294616656|ref|ZP_06696427.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1636]
 gi|294623762|ref|ZP_06702590.1| DNA replication and repair protein RecF [Enterococcus faecium
           U0317]
 gi|314940128|ref|ZP_07847308.1| recombination protein F [Enterococcus faecium TX0133a04]
 gi|314943041|ref|ZP_07849845.1| recombination protein F [Enterococcus faecium TX0133C]
 gi|314948159|ref|ZP_07851555.1| recombination protein F [Enterococcus faecium TX0082]
 gi|314953427|ref|ZP_07856345.1| recombination protein F [Enterococcus faecium TX0133A]
 gi|314993834|ref|ZP_07859170.1| recombination protein F [Enterococcus faecium TX0133B]
 gi|314998141|ref|ZP_07863023.1| recombination protein F [Enterococcus faecium TX0133a01]
 gi|68195123|gb|EAN09582.1| RecF protein [Enterococcus faecium DO]
 gi|257816973|gb|EEV44301.1| recombination protein F [Enterococcus faecium 1,231,502]
 gi|257826892|gb|EEV53518.1| recombination protein F [Enterococcus faecium 1,231,410]
 gi|257829486|gb|EEV56093.1| recombination protein F [Enterococcus faecium 1,231,408]
 gi|260075404|gb|EEW63710.1| RecF protein [Enterococcus faecium C68]
 gi|260078548|gb|EEW66250.1| RecF protein [Enterococcus faecium TC 6]
 gi|289161712|gb|EFD09588.1| DNA replication and repair protein recF [Enterococcus faecium
           D344SRF]
 gi|291588125|gb|EFF19967.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1071]
 gi|291590476|gb|EFF22214.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1636]
 gi|291596716|gb|EFF27939.1| DNA replication and repair protein RecF [Enterococcus faecium
           U0317]
 gi|291604793|gb|EFF34275.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1162]
 gi|313587853|gb|EFR66698.1| recombination protein F [Enterococcus faecium TX0133a01]
 gi|313591725|gb|EFR70570.1| recombination protein F [Enterococcus faecium TX0133B]
 gi|313594530|gb|EFR73375.1| recombination protein F [Enterococcus faecium TX0133A]
 gi|313598241|gb|EFR77086.1| recombination protein F [Enterococcus faecium TX0133C]
 gi|313640633|gb|EFS05213.1| recombination protein F [Enterococcus faecium TX0133a04]
 gi|313645413|gb|EFS09993.1| recombination protein F [Enterococcus faecium TX0082]
          Length = 374

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 166/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WTDDQAMIQGEITKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKLSLTGFLD 233
            +   +  Q+A  G K+  AR + +       N+L   I    QKE    +++     +D
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFVKRLEFWANSLHQQITH--QKE---QLEIEYLTAVD 230

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
                +   ++E++   L   +K D     T +GPHR DL   + ++     +GS G+Q+
Sbjct: 231 SLETHTQEQIQEQFLALLNQNKKKDLFRGTTTVGPHRDDLSF-FINQKNVQTYGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   LI   TG  PILLLD++ + LD++++  L   + +   Q F+T T
Sbjct: 290 TTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDNRQLHLLETI-EGKVQTFLTTT 345


>gi|304437929|ref|ZP_07397875.1| recombination protein F [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369069|gb|EFM22748.1| recombination protein F [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 372

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 165/370 (44%), Gaps = 32/370 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  L +  +R+Y +L L FD    IF+G N  GKTNI+EA+ + + GR  R +S A++
Sbjct: 1   MQITELTLRSYRSYETLHLAFDPGVQIFLGANAQGKTNIIEALYYAAFGRSHRTSSDAEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR--- 121
            R G+                A I +     D              R +    + LR   
Sbjct: 61  IRAGADG--------------AHIGLSFRRHDVPGELSFTFARGARRRITYAGESLRQRD 106

Query: 122 ISWLVP----SMDRIF--SGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT- 174
           +  L+P    S + +F   G    RRR+LD  +    P +   ++ + R+++ RN +L  
Sbjct: 107 LVGLLPMVLFSPEDLFLVKGAPALRRRYLDAELSQASPAYYGELLRYTRILKQRNAVLKD 166

Query: 175 --EGYFDSSWCSSIEAQMAELGVKI---NIARVEMINALSSLIMEYVQ--KENFPHIKLS 227
             E           +AQ+A     I    IA V  + ALS+ +   +   +E     +++
Sbjct: 167 IRERLAAPDDLPPWDAQLARSAAYIVTRRIAAVAQLGALSARVQAVLAAGEELTLAYEIA 226

Query: 228 LTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
             G  D   D    +L   Y K L +GR  D     T +GPH  DL++     ++  ++G
Sbjct: 227 GAGAEDFAEDDMTESLHLWYNKMLCEGRARDIARAATGVGPHLDDLVLRVGGMSLR-SYG 285

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           S G+Q+   + + LA    +    G APILLLD++ + LD D+R AL   +     Q F+
Sbjct: 286 SQGQQRTGALALKLAELFYLQENIGEAPILLLDDVMSELDADRRRALLDFIRHEHIQTFI 345

Query: 348 TGTDKSVFDS 357
           T TD + F +
Sbjct: 346 TATDAAYFPA 355


>gi|239630808|ref|ZP_04673839.1| DNA replication and repair protein recF [Lactobacillus paracasei
           subsp. paracasei 8700:2]
 gi|239527091|gb|EEQ66092.1| DNA replication and repair protein recF [Lactobacillus paracasei
           subsp. paracasei 8700:2]
          Length = 371

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 168/357 (47%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNYA++   F  +  + +G N  GKTN+LE+I  L+  R  R  +  ++
Sbjct: 1   MKLDHLVLKNYRNYAAVDTTFSPEINVLIGANAQGKTNLLESIYVLALARSHRTNNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS      FARV G       S +LE       +  +I+ +    + +   H  +  
Sbjct: 61  IRFGSE-----FARVSGQVSRQSGSHQLELIISHQGKRARIDRIEQPKLSQYLGHFNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D     + P++   +  ++  ++ RN  L +  +    D 
Sbjct: 116 FAPEDLAIVKGSPAGRRRFIDMEFGQMSPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALS---SLIMEYVQKE----NFPHIKLSLTGFLD 233
            +   +   +A  G ++  AR +++  +S   + I + + K     +F + +  +   L 
Sbjct: 176 VYLDVLTDSLAVFGAELITARAKLLETMSDYAATIQQDITKGRESLHFSY-QTQVDPSLR 234

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
           G  +Q + AL E +AK+    R+++  +  +L+GP R D++    DK +    GS G+Q+
Sbjct: 235 GDSEQVYTALGEMFAKQ--QAREIEQGT--SLVGPQRDDVLFIVNDKDVA-NFGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   L+ + TG  P+LLLD++ + LD  ++  L + +     Q F+T T
Sbjct: 290 TTALAVKLAEIDLMKDQTGEYPVLLLDDVLSELDAARQTHLLKAI-QTKVQTFLTTT 345


>gi|283797182|ref|ZP_06346335.1| RecF protein [Clostridium sp. M62/1]
 gi|291075140|gb|EFE12504.1| RecF protein [Clostridium sp. M62/1]
 gi|295090281|emb|CBK76388.1| DNA replication and repair protein RecF [Clostridium cf.
           saccharolyticum K10]
 gi|295115476|emb|CBL36323.1| DNA replication and repair protein RecF [butyrate-producing
           bacterium SM4/1]
          Length = 368

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 93/361 (25%), Positives = 158/361 (43%), Gaps = 28/361 (7%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           N + ++ + +  +RNY SL +VFD    +  GDN  GKTN+LEA+   +  +  R +   
Sbjct: 6   NNMFVESIELKNYRNYGSLSMVFDPGTNVLYGDNAQGKTNVLEAVYVCATTKSHRGSKDK 65

Query: 63  DVTRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           ++ R     S      R + +    D+ +K         + + IN V IR   EL   + 
Sbjct: 66  EIIRFAEDESHIKMNIRKDNVPYRIDMHLK-----KNKTKGIAINGVPIRRASELFGIVN 120

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           + +  P    I      ERRRF+D  +  ++  +   ++ + R +  RN+LL E  F   
Sbjct: 121 VVFFSPEDLNIIKNGPAERRRFVDLELCQLNRLYVHALVQYNRTLTQRNKLLKELPFKPE 180

Query: 182 WCSSI---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
              ++   + Q+   G ++   R E    L+ +I +         I   L+G   G+ + 
Sbjct: 181 LLETLDIWDMQLVSFGRELIRYRREFAGELNEMIRD---------IHRQLSG---GREEL 228

Query: 239 SFC----ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQK 293
             C      +E +   L  GR+ D   + TL GPHR DL   +    + I   GS G+Q+
Sbjct: 229 VICYEPNTEEEAFETALKRGREADIRQKTTLSGPHRDDL--SFSVNGVDIRRFGSQGQQR 286

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
              + + LA   L+       P+LLLD++ + LD  ++  L   +  I + I  TG D  
Sbjct: 287 TAALSLKLAEIELVKKIVKDYPVLLLDDVLSELDSGRQQHLLSGIRHIQTIITCTGLDDF 346

Query: 354 V 354
           V
Sbjct: 347 V 347


>gi|319399911|gb|EFV88157.1| DNA replication and repair protein recF [Staphylococcus epidermidis
           FRI909]
          Length = 371

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 169/384 (44%), Gaps = 29/384 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYEQVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNSDYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQIGQKTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q AE  +K+ + R   I  L +L            E +  +  P +KLS   
Sbjct: 176 TMLEVLNQQFAEYALKVTLRREHFIKELETLAQPIHAGITNHRETLTLDYVPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                ++ +   L EE    L D  + +      L GPHR DL  +  +      +GS G
Sbjct: 233 ----NYEANQSELIEEVLALLNDNLQREKERGVCLYGPHRDDLSFN-VNGMDAQTYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRISNHQAL 373
                D  +   AK  RIS  + L
Sbjct: 347 SVEGIDHEIMNNAKLYRISQGELL 370


>gi|242243252|ref|ZP_04797697.1| recombination protein F [Staphylococcus epidermidis W23144]
 gi|242233201|gb|EES35513.1| recombination protein F [Staphylococcus epidermidis W23144]
          Length = 371

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 169/384 (44%), Gaps = 29/384 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYEQVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNSDYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQIGQKTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q AE  +K+ + R   I  L +L            E +  +  P +KLS   
Sbjct: 176 TMLEVLNQQFAEYALKVTLRREHFIKELETLAQPIHAGITNHRETLTLDYVPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                ++ +   L EE    L D  + +      L GPHR DL  +  +      +GS G
Sbjct: 233 ----NYEANQSELIEEVLALLNDNLQREKERGVCLYGPHRDDLSFN-VNGMDAQTYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRISNHQAL 373
                D  +   AK  RIS  + L
Sbjct: 347 SVEGIDHEIMNNAKLYRISQGEIL 370


>gi|320547699|ref|ZP_08041984.1| recombination protein F [Streptococcus equinus ATCC 9812]
 gi|320447774|gb|EFW88532.1| recombination protein F [Streptococcus equinus ATCC 9812]
          Length = 364

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 167/366 (45%), Gaps = 20/366 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY +  L F     +F+G N  GKTN LEAI FLS  R  R       TR
Sbjct: 3   IQKIALKNYRNYLNNELEFSPGLNVFIGKNAQGKTNFLEAIYFLSLTRSHR-------TR 55

Query: 67  IGSP--SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
           +      F      V G    +  ++ LE       R  +IN +    + +    + +  
Sbjct: 56  LDKELIHFQEKELHVSGNLQRSTGAVPLEIDLSSKGRVTKINHLKQAKLSDYIGVMTVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWC 183
             P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L T    D  + 
Sbjct: 116 FAPEDLQLIKGAPSLRRKFIDIDLGQIKPVYLSDLSNYNHVLKQRNTYLKTAEKVDIDFL 175

Query: 184 SSIEAQMAELGVKINIARVEMINALS--SLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC 241
           + ++ Q+A+ G ++   R++ I  L   +    Y   +   H+K+     +   FD+   
Sbjct: 176 AVLDEQLADFGSRVMEHRLDFIANLEKEADCYHYTISDGLEHLKIHYLSSV--PFDKK-S 232

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
            +KE++ K L    K D   + T  GPHR DL  ++    +    GS G+ + +++ + +
Sbjct: 233 DIKEQFLKTLERNHKRDIFKKNTGAGPHRDDL--EFFINDMPANFGSQGQHRSLILSLKM 290

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNET 361
           A   LI N TG  PILLLD++ + LD  ++  L +++     Q F+T T     + L++ 
Sbjct: 291 AEIELIKNVTGDYPILLLDDVMSELDNYRQTELLKMIIAKNVQTFITTTS---LEHLSQL 347

Query: 362 AKFMRI 367
            K ++I
Sbjct: 348 PKELKI 353


>gi|303254888|ref|ZP_07340973.1| recombination protein F [Streptococcus pneumoniae BS455]
 gi|303259715|ref|ZP_07345691.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           SP-BS293]
 gi|303262182|ref|ZP_07348127.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           SP14-BS292]
 gi|303264617|ref|ZP_07350536.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           BS397]
 gi|303266074|ref|ZP_07351968.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           BS457]
 gi|303268482|ref|ZP_07354276.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           BS458]
 gi|301802888|emb|CBW35669.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           INV200]
 gi|302598159|gb|EFL65220.1| recombination protein F [Streptococcus pneumoniae BS455]
 gi|302636822|gb|EFL67312.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639267|gb|EFL69726.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           SP-BS293]
 gi|302641983|gb|EFL72336.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           BS458]
 gi|302644378|gb|EFL74631.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           BS457]
 gi|302645987|gb|EFL76215.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           BS397]
          Length = 365

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTQTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|194398177|ref|YP_002038823.1| recombination protein F [Streptococcus pneumoniae G54]
 gi|226737841|sp|B5E455|RECF_STRP4 RecName: Full=DNA replication and repair protein recF
 gi|194357844|gb|ACF56292.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           G54]
          Length = 365

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 172/373 (46%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L ++   D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSDQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|57865928|ref|YP_190091.1| recombination protein F [Staphylococcus epidermidis RP62A]
 gi|251811367|ref|ZP_04825840.1| recombination protein F [Staphylococcus epidermidis BCM-HMP0060]
 gi|282874724|ref|ZP_06283603.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           SK135]
 gi|293367577|ref|ZP_06614230.1| recombination protein F [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|73914002|sp|Q5HK02|RECF_STAEQ RecName: Full=DNA replication and repair protein recF
 gi|57636586|gb|AAW53374.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           RP62A]
 gi|251805116|gb|EES57773.1| recombination protein F [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296440|gb|EFA88955.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           SK135]
 gi|291318290|gb|EFE58683.1| recombination protein F [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329724141|gb|EGG60659.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           VCU144]
 gi|329735750|gb|EGG72031.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           VCU028]
 gi|329736171|gb|EGG72444.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           VCU045]
          Length = 371

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 169/384 (44%), Gaps = 29/384 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYEQVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FKSDYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQIGQKTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q AE  +K+ + R   I  L +L            E +  +  P +KLS   
Sbjct: 176 TMLEVLNQQFAEYALKVTLRREHFIKELETLAQPIHAGITNDRETLTLDYVPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                ++ +   L EE    L D  + +      L GPHR DL  +  +      +GS G
Sbjct: 233 ----NYEANQSELIEEVLALLNDNLQREKERGVCLYGPHRDDLSFN-VNGMDAQTYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRISNHQAL 373
                D  +   AK  RIS  + L
Sbjct: 347 SVEGIDHEIMNNAKLYRISQGEIL 370


>gi|221232925|ref|YP_002512079.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           ATCC 700669]
 gi|225855720|ref|YP_002737232.1| recombination protein F [Streptococcus pneumoniae JJA]
 gi|225859998|ref|YP_002741508.1| recombination protein F [Streptococcus pneumoniae 70585]
 gi|254790490|sp|C1CBK4|RECF_STRP7 RecName: Full=DNA replication and repair protein recF
 gi|254790491|sp|B8ZQB8|RECF_STRPJ RecName: Full=DNA replication and repair protein recF
 gi|254790493|sp|C1CHM6|RECF_STRZJ RecName: Full=DNA replication and repair protein recF
 gi|220675387|emb|CAR69989.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           ATCC 700669]
 gi|225719969|gb|ACO15823.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           70585]
 gi|225724158|gb|ACO20011.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           JJA]
          Length = 365

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 172/373 (46%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L ++   D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSDQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|15595201|ref|NP_064723.1| recombination protein F [Pseudomonas aeruginosa PAO1]
 gi|116053723|ref|YP_788158.1| recombination protein F [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254243117|ref|ZP_04936439.1| RecF protein [Pseudomonas aeruginosa 2192]
 gi|296386475|ref|ZP_06875974.1| recombination protein F [Pseudomonas aeruginosa PAb1]
 gi|313111475|ref|ZP_07797276.1| DNA replication and repair protein RecF [Pseudomonas aeruginosa
           39016]
 gi|13959479|sp|Q9I7C3|RECF_PSEAE RecName: Full=DNA replication and repair protein recF
 gi|122262142|sp|Q02V78|RECF_PSEAB RecName: Full=DNA replication and repair protein recF
 gi|9945821|gb|AAG03393.1|AE004440_3 RecF protein [Pseudomonas aeruginosa PAO1]
 gi|115588944|gb|ABJ14959.1| DNA replication and repair protein RecF [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126196495|gb|EAZ60558.1| RecF protein [Pseudomonas aeruginosa 2192]
 gi|310883778|gb|EFQ42372.1| DNA replication and repair protein RecF [Pseudomonas aeruginosa
           39016]
          Length = 369

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/349 (27%), Positives = 162/349 (46%), Gaps = 18/349 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++++  RN   + L    +  I  GDNG GKT++LEAI  L   R FR A    V +   
Sbjct: 6   VSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQY-E 64

Query: 70  PSFFSTFARVEGMEGLA-DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
            +  + F +V    G+A ++ I  E + + ++R   I+    R   +L + L +  + P 
Sbjct: 65  EAACTVFGQVMLANGIASNLGISRERQGEFTIR---IDGQNARSAAQLAETLPLQLINPD 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
             R+  G    RR+FLD  VF ++PR        ++ +R RN  L  G  D +  ++ + 
Sbjct: 122 SFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRNSWLRHGKLDPASQAAWDR 181

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK-ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           +++    +I+  R   I AL  +  E + +  +   + LS     D   D     L E  
Sbjct: 182 ELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSYYRGWDKDRD-----LLEVL 236

Query: 248 AKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC-DKAITIAHGSTGEQKVVLVGIFLAHARL 306
           A  L   ++M      T  GP R+DL +      A  I   S G+QK+V+  + +A   L
Sbjct: 237 ASSLLRDQQMG----HTQAGPQRADLRIRLAGHNAAEIL--SRGQQKLVVCALRIAQGHL 290

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           I+       + L+D++ + LDE  R AL R++ D+G Q+F+T  D  + 
Sbjct: 291 INRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLL 339


>gi|297582342|ref|YP_003698122.1| DNA replication and repair protein RecF [Bacillus selenitireducens
           MLS10]
 gi|297140799|gb|ADH97556.1| DNA replication and repair protein RecF [Bacillus selenitireducens
           MLS10]
          Length = 373

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 166/356 (46%), Gaps = 20/356 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I  L ++++RNY  L L F+ +  +F+G+N  GKTN++EAI  L+  R  R A   ++
Sbjct: 1   MHINELKLTDYRNYTKLHLTFENRVNVFLGENAQGKTNVMEAIYVLAMARSHRTAKDREL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R   P     FARVEG     + ++KLE       + +++N +  + + +      I  
Sbjct: 61  IRWDQP-----FARVEGAVTNRNGAMKLEMIFSGRGKKVKLNALERKRLSDYIGACTIVM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-----GYFD 179
             P    +  G    RRRFLD  +  I   +   +  + +L++ RN  L +       FD
Sbjct: 116 FAPEDLALVKGSPQIRRRFLDMEMGQIFTIYLYYLSQYYKLLKQRNTWLKQLQQKSSSFD 175

Query: 180 SSWCSSIEAQMAELGVKINIARVEMIN---ALSSLIMEYVQKENFPHIKLSLTGFLDGKF 236
                 +  Q+ E G ++   R   +N   A ++ I   + ++    + L     +    
Sbjct: 176 EGMWHVLTEQLVEAGAEVIQRRFSFLNKLEAWATPIHSAISRDK-ETLTLHYESTVKADD 234

Query: 237 DQSFCALKEEYAKKLFDGRKMDSMSRR--TLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
           + S   +K+ + ++    + M+   RR  T+IGPHR D+     D+ +   +GS G+Q+ 
Sbjct: 235 EMSVDVIKQVFFEQF--QQVMEQEIRRGTTIIGPHRDDVAFFVNDRNVQ-TYGSQGQQRT 291

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
             + + LA   LI   TG  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 292 AALSVKLAEIELIHEKTGEYPILLLDDVLSELDDHRQTHLLNSIQG-KVQTFVTTT 346


>gi|107098997|ref|ZP_01362915.1| hypothetical protein PaerPA_01000003 [Pseudomonas aeruginosa PACS2]
 gi|218888749|ref|YP_002437613.1| recombination protein F [Pseudomonas aeruginosa LESB58]
 gi|254237754|ref|ZP_04931077.1| RecF protein [Pseudomonas aeruginosa C3719]
 gi|226737820|sp|B7V0N8|RECF_PSEA8 RecName: Full=DNA replication and repair protein recF
 gi|126169685|gb|EAZ55196.1| RecF protein [Pseudomonas aeruginosa C3719]
 gi|218768972|emb|CAW24730.1| RecF protein [Pseudomonas aeruginosa LESB58]
          Length = 369

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 96/349 (27%), Positives = 162/349 (46%), Gaps = 18/349 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++++  RN   + L    +  I  GDNG GKT++LEAI  L   R FR A    V +   
Sbjct: 6   VSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQY-E 64

Query: 70  PSFFSTFARVEGMEGLA-DISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPS 128
            +  + F +V    G+A ++ I  E + + ++R   I+    R   +L + L +  + P 
Sbjct: 65  EAACTVFGQVMLANGIASNLGISRERQGEFTIR---IDGQNARSAAQLAETLPLQLINPD 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
             R+  G    RR+FLD  VF ++PR        ++ +R RN  L  G  D +  ++ + 
Sbjct: 122 SFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRNSWLRHGKLDPASQAAWDR 181

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK-ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           +++    +I+  R   I AL  +  E + +  +   + LS     D   D     L E  
Sbjct: 182 ELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSYYRGWDKDRD-----LLEVL 236

Query: 248 AKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC-DKAITIAHGSTGEQKVVLVGIFLAHARL 306
           A  L   ++M      T  GP R+DL +      A  I   S G+QK+V+  + +A   L
Sbjct: 237 ASSLLRDQQMG----HTQAGPQRADLRIRLSGHNAAEIL--SRGQQKLVVCALRIAQGHL 290

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
           I+       + L+D++ + LDE  R AL R++ D+G Q+F+T  D  + 
Sbjct: 291 INRAKRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLL 339


>gi|226309591|ref|YP_002769485.1| DNA replication and repair protein F [Brevibacillus brevis NBRC
           100599]
 gi|254790466|sp|C0ZH40|RECF_BREBN RecName: Full=DNA replication and repair protein recF
 gi|226092539|dbj|BAH40981.1| DNA replication and repair protein F [Brevibacillus brevis NBRC
           100599]
          Length = 372

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 98/381 (25%), Positives = 174/381 (45%), Gaps = 45/381 (11%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L+++ +RNY ++ L FD    +F+G+N  GKTN LE+I  L+  +  R     D   
Sbjct: 3   LKNLSLTNYRNYETMSLSFDGPIQLFIGNNAQGKTNALESIYVLALAKSHRTPR--DKEL 60

Query: 67  IGSPSFFSTF-ARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
           I   + ++T  + V    G   + ++L T+  R+    +IN +  + +      L +   
Sbjct: 61  ISWDADYATIRSDVLRRYGSVRLELQLTTKGKRA----KINGMEQQKLSAYVGALNVVMF 116

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I  G   +RRRF+D  +  + P +   + ++ +++  RN+LL +     S  +S
Sbjct: 117 APEDLSIVKGAPAQRRRFIDMEIGQVSPTYLYYLSNYNKVLAQRNQLLKDLAMKKS--NS 174

Query: 186 IE------AQMAELGVKINIARVEMINALSS---------------LIMEYVQKENFPHI 224
           +E       Q+A+L VK+   R E I  L +               L + YV   N   +
Sbjct: 175 LEMLAIWNTQLADLAVKLLRKRFEFIRKLETWAQEIHTGITDGRERLSLHYV---NSSPV 231

Query: 225 KLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI 284
              +T  +D   D+   A +E   +++  G         TLIGPHR D  +   +  +  
Sbjct: 232 TEEMT--IDQAVDKMLAAYEEVRDREIMRG--------STLIGPHRDDFSLKVNNMDVQ- 280

Query: 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTD-IGS 343
            +GS G+Q+   + I LA   LI    G  P+LLLD++ + LDE ++  L   + D + +
Sbjct: 281 TYGSQGQQRTSALSIKLAEIELIKEEVGEYPVLLLDDVLSELDEHRQTLLLETIQDRVQT 340

Query: 344 QIFMTGTDKSVFDSLNETAKF 364
            +  TG +      L + ++F
Sbjct: 341 FVSTTGVEGLKHQVLQQASRF 361


>gi|182685163|ref|YP_001836910.1| recombination protein F [Streptococcus pneumoniae CGSP14]
 gi|226737843|sp|B2INP4|RECF_STRPS RecName: Full=DNA replication and repair protein recF
 gi|182630497|gb|ACB91445.1| recombination protein F [Streptococcus pneumoniae CGSP14]
          Length = 365

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTQTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQPSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|322375204|ref|ZP_08049718.1| DNA replication and repair protein RecF [Streptococcus sp. C300]
 gi|321280704|gb|EFX57743.1| DNA replication and repair protein RecF [Streptococcus sp. C300]
          Length = 365

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 92/370 (24%), Positives = 166/370 (44%), Gaps = 22/370 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKEAKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +         + G+      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDNEQL-----HLSGLLQKKTSSIPLEIDLTPKGRVTKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSSQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCALK 244
           ++ Q+ E G ++   R++ I  L     ++ QK+   H+++S     L   +  S     
Sbjct: 178 LDDQLIEYGCRVIKHRIKFIKDLE----KFGQKK---HLEISNKLEELSISYQSSVNFTN 230

Query: 245 EEYAKKLF-----DGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           EE     F       R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 231 EEQLTSSFKIALDKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITNESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISN 369
           E      I N
Sbjct: 348 ENLSIFNIQN 357


>gi|15904073|ref|NP_359623.1| recombination protein F [Streptococcus pneumoniae R6]
 gi|116516540|ref|YP_817437.1| recombination protein F [Streptococcus pneumoniae D39]
 gi|225857795|ref|YP_002739306.1| recombination protein F [Streptococcus pneumoniae P1031]
 gi|225862043|ref|YP_002743552.1| recombination protein F [Streptococcus pneumoniae Taiwan19F-14]
 gi|298229429|ref|ZP_06963110.1| recombination protein F [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298255953|ref|ZP_06979539.1| recombination protein F [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298501743|ref|YP_003723683.1| recombination protein F [Streptococcus pneumoniae TCH8431/19A]
 gi|51316461|sp|Q8DMX3|RECF_STRR6 RecName: Full=DNA replication and repair protein recF
 gi|122277717|sp|Q04HV1|RECF_STRP2 RecName: Full=DNA replication and repair protein recF
 gi|254790494|sp|C1CNK0|RECF_STRZP RecName: Full=DNA replication and repair protein recF
 gi|254790495|sp|C1CUE4|RECF_STRZT RecName: Full=DNA replication and repair protein recF
 gi|15459739|gb|AAL00834.1| Recombination protein RecF [Streptococcus pneumoniae R6]
 gi|116077116|gb|ABJ54836.1| recF protein [Streptococcus pneumoniae D39]
 gi|225725404|gb|ACO21256.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           P1031]
 gi|225727340|gb|ACO23191.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237338|gb|ADI68469.1| recombination protein F [Streptococcus pneumoniae TCH8431/19A]
 gi|327388971|gb|EGE87319.1| DNA replication and repair protein recF [Streptococcus pneumoniae
           GA04375]
          Length = 365

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|225181145|ref|ZP_03734591.1| DNA replication and repair protein RecF [Dethiobacter alkaliphilus
           AHT 1]
 gi|225168114|gb|EEG76919.1| DNA replication and repair protein RecF [Dethiobacter alkaliphilus
           AHT 1]
          Length = 369

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 172/373 (46%), Gaps = 20/373 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++++ + +  +RNY+SL L  +    +  G N  GKTN+LE+++F++ GR FR  +  ++
Sbjct: 1   MRLETIELRNYRNYSSLSLELNPNINLLFGSNAQGKTNLLESVAFIAAGRSFRTRNEGEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
              G  +  ++ ARV    G   + +  +      +    +N + +   +   + + +  
Sbjct: 61  ILWGENNCTAS-ARVCNRMGRETLKVSFDAGSRNKI--FSVNGLTMNRSNYAGRLVTV-L 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFDSS 181
             P    I  G    RR+F D  +  I P +   +   ++++R RN LL    +    S 
Sbjct: 117 FTPEDLSIVKGSPAVRRKFFDDEISKISPVYEYELGRLQQIIRQRNNLLKKFRQKVLGSQ 176

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENF----PHIKLSLTGFL---DG 234
             +S   Q+A L  KI I RV  I  +   ++  +   N       +++    FL   DG
Sbjct: 177 ELASWNEQLAILSAKILIKRVTAIRRIG--LLARLSHRNLTGRDESLEILYQSFLPLDDG 234

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
             D     +++     L + +  ++   +TL+GPHR D++ +   +   + + S G+Q+ 
Sbjct: 235 ILDAQ--VIQDALLAGLEEKKHEEARLGQTLLGPHRDDIVFNINGRNARL-YASQGQQRT 291

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           +++ + LA    I   TG  P+LL D++ + LDE +R  L   + D   Q F+TGT+   
Sbjct: 292 LVLALKLAELEFIKGETGEYPVLLFDDVFSELDERRRRLLVETI-DGRIQTFITGTEAEK 350

Query: 355 FDSLNETAKFMRI 367
                E+ K  ++
Sbjct: 351 LRQFKESGKMFKV 363


>gi|323487684|ref|ZP_08092942.1| hypothetical protein GPDM_00015 [Planococcus donghaensis MPA1U2]
 gi|323398418|gb|EGA91206.1| hypothetical protein GPDM_00015 [Planococcus donghaensis MPA1U2]
          Length = 370

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 169/363 (46%), Gaps = 35/363 (9%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  L +  +RNY SL L F  +  +F+G+N  GKTN++E++  LS  +  R ++  ++
Sbjct: 1   MRIDRLELVNYRNYESLELEFSPEINVFIGENAQGKTNVMESLYVLSMAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R  +  +    A V    G   + I L  +  ++    ++N +  R + +    L +  
Sbjct: 61  IRWDA-DYGKIKADVFRKYGKLPLEITLSKKGKKA----KVNHLEQRRLSDYIGQLNVVM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY----FDS 180
             P    +  G    RRRF+D  +  I P +   ++++++L++ RN +L + Y     + 
Sbjct: 116 FAPEDLHLVKGSPQVRRRFIDMEIGQISPVYLHDLVNYQKLLKQRNHILKQHYGKQTIND 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFP-HIKLSLTGF--LDGKFD 237
                   Q  E  VKI   R +         ME +QK   P H  +S  G   L  ++ 
Sbjct: 176 VMFEVYTEQFIEAAVKIIRKRYQF--------MELLQKWAEPIHHGIS-RGLEQLQIRY- 225

Query: 238 QSFCALKEEYA---------KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
           Q    LK E+          +KL + RK +     TL+GPHR +L   + +      +GS
Sbjct: 226 QPISGLKPEWTPEEMASFLEQKLIEVRKREIERGVTLVGPHRDELQF-FVNGYDVQTYGS 284

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS-QIFM 347
            G+Q+   + + LA   LI    G AP+LLLD++ + LD+ +++ L   +   GS Q F+
Sbjct: 285 QGQQRTTALSLKLAEIELIKQEVGEAPVLLLDDVLSELDDYRQSHLLNTIK--GSVQTFV 342

Query: 348 TGT 350
           T T
Sbjct: 343 TTT 345


>gi|306834588|ref|ZP_07467701.1| recombination protein F [Streptococcus bovis ATCC 700338]
 gi|304423390|gb|EFM26543.1| recombination protein F [Streptococcus bovis ATCC 700338]
          Length = 364

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 159/347 (45%), Gaps = 13/347 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY +  L F     +F+G N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IQKITLKNYRNYLTSELEFSPGLNVFIGKNAQGKTNFLEAIYFLSLTRSHRTRTDKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +     +   ++   G   + I L ++     R  ++N +    + +    + +    
Sbjct: 63  FDAKELLVS-GILQRSSGTVPLDISLSSKG----RVTKVNHLKQAKLSDYIGVMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L T    D+ + + 
Sbjct: 118 PEDLQLIKGAPSLRRKFIDIDLGQIKPIYLADLSNYNHVLKQRNTYLKTAEKVDTDFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R++ I+ L        Y       H+ +    +L     Q    +
Sbjct: 178 LDEQLADFGSRVMEHRLDFISNLEKEADRYHYAISNGIEHLSIH---YLSSVSFQEKDDI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           K  + K L   ++ D   + T +GPHR DL  ++    +    GS G+ + +++ + +A 
Sbjct: 235 KPNFLKALQKNQQRDIFKKNTSVGPHRDDL--EFFINDMPANFGSQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
             LI   TG  PILLLD++ + LD  ++  L +++ D   Q F+T T
Sbjct: 293 IELIRTVTGDYPILLLDDVMSELDNYRQTELLKMIIDKNVQTFITTT 339


>gi|15902031|ref|NP_346635.1| recombination protein F [Streptococcus pneumoniae TIGR4]
 gi|111658642|ref|ZP_01409292.1| hypothetical protein SpneT_02000232 [Streptococcus pneumoniae
           TIGR4]
 gi|148984530|ref|ZP_01817818.1| recombination protein F [Streptococcus pneumoniae SP3-BS71]
 gi|148988871|ref|ZP_01820286.1| recombination protein F [Streptococcus pneumoniae SP6-BS73]
 gi|149003094|ref|ZP_01828003.1| recombination protein F [Streptococcus pneumoniae SP14-BS69]
 gi|149007732|ref|ZP_01831341.1| recombination protein F [Streptococcus pneumoniae SP18-BS74]
 gi|149020146|ref|ZP_01835120.1| recombination protein F [Streptococcus pneumoniae SP23-BS72]
 gi|168491759|ref|ZP_02715902.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           CDC0288-04]
 gi|168494012|ref|ZP_02718155.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           CDC3059-06]
 gi|169832646|ref|YP_001695579.1| recombination protein F [Streptococcus pneumoniae Hungary19A-6]
 gi|237651040|ref|ZP_04525292.1| recombination protein F [Streptococcus pneumoniae CCRI 1974]
 gi|237821153|ref|ZP_04596998.1| recombination protein F [Streptococcus pneumoniae CCRI 1974M2]
 gi|307128490|ref|YP_003880521.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           670-6B]
 gi|20978636|sp|Q97N44|RECF_STRPN RecName: Full=DNA replication and repair protein recF
 gi|226737842|sp|B1IAD9|RECF_STRPI RecName: Full=DNA replication and repair protein recF
 gi|14973738|gb|AAK76275.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           TIGR4]
 gi|147758835|gb|EDK65831.1| recombination protein F [Streptococcus pneumoniae SP14-BS69]
 gi|147760727|gb|EDK67699.1| recombination protein F [Streptococcus pneumoniae SP18-BS74]
 gi|147923307|gb|EDK74421.1| recombination protein F [Streptococcus pneumoniae SP3-BS71]
 gi|147925682|gb|EDK76758.1| recombination protein F [Streptococcus pneumoniae SP6-BS73]
 gi|147930824|gb|EDK81805.1| recombination protein F [Streptococcus pneumoniae SP23-BS72]
 gi|168995148|gb|ACA35760.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           Hungary19A-6]
 gi|183573999|gb|EDT94527.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           CDC0288-04]
 gi|183575893|gb|EDT96421.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           CDC3059-06]
 gi|301795136|emb|CBW37609.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           INV104]
 gi|301800959|emb|CBW33621.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           OXC141]
 gi|306485552|gb|ADM92421.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           670-6B]
 gi|332077793|gb|EGI88252.1| DNA replication and repair protein recF [Streptococcus pneumoniae
           GA41301]
 gi|332199049|gb|EGJ13130.1| DNA replication and repair protein recF [Streptococcus pneumoniae
           GA47901]
          Length = 365

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|199598230|ref|ZP_03211651.1| Recombinational DNA repair ATPase (RecF pathway) [Lactobacillus
           rhamnosus HN001]
 gi|199590833|gb|EDY98918.1| Recombinational DNA repair ATPase (RecF pathway) [Lactobacillus
           rhamnosus HN001]
          Length = 372

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 89/357 (24%), Positives = 166/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L++  +RNYA +   F  +  + +G+N  GKTN+LEAI  L+  R  R  +  ++
Sbjct: 1   MKLDHLSLKNYRNYAMVDTAFSPEINVLIGENAQGKTNLLEAIYVLALARSHRTNNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R GS      FARV G       + +LE       +  +I+ +    + +   H  +  
Sbjct: 61  IRFGSD-----FARVSGQISRQSGTHQLELIISHQGKRARIDRIEQSKLSQYLGHFNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D     + P++   +  ++  ++ RN  L +  +    D 
Sbjct: 116 FAPEDLAIVKGSPAGRRRFIDMEFGQMSPKYLYNLSQYKTFLKQRNAYLKQLKYHQAKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHIKLSLTGFLD 233
            +   +   +A  G ++  AR +++  +S         I +  +K  F + +  +   L 
Sbjct: 176 VYLDVLTDSLAAFGAELITARAKLLQTMSDYAAAIQQDITKGREKLQFAY-QTQVAADLR 234

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
              +Q + AL   +AK+    R+++  +  +L+GPHR D++    DK +    GS G+Q+
Sbjct: 235 QDSEQVYEALGALFAKQ--QSREIEQGT--SLVGPHRDDVLFIVNDKDVA-NFGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   L+ + TG  P+LLLD++ + LD  ++  L + +     Q F+T T
Sbjct: 290 TTALAVKLAEIDLMKDQTGEYPVLLLDDVLSELDAIRQTHLLKAI-QAKVQTFLTTT 345


>gi|294619748|ref|ZP_06699153.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1679]
 gi|291594018|gb|EFF25487.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1679]
          Length = 374

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 165/357 (46%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L + F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNIEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WTDDQAMIQGEITKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKLSLTGFLD 233
            +   +  Q+A  G K+  AR + +       N+L   I    QKE    +++     +D
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFVKRLEFWANSLHQQITH--QKE---QLEIEYLTAVD 230

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
                +   ++E++   L   +K D     T +GPHR DL   + ++     +GS G+Q+
Sbjct: 231 SLETHTQEQIQEQFLALLNQNKKKDLFRGTTTVGPHRDDLSF-FINQKNVQTYGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   LI   TG  PILLLD++ + LD+ ++  L   + +   Q F+T T
Sbjct: 290 TTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDSRQLHLLETI-EGKVQTFLTTT 345


>gi|306834801|ref|ZP_07467865.1| recombination protein F [Corynebacterium accolens ATCC 49726]
 gi|304569329|gb|EFM44830.1| recombination protein F [Corynebacterium accolens ATCC 49726]
          Length = 397

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 172/376 (45%), Gaps = 29/376 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L++ +FR++  L+L      T+FVG NG GKTNI+EA+ + +     R +  + + R
Sbjct: 3   IRDLDVRDFRSWPELKLELGPGITLFVGRNGFGKTNIVEAVGYTAHLSSHRVSHDSPLVR 62

Query: 67  IGSPSFFSTFARV-EGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+ S   +   V +G E    + IK       +    QIN   +R   EL   ++    
Sbjct: 63  QGAQSARVSLTAVNQGRELTTHLLIK-----PHAANQAQINRTRLRSPRELLGVVKTVLF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------GYF 178
            P    +  G    RR +LD ++ +  PR      D++++++ RN LL         GY 
Sbjct: 118 SPEDLALVRGEPAGRRAYLDSIIASRTPRLAGVKADYDKVLKQRNALLKSASASLRRGYG 177

Query: 179 DSSWCSSI------EAQMAELGVKINIARVEMINALSSLIMEY---VQKENFP-HIKLSL 228
           DS   S++      +AQ+A LG ++  AR+ +++AL   I      +  E+ P H++   
Sbjct: 178 DSDGASALSTLDTWDAQLARLGAQVIAARLALVDALLDHIPAAYAGLAPESRPAHVEYKS 237

Query: 229 TGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
           T  +D    +   A+      +L + R+ +     +L+GPHR DL++   D+       S
Sbjct: 238 T--IDTSDREVLEAV---MLTELANARQREIERGISLVGPHRDDLVLHLGDQPAK-GFAS 291

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            GE     + + LA   L+    G  P+L+LD++ A LD  +R  L  +       +   
Sbjct: 292 HGETWSYAIALRLAEFELLREEGGSDPVLILDDVFAELDAKRRTQLVHLAATAEQVLITA 351

Query: 349 GTDKSVFDSLNETAKF 364
             D+ + D+L    ++
Sbjct: 352 AVDEDLPDNLEPIVRY 367


>gi|148993621|ref|ZP_01823092.1| recombination protein F [Streptococcus pneumoniae SP9-BS68]
 gi|168489301|ref|ZP_02713500.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           SP195]
 gi|147927842|gb|EDK78864.1| recombination protein F [Streptococcus pneumoniae SP9-BS68]
 gi|183572210|gb|EDT92738.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           SP195]
 gi|332071670|gb|EGI82163.1| DNA replication and repair protein recF [Streptococcus pneumoniae
           GA17570]
          Length = 365

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 88/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|294630341|ref|ZP_06708901.1| RecF protein [Streptomyces sp. e14]
 gi|292833674|gb|EFF92023.1| RecF protein [Streptomyces sp. e14]
          Length = 373

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 101/361 (27%), Positives = 159/361 (44%), Gaps = 27/361 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA   +  D   T FVG NG GKTN++EA+ +L+     R A+ A +
Sbjct: 1   MHVTHLSLADFRSYARAEVPLDPGVTAFVGPNGQGKTNLVEAVGYLAALGSHRVATDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R +  +G     ++LE    R+ R        +R  D L   +R   
Sbjct: 61  IRMGA---DRAVIRAQVRQGERQQLVELELNPGRANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF------ 178
             P    +  G   ERRRFLD ++ A  PR      D+ER+++ RN LL           
Sbjct: 117 FAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYERVLKQRNTLLKSAALARRHGG 176

Query: 179 ---DSSWCSSIEAQMAELGVKINIARVEMINALSSL---IMEYVQKENFP---HIKLSLT 229
              D S     +  +A  G ++   R+++I AL  L     E +     P     K S  
Sbjct: 177 RSMDMSTLDVWDQHLARAGAELLARRLDLIAALQPLADKAYEQLAPGGGPLALEYKPSAP 236

Query: 230 GFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
           G    + D     L  +    L D RK +     TL+GPHR DL++    +     + S 
Sbjct: 237 GEAHTRED-----LYAQLTAALADARKQEIERGVTLVGPHRDDLLLK-LGQLPAKGYASH 290

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           GE     + + LA   L+    G  P+L+LD++ A LD  +R  L  +V   G Q+ +T 
Sbjct: 291 GESWSYALALRLASYDLL-RAEGNEPVLILDDVFAELDARRRERLAELVAP-GEQVLVTA 348

Query: 350 T 350
            
Sbjct: 349 A 349


>gi|313889502|ref|ZP_07823148.1| DNA replication and repair protein RecF [Streptococcus
           pseudoporcinus SPIN 20026]
 gi|313122114|gb|EFR45207.1| DNA replication and repair protein RecF [Streptococcus
           pseudoporcinus SPIN 20026]
          Length = 364

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 95/377 (25%), Positives = 168/377 (44%), Gaps = 37/377 (9%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L ++ +RNY  ++  F     +F+G+N  GKTN LEAI F++  R  R       TR
Sbjct: 3   LKELTLTNYRNYEQIQTKFVPGLNVFIGNNAQGKTNFLEAIYFIALTRSHR-------TR 55

Query: 67  IGSP--SFFSTFARVEG-MEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
           I      F     +V G +E  + I I LE    +  R  +IN +    + +   ++++ 
Sbjct: 56  IDKELIHFLKDDLKVSGKIERTSGI-ISLEIALTKKGRITKINSLKQAKLSDYIGNMKVV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSW 182
              P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L T    +S +
Sbjct: 115 LFAPEDLQLIKGAPSLRRKFIDIDLGQIKPVYLSDLSQYNYVLKQRNTYLKTASSINSDF 174

Query: 183 CSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC- 241
              ++ Q+A+ G ++   R++ I AL     E   + +F           DG  D +   
Sbjct: 175 LDVLDEQLADYGTRVIHQRMQFIEALE----EEAHRHHF--------AISDGLEDLTLSY 222

Query: 242 ----------ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGE 291
                     ++KE + + L + R+ D   + T +GPHR D++    D     A  S G+
Sbjct: 223 QSSIVLEPKESIKERFIEALQNNRQKDMFKKNTSVGPHRDDILFYINDMNANFA--SQGQ 280

Query: 292 QKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            + +++ + +A   L+   TG  PILLLD++ + LD  ++  L   +     Q F+T T 
Sbjct: 281 HRSLILSLKMAEVSLMKELTGENPILLLDDVMSELDNLRQTKLLETIIQEHVQTFITTTS 340

Query: 352 KSVFDSLNETAKFMRIS 368
                SL    K   +S
Sbjct: 341 LEHLSSLPPDIKTFYVS 357


>gi|153811990|ref|ZP_01964658.1| hypothetical protein RUMOBE_02383 [Ruminococcus obeum ATCC 29174]
 gi|149831889|gb|EDM86975.1| hypothetical protein RUMOBE_02383 [Ruminococcus obeum ATCC 29174]
          Length = 362

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 97/356 (27%), Positives = 164/356 (46%), Gaps = 26/356 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  FRNY  L+L FD    IF GDN  GKTNILE++      +  + +   ++ R
Sbjct: 3   IESIELKNFRNYQDLQLDFDKGTNIFYGDNAQGKTNILESVYICGTTKSHKGSKDKEIIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRISWL 125
            G        + +  M    ++S K++    ++  + + IN + I+   EL   + + + 
Sbjct: 63  FGEEE-----SHIRMMVKKDELSYKIDMHLRKNKAKGVAINGLRIKKARELFGIVNLVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRF+D  +  +D  +   +  +  ++  RNRLL + Y + S   +
Sbjct: 118 SPEDLNIIKNGPGERRRFMDLELCQLDQIYLTDLAGYNHIVNQRNRLLKDLYQNPSLRET 177

Query: 186 IE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTG---FLDGKFDQS 239
           +E    QM + G KI   R + +  L+ +I +         I  +LTG    L+  ++ S
Sbjct: 178 LEIWDIQMLQYGKKIIEKRRDFVRDLNDVIQD---------IHRNLTGGEEHLEVIYEPS 228

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVG 298
                E + + L   R+ D   + T  GPHR DL   +    I I   GS G+Q+   + 
Sbjct: 229 --TESECFEETLKKNRERDMRMKMTSAGPHRDDLC--FMVNGIDIRKFGSQGQQRTAALS 284

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
           + L+   L+       PILLLD++ + LD +++  L   + DI + I  TG D  V
Sbjct: 285 LKLSEIYLVKEKIKDTPILLLDDVLSELDSNRQTYLLDSIHDIQTLITCTGLDDFV 340


>gi|329938635|ref|ZP_08288031.1| DNA recombination and repair protein RecF [Streptomyces
           griseoaurantiacus M045]
 gi|329302126|gb|EGG46018.1| DNA recombination and repair protein RecF [Streptomyces
           griseoaurantiacus M045]
          Length = 373

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 104/370 (28%), Positives = 166/370 (44%), Gaps = 28/370 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA + +  DA  T FVG NG GKTN++EA+ +L+     R +S A +
Sbjct: 1   MHVTHLSLADFRSYAHVEVPLDAGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R +  +G     ++LE    R+ R        +R  D L   +R   
Sbjct: 61  VRMGA---ERAIVRAQVRQGERQQLLELELNPGRANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY------- 177
             P    +  G   ERRRFLD ++ A  PR      D++R+++ RN LL           
Sbjct: 117 FAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYDRVLKQRNTLLKSAALARRHGG 176

Query: 178 --FDSSWCSSIEAQMAELGVKINIARVEMINALSSLI---MEYVQKENFP---HIKLSLT 229
              D S     +  +A  G ++   R+++I AL  L     E +     P     + S  
Sbjct: 177 RSLDLSTLDVWDQHLARAGAELLARRLDLIAALRPLTDKAYEQLAPGGGPVGLEYRPSAP 236

Query: 230 GFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
           G    + D     L E+    L + RK +     TL+GPHR DL++    +     + S 
Sbjct: 237 GEAHTRED-----LHEQLLAALAEARKQEIERGVTLVGPHRDDLLLK-LGQLPAKGYASH 290

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           GE     + + LA   L+    G  P+L+LD++ A LD  +R  L  +V   G Q+ +T 
Sbjct: 291 GESWSYALALRLASYDLL-RAEGNEPVLVLDDVFAELDVRRRERLAELVAP-GEQVLVTA 348

Query: 350 T-DKSVFDSL 358
             D  V D L
Sbjct: 349 AVDDDVPDVL 358


>gi|260887488|ref|ZP_05898751.1| DNA replication and repair protein RecF [Selenomonas sputigena ATCC
           35185]
 gi|330837870|ref|YP_004412450.1| DNA replication and repair protein RecF [Selenomonas sputigena ATCC
           35185]
 gi|260862775|gb|EEX77275.1| DNA replication and repair protein RecF [Selenomonas sputigena ATCC
           35185]
 gi|329745634|gb|AEB98990.1| DNA replication and repair protein RecF [Selenomonas sputigena ATCC
           35185]
          Length = 369

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 169/373 (45%), Gaps = 29/373 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K K L +  FRNY  L L       +F+G+N  GKTNI EA+ + + GR  R  + AD+
Sbjct: 1   MKAKSLRLKCFRNYEELDLSLSPNINVFLGENAQGKTNIAEALYYAAIGRSHRTNADADL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRIS 123
               +P+     A++  +    D+   LE +  R   R ++ N   I+   EL       
Sbjct: 61  IAWDAPA-----AKIGLLFERLDVENTLEFQFQRGRRRSIRKNGEPIK-TKELFGVFNAV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFDS 180
              P    +  G   ERRRFLD  +    P +   ++ + R++  RN LL    E     
Sbjct: 115 LFSPEDLFLIKGAPAERRRFLDGEISQASPSYGHELMQYTRILTQRNSLLKKIRERRAGK 174

Query: 181 SWCSSIEAQMAELGVKINIAR---VEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGK 235
              S  + Q+A+    I   R   V+ +N L++L+   +   KEN     LSL+  L G 
Sbjct: 175 EMLSLWDEQLAKSAAHIVEKRFLAVKKLNMLANLMQRRISAGKEN-----LSLSYELCGA 229

Query: 236 FDQSFCALKE---EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
            ++  C  +E    Y KKL +   +D +   T +GP R D+ ++  +     + GS G+Q
Sbjct: 230 EEEPPCVTEELVPWYNKKLEESLDLDVLRGSTSVGPQRDDIRLE-VNGVNLRSFGSQGQQ 288

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           +  ++ + L+    + + TG  P+LLLD++ + LD  +R  L   +     Q  +T TD 
Sbjct: 289 RTGVLALKLSELEFLRSETGEYPVLLLDDVMSELDGTRREKLLDFIGREHIQTLLTATDA 348

Query: 353 SVFDSLNETAKFM 365
           +         KFM
Sbjct: 349 AYLPE-----KFM 356


>gi|161830866|ref|YP_001595903.1| DNA replication and repair protein RecF [Coxiella burnetii RSA 331]
 gi|215918858|ref|NP_819059.2| DNA replication and repair protein RecF [Coxiella burnetii RSA 493]
 gi|218511878|sp|Q83FD6|RECF_COXBU RecName: Full=DNA replication and repair protein recF
 gi|226737785|sp|A9N902|RECF_COXBR RecName: Full=DNA replication and repair protein recF
 gi|161762733|gb|ABX78375.1| DNA replication and repair protein RecF [Coxiella burnetii RSA 331]
 gi|206583742|gb|AAO89573.2| DNA replication and repair protein [Coxiella burnetii RSA 493]
          Length = 357

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 94/349 (26%), Positives = 156/349 (44%), Gaps = 24/349 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRN A + +   +Q   F G NG GKT+ILE+I +LS GR FR      + +  +
Sbjct: 7   LKVNQFRNLADVDITPHSQFNFFFGQNGAGKTSILESIYYLSVGRSFRTHLPQRLIQDNT 66

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F        G +    I + +E RD    RCL+IN           K L +  L    
Sbjct: 67  DRFLIFITLYNGTQF---IPLGVE-RDCHGDRCLRINGETASSWSLAAKRLPLCSLSAMS 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
            R        RR+FLD ++F ++P         +R ++ RN  L +        +  +  
Sbjct: 123 HRFLLDGPRVRRQFLDWLMFHVEPSFFSIWQRLQRSLKQRNAAL-KAKLPLGEITHWDKM 181

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           + E G +++  R  ++     L  + +Q+    +P I     G+             E+Y
Sbjct: 182 LVEDGERLHQLRQNVVTEFKPLFTQMLQQFLPAYPLIGHYFRGW------------SEKY 229

Query: 248 A--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCD-KAITIAHGSTGEQKVVLVGIFLAHA 304
           +  ++L    K D     T  GP R+D  +   D  A  I   S G+QK+V   +  A  
Sbjct: 230 SLMEQLQINLKQDLQRGYTQAGPQRADFRLTLGDLPAQDIL--SQGQQKLVTYALHFAQG 287

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            L+   TG +PI L+D++ A LD +KR+ +  +V  + SQ+F++G D +
Sbjct: 288 LLLKEKTGISPIYLIDDLPAELDANKRDCVIDLVNCLESQVFISGIDPN 336


>gi|298246029|ref|ZP_06969835.1| DNA replication and repair protein RecF [Ktedonobacter racemifer
           DSM 44963]
 gi|297553510|gb|EFH87375.1| DNA replication and repair protein RecF [Ktedonobacter racemifer
           DSM 44963]
          Length = 401

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 94/377 (24%), Positives = 169/377 (44%), Gaps = 32/377 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +  L +  FRNY  L L        F G+N  GKTN+LEA+S L+    F  +S  +V  
Sbjct: 3   LTHLTLEYFRNYKHLDLTLGPGLFFFCGENAQGKTNLLEAVSMLATATSFHASSDREVVN 62

Query: 67  IGSPSFFSTF-ARVEGMEGLADISIKL-------ETRDDRSVRC--------------LQ 104
             +P   +    RV   E  A I I +        ++DD S +                +
Sbjct: 63  WQAPDHVAHLQGRVSRHEDDAQIEISVFDPTPPTFSQDDTSQQTSRGLDLPANTPRKRYK 122

Query: 105 INDVVIRVVDELNKHLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFER 164
           +N V  R +D + + +++    P    +  G   ERRRF DR +  + P + + ++ + +
Sbjct: 123 LNGVPRRTIDIIGQ-MKVVLFAPVDLHLVDGSPEERRRFFDRALCQVSPHYCQALVRYRK 181

Query: 165 LMRGRNRLLT---EGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENF 221
           ++  R+ LL    +   D      ++ Q+ +L  +I   R  M+ +++ L     Q  + 
Sbjct: 182 VVTQRSALLKRIRDHQEDPRLIDYLDDQLTQLANQIMHERHHMLTSINQLANPLQQAISG 241

Query: 222 PHIKLSLTGFLDGKFDQSFC--ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCD 279
              +L +        D+S      ++ Y ++L   R+ ++M    L+GPHR DL  ++  
Sbjct: 242 GRERLEIIYRPSFSVDESLSLPEAQKHYQQQLQAIRRKETMQGVCLLGPHRDDL--EFLV 299

Query: 280 KAIT-IAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIV 338
             +  +++GS G+Q+   +   LA    + + TG  P+LLLD++ + LD  +R  L + V
Sbjct: 300 NGVNMLSYGSRGQQRTAALSTKLAELAFMRSNTGDEPVLLLDDVFSELDAVRRQYLLQEV 359

Query: 339 TDIGSQIFMTGTDKSVF 355
                Q+ +T TD   F
Sbjct: 360 LS-HQQVLLTATDLESF 375


>gi|22538290|ref|NP_689141.1| recombination protein F [Streptococcus agalactiae 2603V/R]
 gi|25012150|ref|NP_736545.1| recombination protein F [Streptococcus agalactiae NEM316]
 gi|77413654|ref|ZP_00789839.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           515]
 gi|51316463|sp|Q8DWQ8|RECF_STRA5 RecName: Full=DNA replication and repair protein recF
 gi|51316464|sp|Q8E2K7|RECF_STRA3 RecName: Full=DNA replication and repair protein recF
 gi|22535205|gb|AAN01014.1|AE014289_14 recF protein [Streptococcus agalactiae 2603V/R]
 gi|24413694|emb|CAD47774.1| Unknown [Streptococcus agalactiae NEM316]
 gi|77160309|gb|EAO71435.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           515]
          Length = 369

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 92/366 (25%), Positives = 166/366 (45%), Gaps = 14/366 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  +RNY   ++ F     IF+G N  GKTN LEAI FL+  R  R  S  ++  
Sbjct: 3   IKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   T   V    G  ++ I+L  +     R  ++N +    + +    + +    
Sbjct: 63  FKHHDVQIT-GEVIRKSGHLNLDIQLSEKG----RITKVNHLKQAKLSDYIGAMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+FLD  +  I P +   + ++  +++ RN  L T    D ++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFLDIDIGQIKPTYLAELSNYNHVLKQRNTYLKTTNNVDKTFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R + I AL+       Y+      H+ +     ++   D+S  ++
Sbjct: 178 LDEQLADYGSRVIEHRFDFIQALNDEADKHHYIISTELEHLSIHYKSSIEFT-DKS--SI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E +  +L      D   + T IGPHR D+     D   T A  S G+Q+ +++ + LA 
Sbjct: 235 REHFLNQLSKSHSRDIFKKNTSIGPHRDDITFFINDINATFA--SQGQQRSLILSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             LI   T   PILLLD++ + LD  ++  L   + +   Q F+T T      +L +  K
Sbjct: 293 IELIKTVTNDYPILLLDDVMSELDNHRQLKLLEGIKE-NVQTFITTTSLEHLSALPDQLK 351

Query: 364 FMRISN 369
              +S+
Sbjct: 352 IFNVSD 357


>gi|242372599|ref|ZP_04818173.1| recombination protein F [Staphylococcus epidermidis M23864:W1]
 gi|242349654|gb|EES41255.1| recombination protein F [Staphylococcus epidermidis M23864:W1]
          Length = 371

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 97/386 (25%), Positives = 170/386 (44%), Gaps = 33/386 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYEEVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNSDYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYVGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQIGQKTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q A+  +K+ + R   I  L  L            E +  +  P +KLS   
Sbjct: 176 TMLEVLNQQFAQYALKVTLRREHFIKELEELAQPIHSGITNEREKLALKYLPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGS 288
                +++    L +E    L D  K +      L GPHR DL   V+  D  I   +GS
Sbjct: 233 ----DYEKDESELLDEVMTLLNDNLKREKERGVCLYGPHRDDLGFNVNGMDAQI---YGS 285

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            G+Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T
Sbjct: 286 QGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVT 344

Query: 349 GTDKSVFD-SLNETAKFMRISNHQAL 373
            T     D  +   AK  RIS  + L
Sbjct: 345 TTSVDGIDHEIMNNAKLYRISQGELL 370


>gi|152994046|ref|YP_001338881.1| recombination protein F [Marinomonas sp. MWYL1]
 gi|189039628|sp|A6VR67|RECF_MARMS RecName: Full=DNA replication and repair protein recF
 gi|150834970|gb|ABR68946.1| DNA replication and repair protein RecF [Marinomonas sp. MWYL1]
          Length = 368

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 97/350 (27%), Positives = 168/350 (48%), Gaps = 19/350 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L+IS  RN +S+R     Q  + VG NG GKT++LEAI  LS GR FR   +    +  +
Sbjct: 6   LDISHVRNLSSVRFEPSPQVNVIVGKNGSGKTSVLEAIHLLSFGRSFRSHKHKTYIQHEN 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
            +    FA++   +G + I + L+   D  +  ++I     + V EL + L +  + P  
Sbjct: 66  DACI-VFAQLHQKQG-SPIRVGLQRHRDGQID-VRIQGQRAQSVIELAERLPVQLINPDA 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
            R+  G    RR+F+D   F  D    +    +++ ++ RN LL  G    S  ++ + +
Sbjct: 123 FRLLEGSPSIRRQFIDWGAFHFDKDFIQAWRGWQKALKQRNTLLRRGKISLSLLAAFDQE 182

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLT-GFLDGKFDQSFCALKEEYA 248
           +  LG ++N +R   +  L+     +V+  +    +LS++  F  G   Q   A+  E  
Sbjct: 183 LIRLGEQVNQSRKAYVEKLTP---HFVKVLSLLTTELSVSLQFFQGWDAQKNLAMAVEA- 238

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYC--DKAITIAHGSTGEQKVVLVGIFLAHARL 306
                GR+ D     T  GP R+DL V     D   T+   S G+QK+V+  + +A  +L
Sbjct: 239 -----GRERDIELGYTHTGPQRADLRVKTATGDALDTL---SRGQQKLVVSALKIAQGQL 290

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + +  G   + L+D++ A LD + R  L +++  + SQIF+T  +    D
Sbjct: 291 LID-MGRPLVFLVDDLPAELDANHRQKLCQLLESLNSQIFITSVEPDTTD 339


>gi|270291841|ref|ZP_06198056.1| DNA replication and repair protein RecF [Streptococcus sp. M143]
 gi|270279369|gb|EFA25211.1| DNA replication and repair protein RecF [Streptococcus sp. M143]
          Length = 365

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 91/370 (24%), Positives = 167/370 (45%), Gaps = 22/370 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKETKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLLQKKTSSIPLEIDLTPKGRVTKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSNQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCALK 244
           ++ Q+ E G ++   R++ I  L +    + QK+   H+++S  +  L   +  +     
Sbjct: 178 LDDQLVEYGCRVIKHRIKFIKDLEN----FGQKK---HLEISNQSEELSISYQSTVNFTN 230

Query: 245 EE-----YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           EE     +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 231 EEVLMDSFKMALEKSRSRDLFKKNTGVGPHRDD--IAFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITKESPILLLDDVMSELDNTRQLKLLETISH-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISN 369
           E      I N
Sbjct: 348 ENLSIFNIRN 357


>gi|322390514|ref|ZP_08064032.1| recombination protein F [Streptococcus parasanguinis ATCC 903]
 gi|321142788|gb|EFX38248.1| recombination protein F [Streptococcus parasanguinis ATCC 903]
          Length = 364

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 166/367 (45%), Gaps = 13/367 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L+I  FRNY  L + F     IF+G N  GKTNILE+I FL+  R  R  +  D+  
Sbjct: 3   LKHLSIQHFRNYQELEVEFHPGLNIFLGQNAQGKTNILESIYFLALTRSHRTRNDRDLIY 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S  F     +V G        + LE       R  ++N +    +     H+ +    
Sbjct: 63  FESTDF-----KVSGQLQRETGPLPLEISLTPKGRITKVNHLKQAKLSNYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  + P +   +  +  +++ RN  L      D+++   
Sbjct: 118 PEDLQLIKGSPAGRRKFIDIELGQMKPLYLSDLSQYNHVLKQRNSYLKNSEKIDATFLEV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           +++Q+A  G ++   R+E I  L +   E   + +     LS+  +    F +    ++E
Sbjct: 178 LDSQLASFGSRVIHHRLEFIKKLEAKAKEKHTRLSDNKEALSIQ-YQSTVFSEEGNDIEE 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
           ++   L   R+ D   + T IGPHR DL   +    +    GS G+ + V++ + LA   
Sbjct: 237 QFLSMLEKNRQKDIFRKTTSIGPHRDDLA--FFINNMNATFGSQGQHRSVVLSLKLAEIE 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           L+   T   PILLLD++ + LD  ++  L   +++   Q F+T T     D L +  + +
Sbjct: 295 LMEEITREKPILLLDDVMSELDNYRQLQLLETISN-NIQTFITTT---TLDHLKDLLEEL 350

Query: 366 RISNHQA 372
           +I   QA
Sbjct: 351 KIFTVQA 357


>gi|288906437|ref|YP_003431659.1| recombination protein RecF [Streptococcus gallolyticus UCN34]
 gi|306832474|ref|ZP_07465626.1| recombination protein F [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325979499|ref|YP_004289215.1| DNA replication and repair protein recF [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|288733163|emb|CBI14744.1| recombination protein RecF [Streptococcus gallolyticus UCN34]
 gi|304425374|gb|EFM28494.1| recombination protein F [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325179427|emb|CBZ49471.1| DNA replication and repair protein recF [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 364

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 158/347 (45%), Gaps = 13/347 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY +  L F     +F+G N  GKTN LEAI FLS  R  R  +  ++  
Sbjct: 3   IQKITLKNYRNYLTSELEFSPGLNVFIGKNAQGKTNFLEAIYFLSLTRSHRTRTDKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +     +   ++   G   + I L ++     R  ++N +    + +    + +    
Sbjct: 63  FDAKELLVS-GILQRSSGTVPLDISLSSKG----RVTKVNHLKQAKLSDYIGVMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L T    D+ + + 
Sbjct: 118 PEDLQLIKGAPSLRRKFIDIDLGQIKPIYLADLSNYNHVLKQRNTYLKTAEKVDTDFLAV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R++ I+ L        Y       H+ +    +L     Q    +
Sbjct: 178 LDEQLADFGSRVMEHRLDFISNLEKEADRYHYAISNGVEHLSIH---YLSSVSFQEKDDI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           K  + K L    + D   + T +GPHR DL  ++    +    GS G+ + +++ + +A 
Sbjct: 235 KPNFLKALQKNHQRDIFKKNTSVGPHRDDL--EFFINDMPANFGSQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
             LI   TG  PILLLD++ + LD  ++  L +++ D   Q F+T T
Sbjct: 293 IELIKTVTGDYPILLLDDVMSELDNYRQTELLKMIIDKNVQTFITTT 339


>gi|253581084|ref|ZP_04858344.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847620|gb|EES75590.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 361

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 100/352 (28%), Positives = 158/352 (44%), Gaps = 24/352 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  FRNY SL L       IF G+N  GKTNILEA+      +  + +   D+ +
Sbjct: 3   IESVQLKNFRNYDSLELDLAQGTNIFYGNNAQGKTNILEALYLCGTTKSHKGSRDKDMIQ 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   S      + + +    D+ +K         + + IN + IR   EL   + + + 
Sbjct: 63  FGKDESHIRMMVKRDELSYRIDMHLK-----KNKAKGVAINGLPIRKASELFGVVNLVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERRRFLD  +  +D  +   +  +  ++  RN+LL +     S   +
Sbjct: 118 SPEDLNIIKNGPGERRRFLDLELCQLDKIYLTDLASYNHIVNQRNKLLKDLSVQPSLKDT 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD--GKFDQSF 240
           ++    QMAE G KI   R E I  L+    E V+K     I  +LTG L+      +  
Sbjct: 178 LDIWDIQMAEYGRKIIDKRSEFIKELN----ETVRK-----IHGNLTGGLEELNVIYEPD 228

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGI 299
           C   E+    +   R+ D   R T  GPHR DL V      I I  +GS G+Q+   + +
Sbjct: 229 CT-AEKLESTICANRERDMRMRLTSAGPHRDDLCV--MANGIDIRKYGSQGQQRTAALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            L+   ++       P+LLLD++ + LD  ++N L   ++DI + I  TG D
Sbjct: 286 KLSEIYIVKRKIKDTPVLLLDDVLSELDSSRQNYLLDSISDIQTLITCTGLD 337


>gi|324991876|gb|EGC23799.1| recombination protein F [Streptococcus sanguinis SK405]
 gi|324996234|gb|EGC28144.1| recombination protein F [Streptococcus sanguinis SK678]
 gi|327458500|gb|EGF04850.1| recombination protein F [Streptococcus sanguinis SK1]
 gi|327471598|gb|EGF17041.1| recombination protein F [Streptococcus sanguinis SK408]
 gi|327490328|gb|EGF22115.1| recombination protein F [Streptococcus sanguinis SK1058]
          Length = 364

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 165/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEAI FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAIYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENDLLVS-GILEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L     Q    L
Sbjct: 178 LDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEKLTIK---YLSSIPLQKIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLISSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIMS 362


>gi|300777028|ref|ZP_07086886.1| recombination protein F [Chryseobacterium gleum ATCC 35910]
 gi|300502538|gb|EFK33678.1| recombination protein F [Chryseobacterium gleum ATCC 35910]
          Length = 359

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 108/373 (28%), Positives = 174/373 (46%), Gaps = 38/373 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L++  F+N+   +  F  Q   FVG+NGVGKTNIL+A+ +LS G+ F      D+  
Sbjct: 3   IKKLSLYNFKNHTEKKFEFSPQINCFVGNNGVGKTNILDALHYLSVGKSF--LGNTDLNN 60

Query: 67  IGSPS-FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKH---LRI 122
           I     FF+  A ++  +    I I   T+   + + ++ ND   +  D L  H   L  
Sbjct: 61  IKKEEDFFTIDAEIQNEDSEDIIRI---TQPKEAKKVIKKND---KSYDRLADHIGYLPS 114

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
             + P    + S     RR+FLD M+   D  +   +I +++ ++ RN LL     + +W
Sbjct: 115 VMISPYDSNLISDSGESRRKFLDSMISQTDSGYLFDLIQYQKTIQQRNALLKYFAKNRTW 174

Query: 183 -CSSIEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQ 238
              S+E     +   G KI   R E +  L+ ++      +NF  I   ++G   GK   
Sbjct: 175 DKDSLEIYDDPIIRFGTKIFNKRKEFVEQLNPIV------QNFYKI---ISG---GKETV 222

Query: 239 SFCA----LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
           S       L++ +   L +  + D M   T  G H+ DL+ +  D  +    GS G+QK 
Sbjct: 223 SVIYESHLLEDSFENLLKESLEKDRMLTYTSKGIHKDDLLFE-MDHVLIKKIGSQGQQKS 281

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDK- 352
            L+ + LA   L+   T   PILLLD+I   LD+ + + L  +V  +   QIF+T T + 
Sbjct: 282 FLISLKLAQMSLVKELTKKTPILLLDDIFDKLDDIRVSQLIELVNRESFGQIFITDTHRE 341

Query: 353 ---SVFDSLNETA 362
              SV   +NE +
Sbjct: 342 RTESVVKKINEES 354


>gi|238915980|ref|YP_002929497.1| DNA replication and repair protein RecF [Eubacterium eligens ATCC
           27750]
 gi|259563364|sp|C4Z176|RECF_EUBE2 RecName: Full=DNA replication and repair protein recF
 gi|238871340|gb|ACR71050.1| DNA replication and repair protein RecF [Eubacterium eligens ATCC
           27750]
          Length = 363

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 92/378 (24%), Positives = 170/378 (44%), Gaps = 36/378 (9%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ + + +FRNY  L + F+    I  GDN  GKTNILE+I   S  +  R +   ++ R
Sbjct: 3   VESVELKDFRNYEFLDMNFNEHVNIIYGDNAQGKTNILESIYMCSTSKSHRGSKDREIVR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G   S         GM+   D+ +K         + + +N + I+   EL   + I + 
Sbjct: 63  FGEDESHIKLNVLKHGMKYRIDMHLK-----KNKTKGIAVNGIPIKKAVELFGIINIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS---- 181
            P    I      ERRRF+D  +  +D  +   ++++ +++  RN+LL +  F  S    
Sbjct: 118 SPEDLNIIKNGPSERRRFMDMELSQLDKIYLSNLVNYNKVLNQRNKLLKDIAFSPSEQLM 177

Query: 182 -----WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKF 236
                W    + Q+ + G  I   R   I  ++++I +         I   LTG   G  
Sbjct: 178 QTLDIW----DMQLVKYGSLIIKGRKSFIEKINTIISD---------IHSRLTG---GIE 221

Query: 237 DQSFCALKE----EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
           +   C + +    ++ +++ + R+ D   + T  GPH+ DLI    D  +   +GS G+Q
Sbjct: 222 NIKVCYVPDVDVNDFEEEVRNSRQKDIKYKVTGKGPHKDDLIFLINDNDVR-KYGSQGQQ 280

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           +   + + L+   L+       P+LLLD++ + LD +++N L   + DI + +  TG ++
Sbjct: 281 RTAALSLKLSEIELVKLVIKDTPVLLLDDVLSELDSNRQNFLINSIGDIQTIVTCTGLEE 340

Query: 353 SVFDSLNETAKFMRISNH 370
            + + +N    F     H
Sbjct: 341 FINNRMNINKIFKVTDGH 358


>gi|319746166|gb|EFV98437.1| recombination protein F [Streptococcus agalactiae ATCC 13813]
          Length = 355

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 164/364 (45%), Gaps = 14/364 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  +RNY   ++ F     IF+G N  GKTN LEAI FL+  R  R  S  ++  
Sbjct: 3   IKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   T   V    G  ++ I+L  +     R  ++N +    + +    + +    
Sbjct: 63  FKHHDVQIT-GEVIRKSGHLNLDIQLSEKG----RITKVNHLKQAKLSDYIGAMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+FLD  +  I P +   + ++  +++ RN  L T    D ++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFLDIDIGQIKPTYLAELSNYNHVLKQRNTYLKTTNNVDKTFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R + I AL+       Y+      H+ +     ++   D+S  ++
Sbjct: 178 LDEQLADYGSRVIEHRFDFIQALNDEADKHHYIISTELEHLSIHYKSSIEFT-DKS--SI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E +  +L      D   + T IGPHR D+     D  I    GS G+Q+ +++ + LA 
Sbjct: 235 REHFLNQLSKSHSRDIFKKNTSIGPHRDDITFFIND--INATFGSQGQQRSLILSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             LI   T   PILLLD++ + LD  ++  L   + +   Q F+T T      +L +  K
Sbjct: 293 IELIKTVTNDYPILLLDDVMSELDNHRQLKLLEGIKE-NVQTFITTTSLEHLSALPDQLK 351

Query: 364 FMRI 367
              +
Sbjct: 352 IFNV 355


>gi|291539809|emb|CBL12920.1| recF protein [Roseburia intestinalis XB6B4]
          Length = 368

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 164/355 (46%), Gaps = 28/355 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + ++ FRNY +L++ FD    I  GDN  GKTNILEA       +  + +   ++ R
Sbjct: 3   IQSIELNNFRNYENLQISFDEGTNILFGDNAQGKTNILEAAYLSGTTKSHKGSKDKEMIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  +   T     G +   D+ +K     +RS + + +N + ++   EL   L I + 
Sbjct: 63  FGTNEAHLRTMVLKNGKQYQIDMHLK----HNRS-KGIAVNKIPMKKASELFGILNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERR FLD  +  +D  +   + ++ +++  RN+LL +  +      +
Sbjct: 118 SPEDLNIIKNGPSERRHFLDAELCQLDKIYLYDLSNYNKILNQRNKLLKDMVYRPELSDT 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + Q+A+ G KI   R + +  L+ ++ E        H ++S      G  ++ F +
Sbjct: 178 LPVWDMQLADTGKKIIRRREKFVKELNEIVHEI-------HYRIS------GGREELFLS 224

Query: 243 LKEEYAKKLFDG-----RKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            +   +  L +      +  D    +T +GPHR DL+       I    GS G+Q+   +
Sbjct: 225 YEPSVSADLLEQELERVKPRDLKQCQTSVGPHRDDLLFSIAGVDIR-KFGSQGQQRTSAL 283

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            + L+   L+  +    P+LLLD++ + LD +++N L   + D  + I  TG D+
Sbjct: 284 SLKLSEIELVRKSIHDTPVLLLDDVLSELDSNRQNYLLNSICDTQTIITCTGLDE 338


>gi|227506185|ref|ZP_03936234.1| recombination protein F [Corynebacterium striatum ATCC 6940]
 gi|227197209|gb|EEI77257.1| recombination protein F [Corynebacterium striatum ATCC 6940]
          Length = 392

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 174/376 (46%), Gaps = 30/376 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L++ +FR++  L +      T+FVG NG GKTNI+EAI +++     R +  A + R
Sbjct: 3   IRELDVRDFRSWPELSIELGPGITLFVGRNGYGKTNIVEAIGYVAHLSSHRVSHDAPLVR 62

Query: 67  IGSPSF-FSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
             + +   ST A  +G E  A + IK       +    QIN   ++   EL   ++    
Sbjct: 63  QSAVNARISTTAVNQGRELTAHLLIK-----PHAANQAQINRTRLKSPRELLGVVKSVLF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------GYF 178
            P    +  G   ERR +LD ++ +  PR      D++++++ RN LL         GY 
Sbjct: 118 SPEDLAVVRGEPAERRTYLDNIIASRTPRLAGVKADYDKVLKQRNALLKSASSSLRRGYG 177

Query: 179 DSSWCSSI------EAQMAELGVKINIARVEMINALSSLIMEY---VQKENFP-HIKLSL 228
           DS   S++      +AQ+A LG ++  AR+ +++ALS LI      +  E+ P HI+   
Sbjct: 178 DSDGASALATLDVWDAQLARLGAQVIEARLALVDALSELIPSAYAGLAPESRPAHIEYKS 237

Query: 229 TGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
           T  +  +       L E  AK     R+ +     +L+GPHR DL+++   +       S
Sbjct: 238 TIDVSDREVLEAVMLTELAAK-----RQREIERGISLVGPHRDDLVLNLGTQPAK-GFAS 291

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            GE     + + LA   L+    G  PIL+LD++ A LD  +R  L  +  +    +   
Sbjct: 292 HGETWSYAISLRLAEFNLLRQ-DGTDPILILDDVFAELDAKRREKLVHLAAEAEQVLITA 350

Query: 349 GTDKSVFDSLNETAKF 364
             D+ +  +L    ++
Sbjct: 351 AVDEDLPGNLEPIVRY 366


>gi|222053120|ref|YP_002535482.1| DNA replication and repair protein RecF [Geobacter sp. FRC-32]
 gi|254790478|sp|B9M7S3|RECF_GEOSF RecName: Full=DNA replication and repair protein recF
 gi|221562409|gb|ACM18381.1| DNA replication and repair protein RecF [Geobacter sp. FRC-32]
          Length = 364

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 171/356 (48%), Gaps = 27/356 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQH-TIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           +K+  + +  FRN     L+  AQH  IF G+NG GKTN+LE+I  ++  + F+ A  +D
Sbjct: 1   MKLNKIYLQSFRNLQETMLM-PAQHFNIFYGNNGQGKTNLLESIFIMATMKSFKTARSSD 59

Query: 64  VTRIGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           + R G+  S    +   +G+    +I++ L    D   + ++++   +  +D+   HL +
Sbjct: 60  LVRWGAISSLLKGWVERDGV--TREIAVFL----DNQGKKIRVDQKAVTRIDDFFGHLNV 113

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG---YFD 179
               P    +  GL   RR++LDR VF+ D  +      + ++++ RN LL  G    FD
Sbjct: 114 VVFTPEEVNMVKGLPELRRKYLDRAVFSSDITYLSVYHAYSKILKNRNMLLKRGEKASFD 173

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFD 237
             W      ++ E G  I ++R+  ++AL  L+  + ++   N   + +S   +     D
Sbjct: 174 -IWTE----KLVEQGKNIILSRLAYLDALRDLLKRFYREISGNEEAVDISYRPY---HMD 225

Query: 238 QSFCA--LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKV 294
            + C   + + +A+ L      +     TL GPHR D  V++      +   GS G+QK 
Sbjct: 226 LADCRGDVADAFAEALAKTATEEERRGTTLAGPHRDD--VEFILNGRPLKQFGSQGQQKS 283

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
            ++ + +A    +       PI LLD++S+ LD++++  L   +     Q+F+T T
Sbjct: 284 YVLALKMAETEYLQKKFHSQPIFLLDDLSSELDQERKKNLMEFLKKRDMQVFITTT 339


>gi|148997971|ref|ZP_01825484.1| recombination protein F [Streptococcus pneumoniae SP11-BS70]
 gi|168576099|ref|ZP_02722004.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           MLV-016]
 gi|307068837|ref|YP_003877803.1| recombinational DNA repair ATPase [Streptococcus pneumoniae AP200]
 gi|147755981|gb|EDK63024.1| recombination protein F [Streptococcus pneumoniae SP11-BS70]
 gi|183578126|gb|EDT98654.1| DNA replication and repair protein RecF [Streptococcus pneumoniae
           MLV-016]
 gi|306410374|gb|ADM85801.1| Recombinational DNA repair ATPase (RecF pathway) [Streptococcus
           pneumoniae AP200]
 gi|332198641|gb|EGJ12724.1| DNA replication and repair protein recF [Streptococcus pneumoniae
           GA41317]
          Length = 365

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 87/373 (23%), Positives = 172/373 (46%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L ++   D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSDQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   +  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSKSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|306820917|ref|ZP_07454537.1| recombination protein F [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551031|gb|EFM39002.1| recombination protein F [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 356

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 96/359 (26%), Positives = 163/359 (45%), Gaps = 34/359 (9%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  +N+  +RNY +L L F     + +G NG GKTNI+EA+ FLS  + FR     +V
Sbjct: 1   MQINNINLKNYRNYENLSLDFSENINMIIGQNGQGKTNIVEAVHFLSFAKSFRTNRDKEV 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
              G  S +   + ++ ++    I I++   D ++V    IN   I  + +L   + +  
Sbjct: 61  INFGKDSAYIK-SSIQNIDDSYTIDIRISNLDKKAV---NINKNPISKISDLMGIVNVVV 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P   +I S     RR F+++ +  I P +   ++D+ + +  +N LL     D+    
Sbjct: 117 FSPEDTKIVSDTPSFRRGFMNKEISQIKPLYYNILLDYNQTLENKNSLLKTQNPDTIMLD 176

Query: 185 SIEAQMAELGVKINIARVEMINALSSLIMEY-----VQKENF-----PHIKLSLTGFLDG 234
             + Q++    KI   R + I  +S +  E       QKEN      P+IK         
Sbjct: 177 IYDEQLSAYMEKIIAYRKDFIKQISVIANETHGKISSQKENLIINYSPNIKYE------- 229

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLI-GPHRSDLIVDYCDKAITIAHGSTGEQK 293
                    K+E   KL    + D M R T   G H+ D+ +   D  I    GS G++K
Sbjct: 230 ---------KKEDIFKLLSSSRADDMIRGTSSKGIHKDDIEIMIGDIDIR-KFGSQGQKK 279

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
              + + L+   LI N     P+++LD+I + LD ++R  L   + +I  Q F+T T+K
Sbjct: 280 TATIALKLSEIELIYNMKKEYPVVILDDIFSELDINRRKMLIEKLLNI--QTFITTTEK 336


>gi|240145739|ref|ZP_04744340.1| DNA replication and repair protein RecF [Roseburia intestinalis
           L1-82]
 gi|257202155|gb|EEV00440.1| DNA replication and repair protein RecF [Roseburia intestinalis
           L1-82]
          Length = 368

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 165/355 (46%), Gaps = 28/355 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + ++ FRNY +L + FD    I  GDN  GKTNILEA       +  + +   ++ R
Sbjct: 3   IQSIELNNFRNYENLHISFDEGTNILFGDNAQGKTNILEAAYLSGTTKSHKGSKDKEMIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  +   T     G +   D+ +K     +RS + + +N + ++   EL   L I + 
Sbjct: 63  FGTNEAHLRTMVLKNGKQYQIDMHLK----HNRS-KGIAVNKIPMKKASELFGILNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERR FLD  +  +D  +   + ++ +++  RN+LL +  +      +
Sbjct: 118 SPEDLNIIKNGPSERRHFLDAELCQLDKIYLSDLSNYNKILNQRNKLLKDMVYRPELSDT 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + Q+A+ G KI   R + +  L+ L+ E        H ++S      G  ++ F +
Sbjct: 178 LPVWDMQLADTGKKIIRRREKFVKELNELVHEI-------HYRIS------GGREELFLS 224

Query: 243 LKEEYAKKLFDGR----KMDSMSR-RTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            +   +  L +      K+  + + +T +GPHR DL+       I    GS G+Q+   +
Sbjct: 225 YEPSVSADLLEQELERVKLRDLKQCQTSVGPHRDDLLFSIAGVDIR-KFGSQGQQRTSAL 283

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            + L+   L+  +    P+LLLD++ + LD +++N L   + D  + I  TG D+
Sbjct: 284 SLKLSEIELVRKSIHDTPVLLLDDVLSELDSNRQNYLLNSICDTQTIITCTGLDE 338


>gi|23014791|ref|ZP_00054591.1| COG1195: Recombinational DNA repair ATPase (RecF pathway)
           [Magnetospirillum magnetotacticum MS-1]
          Length = 174

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 89/149 (59%), Gaps = 5/149 (3%)

Query: 1   MTNRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRAS 60
           + +R  ++ L++++FR Y +LRL  DA+  +  G NG GKTNILEA+SFL PGRG RRA 
Sbjct: 11  LASRPAVRRLSLADFRCYGTLRLETDARPVVLTGPNGAGKTNILEALSFLVPGRGLRRAG 70

Query: 61  YADVTRIGSP--SFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNK 118
             D+TR G P  S ++  A ++G  G  +I    E   +R  R ++I+    +  D L  
Sbjct: 71  AGDITRHGLPAGSPWAVAASLDGPAGRVEIGTGREAGHER--RSVRIDGKPAKPGD-LAG 127

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRM 147
            +   WL P+MDR+F   +  RRRFLDR+
Sbjct: 128 LVSALWLTPAMDRLFIEGASGRRRFLDRL 156


>gi|320531088|ref|ZP_08032117.1| putative recombination protein F [Selenomonas artemidis F0399]
 gi|320136670|gb|EFW28623.1| putative recombination protein F [Selenomonas artemidis F0399]
          Length = 373

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 106/382 (27%), Positives = 171/382 (44%), Gaps = 31/382 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  L +  +RNY  L L FD    IF+G N  GKTNI+EA+ + S GR  R  S A++
Sbjct: 1   MRITRLELHSYRNYEILDLRFDPGVQIFLGANAQGKTNIIEALYYASFGRSHRTTSDAEL 60

Query: 65  TRIGSPS--FFSTFAR--VEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHL 120
            R+   +     +F R  V G     ++S   E    R  R L+  + + +   EL   L
Sbjct: 61  IRMEESAGRIDLSFLRHDVPG-----ELSFTFERGHRR--RILRAGEPLRQ--RELVGLL 111

Query: 121 RISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGY 177
            +    P    +  G    RRR+LD  +    P +   ++ +  ++R R  +L    E  
Sbjct: 112 PMVLFSPEDLFLVKGAPALRRRYLDAELSQASPAYYGELLRYTHILRQRGAILKDIRERL 171

Query: 178 FDSSWCSSIEAQMAELGVKI---NIARVEMINALSSLIM-------EYVQKENFPHIKLS 227
                    + Q+A    +I    IA  E + ALS  +        E        H+   
Sbjct: 172 VPVDALEPWDVQLARSAARIVTRRIAAAERLGALSGRVQAVLAAGEELTISYEIAHVPDD 231

Query: 228 LTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
           L G  DG  D+    L+  Y K L + R  D     T +GPH  DL++     ++  ++G
Sbjct: 232 LPGEKDGMADR----LEVWYNKALSEFRFRDIARGSTGVGPHLDDLVLSVGGMSLR-SYG 286

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           S G+Q+   + + LA    + ++ G APILLLD++ + LD D+R AL   +     Q F+
Sbjct: 287 SQGQQRTGALALKLAELFYLRDSVGEAPILLLDDVMSELDADRRAALLSFIRSEHIQTFI 346

Query: 348 TGTDKSVFDSLNETAKFMRISN 369
           T TD + F +    A +  +++
Sbjct: 347 TATDAAYFPAEEMGATYRYVTH 368


>gi|293553550|ref|ZP_06674177.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1039]
 gi|291602305|gb|EFF32530.1| DNA replication and repair protein RecF [Enterococcus faecium
           E1039]
          Length = 374

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 164/357 (45%), Gaps = 23/357 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY  L   F     IF+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MRLNKLYLKNYRNYEELNTEFSKNLVIFLGENAQGKTNLLESIYVLAMTRSHRTSSEQEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A ++G       ++ LE    +  R  +IN +  + +      + +  
Sbjct: 61  --IG---WTDDQAMIQGEITKGSSTLPLEILLSKKGRKTKINHIEQKKLSTYVGQMNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+FLD  +  I+P +   ++ ++ +++ RN+ L +       D 
Sbjct: 116 FAPEDLSLVKGSPQIRRKFLDMELGQINPIYLYDLVQYQAILKQRNQYLKQLNEKKQTDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMI-------NALSSLIMEYVQKENFPHIKLSLTGFLD 233
            +   +  Q+A  G K+  AR + +       N+L   I    QKE    +++     +D
Sbjct: 176 LYLDILSEQLAAFGSKVLKARAQFVKRLEFWANSLHQQITH--QKE---QLEIEYLTAVD 230

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
                +   ++E++   L   +K D     T +GPHR DL   + ++     +GS G+Q+
Sbjct: 231 SLETHTQEQIQEQFLALLNQNKKKDLFRGTTTVGPHRDDLSF-FINQKNVQTYGSQGQQR 289

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              + + LA   LI   TG  PILLLD++ + LD+ ++  L   + +   Q F+T T
Sbjct: 290 TTALSVKLAEIDLIKEETGEYPILLLDDVMSELDDSRQLHLLETI-EGKVQTFLTTT 345


>gi|148378015|ref|YP_001252556.1| DNA replication and repair protein RecF [Clostridium botulinum A
           str. ATCC 3502]
 gi|148287499|emb|CAL81558.1| DNA replication and repair protein [Clostridium botulinum A str.
           ATCC 3502]
          Length = 367

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 170/365 (46%), Gaps = 39/365 (10%)

Query: 4   RIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYAD 63
           R+ IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D
Sbjct: 3   RMYIKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKD 62

Query: 64  VTRIG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRI 122
           + +   + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +
Sbjct: 63  LIKWDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNV 117

Query: 123 SWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW 182
               P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W
Sbjct: 118 VMFSPEDLRIIKDSPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNW 171

Query: 183 CSSI-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLS 227
            + I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    
Sbjct: 172 NNKINDIIDIYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY---- 226

Query: 228 LTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHG 287
           LT   D  FD +    ++E    L   RK D     T IGPHR D  V   +   T   G
Sbjct: 227 LTNIKD--FDNA----EKELLIVLKKNRKKDLERNSTSIGPHRDDFEVS-INNIDTRIFG 279

Query: 288 STGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFM 347
           S G+Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  
Sbjct: 280 SQGQQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQKFVLNSIDKIQTIITC 339

Query: 348 TGTDK 352
           TG ++
Sbjct: 340 TGIEE 344


>gi|300853236|ref|YP_003778220.1| putative DNA replication and repair protein RecF [Clostridium
           ljungdahlii DSM 13528]
 gi|300433351|gb|ADK13118.1| predicted DNA replication and repair protein RecF [Clostridium
           ljungdahlii DSM 13528]
          Length = 366

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 159/353 (45%), Gaps = 24/353 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK+L +  FRNY  L + FD    +F+GDN  GKTNILE+I + S G+  R     ++  
Sbjct: 3   IKYLKLINFRNYKELEMEFDKNLNVFIGDNAQGKTNILESIYYCSIGKSPRTNKDKELIN 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 +           L D  I+++   +   + + IN + +  + EL     +    
Sbjct: 63  WNGKYAYIKAGVYSSSHNLNDKKIEIKIFKE-GKKGININSIRVNKLSELMGIFNVVMFS 121

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSSWCSS 185
           P   +I       RR+FLD  +     R+   ++ + +++  RN LL +    +S     
Sbjct: 122 PEDLKIIKESPSFRRKFLDIELCKFSKRYYYNLVQYNKVLSERNLLLRKRNNSNSDILDI 181

Query: 186 IEAQMAELGVKINIARVEMINALSSL-------IMEYVQKENFPHIKLSLTGFLDGKFDQ 238
            + Q+++ G  I   R + IN LS +       I    +K  F ++  S+T  LD   + 
Sbjct: 182 YDIQLSKYGAVIIDLRNKYINKLSKMGKIIHEDITSQTEKIEFKYV-TSITD-LDNIENS 239

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH-GSTGEQKVVLV 297
            F  L+          R+ D     TL GPHR D +       I + + GS G+Q+  ++
Sbjct: 240 LFKVLET--------NRQRDIEKGITLYGPHRDDFVTSI--NGINVRNFGSQGQQRTSVL 289

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
            +  A   +I   TG  P+LLLD++ + LD +++  +   + +I  Q F+TGT
Sbjct: 290 TMKFASLEIIKEITGEYPVLLLDDVLSELDANRQKYILNSIDEI--QTFITGT 340


>gi|295398132|ref|ZP_06808181.1| recombination protein F [Aerococcus viridans ATCC 11563]
 gi|294973651|gb|EFG49429.1| recombination protein F [Aerococcus viridans ATCC 11563]
          Length = 371

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 162/360 (45%), Gaps = 29/360 (8%)

Query: 3   NRIKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYA 62
           N IK+K     +FRNY  L + F     +F+G+N  GKT++LEAI  +S  R  R A+  
Sbjct: 4   NDIKLK-----DFRNYEDLTVTFSPGVNVFIGENAQGKTSLLEAIYMMSLARSHRTANEK 58

Query: 63  DVTRIGSPSFFSTFARVEG---MEGLADISIKLE-TRDDRSVRCLQINDVVIRVVDELNK 118
           D        +   FAR+EG        D+ + L  T+  +  +   +N    R+ D + K
Sbjct: 59  DTIH-----WKQDFARIEGSISTRTNPDLPLALTITKSGKRAKVNHLNQN--RMSDYIGK 111

Query: 119 HLRISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN----RLLT 174
            L +    P    +  G    RR+F+D  +  + P++    + + RL++ RN    +LL 
Sbjct: 112 -LNVVLFAPEDLELIKGAPQLRRKFIDMELGQMSPKYLYESVQYNRLLKQRNAYLKQLLY 170

Query: 175 EGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPH----IKLSLTG 230
           +   D  +   +  Q+A     +   R+  ++ L S         N  H    + L+  G
Sbjct: 171 KETQDQIYLDILTEQLAASATHVIYQRLRFVDQLESWAKPI--HSNISHGLEELTLAYRG 228

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             +   D +  A+ ++   K  + +  +     TL+GPHR DL      + +    GS G
Sbjct: 229 PSELTLDMTEDAIYQQLMTKFKEKKDHEFARGVTLVGPHRDDLTFKVNGRDVQ-KFGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ + LA    +    G  PILLLD++ + LD++++  L + +     Q F+T T
Sbjct: 288 QQRTTVLSMKLAEIECMHEVLGEYPILLLDDVLSELDDERQTHLLKSIQS-KVQTFLTTT 346


>gi|212211672|ref|YP_002302608.1| DNA replication and repair protein [Coxiella burnetii CbuG_Q212]
 gi|226737783|sp|B6J289|RECF_COXB2 RecName: Full=DNA replication and repair protein recF
 gi|212010082|gb|ACJ17463.1| DNA replication and repair protein [Coxiella burnetii CbuG_Q212]
          Length = 357

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 94/349 (26%), Positives = 156/349 (44%), Gaps = 24/349 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRN A + +   +Q   F G NG GKT+ILE+I +LS GR FR      + +  +
Sbjct: 7   LKVNQFRNLADVDITPHSQFNFFFGQNGAGKTSILESIYYLSVGRSFRTHLPQRLIQDNT 66

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F        G +    I + +E RD    RCL+IN           K L +  L    
Sbjct: 67  DRFLIFITLYNGTQF---IPLGVE-RDCHGDRCLRINGETASSWSLAAKRLPLCSLSAMS 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
            R        RR+FLD ++F ++P         +R ++ RN  L +        +  +  
Sbjct: 123 HRFLLDGPRVRRQFLDWLMFHVEPSFFSIWQRLQRSLKQRNAAL-KAKLPLGEITHWDKM 181

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           + E G +++  R  ++     L  + +Q+    +P I     G+             E+Y
Sbjct: 182 LVEDGERLHQLRQNVVTEFKPLFTQMLQQFLPAYPLIGHYFRGW------------SEKY 229

Query: 248 A--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCD-KAITIAHGSTGEQKVVLVGIFLAHA 304
           +  ++L    K D     T  GP R+D  +   D  A  I   S G+QK+V   +  A  
Sbjct: 230 SLMEQLQINLKQDLQRGYTQAGPQRADFRLTLRDLPAQDIL--SQGQQKLVTYALHFAQG 287

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            L+   TG +PI L+D++ A LD +KR+ +  +V  + SQ+F++G D +
Sbjct: 288 LLLKEKTGISPIYLIDDLPAELDANKRDCVIDLVNCLESQVFISGIDPN 336


>gi|223932878|ref|ZP_03624874.1| DNA replication and repair protein RecF [Streptococcus suis
           89/1591]
 gi|330833788|ref|YP_004402613.1| DNA replication and repair protein RecF [Streptococcus suis ST3]
 gi|223898459|gb|EEF64824.1| DNA replication and repair protein RecF [Streptococcus suis
           89/1591]
 gi|329308011|gb|AEB82427.1| DNA replication and repair protein RecF [Streptococcus suis ST3]
          Length = 364

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 89/361 (24%), Positives = 163/361 (45%), Gaps = 10/361 (2%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  FRNY  L + F     +F+G+N  GKTNILE+I  L+  R  R  +  D+ +   
Sbjct: 6   LELQHFRNYNQLDIEFHKGLNVFLGENAQGKTNILESIYVLALTRSHRTRTDKDLLQFQE 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
               S    +    G   + I L  +     R  ++N +    +     H+ +    P  
Sbjct: 66  KE-LSISGLLHRTSGKVPLDIHLTDKG----RVTKVNHLKQAKLSNYIGHMNVVLFAPED 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S ++ 
Sbjct: 121 LQLIKGAPALRRKFIDVELGQIKPLYLSDLSNYNHVLKQRNTYLKSTDKIDENFLSVLDQ 180

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           Q+AE G ++   R++ +  L       VQ+ +    +L++      K       L +++ 
Sbjct: 181 QLAEYGSRVIQHRIDFLKKLEEFGNRKVQEISGNREELTIEYQTSIKLTDD-VNLIDKFL 239

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
            +L   RK D   + T +GPHR D  V +    +   +GS G+ + +++ + LA   L+ 
Sbjct: 240 TELERCRKRDLFKKNTGVGPHRDD--VAFFINGMNAHYGSQGQHRSLVLSLKLAEIELMK 297

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMRIS 368
             T   PILLLD++ + LD +++  L   +TD   Q F+T T       L ++ K   I 
Sbjct: 298 EVTREYPILLLDDVMSELDNNRQIKLLETITDT-IQTFITTTSLDHLHKLPDSLKIFHIE 356

Query: 369 N 369
           +
Sbjct: 357 S 357


>gi|290959001|ref|YP_003490183.1| DNA replication protein [Streptomyces scabiei 87.22]
 gi|260648527|emb|CBG71638.1| DNA replication protein [Streptomyces scabiei 87.22]
          Length = 374

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 99/368 (26%), Positives = 163/368 (44%), Gaps = 21/368 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA + +  D   T FVG NG GKTN++EA+ +L+     R +S A +
Sbjct: 1   MHVTHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R +  +G     ++LE    ++ R        +R  D L   +R   
Sbjct: 61  VRMGA---DRAVVRAQVRQGERQQLVELELNPGKANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF------ 178
             P    +  G   ERRRFLD ++ A  PR      D+ER+++ RN LL           
Sbjct: 117 FAPEDLALVKGDPGERRRFLDELITARSPRMAGVRSDYERVLKQRNTLLKSAALARRHGG 176

Query: 179 ---DSSWCSSIEAQMAELGVKINIARVEMINALSSL---IMEYVQKENFPHIKLSLTGFL 232
              D S     +  +A +G  +   R++++ A+  L     E +     P + L      
Sbjct: 177 RTMDLSTLDVWDQHLARVGADLLAQRLDLVAAIQPLADKAYEQLAPGGGP-VGLEYRPSS 235

Query: 233 DGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQ 292
            G    +   L E+    L + RK +     TL+GPHR D+ +    +     + S GE 
Sbjct: 236 PGLVGHAREELYEQLTAALTESRKQEIERGVTLVGPHRDDVTLK-LGQLPAKGYASHGES 294

Query: 293 KVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT-D 351
               + + LA   L+    G  P+L+LD++ A LD  +R  L  +V   G Q+ +T   D
Sbjct: 295 WSYALALRLASYDLL-RAEGNEPVLILDDVFAELDSRRRERLAELVAP-GEQVLVTAAVD 352

Query: 352 KSVFDSLN 359
             V D L 
Sbjct: 353 DDVPDVLT 360


>gi|332523373|ref|ZP_08399625.1| DNA replication and repair protein RecF [Streptococcus porcinus
           str. Jelinkova 176]
 gi|332314637|gb|EGJ27622.1| DNA replication and repair protein RecF [Streptococcus porcinus
           str. Jelinkova 176]
          Length = 363

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 84/365 (23%), Positives = 164/365 (44%), Gaps = 13/365 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  +RNY  ++  F     +F+G+N  GKTN LEAI F++  R  R  +  ++  
Sbjct: 3   LKELTLINYRNYEQIQTKFVPGLNVFIGNNAQGKTNFLEAIYFIALTRSHRTRTDKELIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                    + ++E   G+  + I L  +     R  +IN +    + +   ++++    
Sbjct: 63  FLKDD-LKVYGKIERTSGVISLEITLTKKG----RITKINSLKQAKLSDYVGNMKVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L T    +  +   
Sbjct: 118 PEDLQLIKGAPSLRRKFIDIDLGQIKPVYLSDLSQYNYVLKQRNTYLKTAVSINKDFLDV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R++ I AL        +   +    +KLS    +  +  +S   +
Sbjct: 178 LDEQLADYGTRVIHQRMQFIEALQQEAHRHHFAISDGLEQLKLSYQSSIALEAKES---I 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           ++ + + L   R+ D   + T +GPHR D++    D     A  S G+ + +++ + +A 
Sbjct: 235 RDRFMEALLHNRQKDMFKKNTSVGPHRDDIMFYINDMNANFA--SQGQHRSLILSLKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             L+   TG  PILLLD++ + LD  ++  L   +     Q F+T T      SL    K
Sbjct: 293 VSLMKELTGENPILLLDDVMSELDNLRQTKLLETIIQEHVQTFITTTSLEHLSSLPPDIK 352

Query: 364 FMRIS 368
              +S
Sbjct: 353 TFYVS 357


>gi|153209959|ref|ZP_01947546.1| DNA replication and repair protein RecF [Coxiella burnetii 'MSU
           Goat Q177']
 gi|212217691|ref|YP_002304478.1| DNA replication and repair protein [Coxiella burnetii CbuK_Q154]
 gi|226737782|sp|B6J8S5|RECF_COXB1 RecName: Full=DNA replication and repair protein recF
 gi|120575205|gb|EAX31829.1| DNA replication and repair protein RecF [Coxiella burnetii 'MSU
           Goat Q177']
 gi|212011953|gb|ACJ19333.1| DNA replication and repair protein [Coxiella burnetii CbuK_Q154]
          Length = 357

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 94/349 (26%), Positives = 157/349 (44%), Gaps = 24/349 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRN A + +   +Q   F G NG GKT+ILE+I +LS GR FR      + +  +
Sbjct: 7   LKVNQFRNLADVDITPHSQFNFFFGQNGAGKTSILESIYYLSVGRSFRTHLPQRLIQDNT 66

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F        G +    I + +E RD +  RCL+IN           K L +  L    
Sbjct: 67  DRFLIFITLYNGTQF---IPLGVE-RDCQGDRCLRINGETASSWSLAAKRLPLCSLSAMS 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
            R        RR+FLD ++F ++P         +R ++ RN  L +        +  +  
Sbjct: 123 HRFLLDGPRVRRQFLDWLMFHVEPSFFSIWQRLQRSLKQRNASL-KAKLPLGEITHWDKM 181

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           + E G +++  R  ++     L  + +Q+    +P I     G+             E+Y
Sbjct: 182 LVEDGERLHQLRQNIVTEFKPLFTQMLQQFLPAYPLIGHYFRGW------------SEKY 229

Query: 248 A--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCD-KAITIAHGSTGEQKVVLVGIFLAHA 304
           +  ++L    K D     T  GP R+D  +   D  A  I   S G+QK+V   +  A  
Sbjct: 230 SLMEQLQINLKQDLQRGYTQAGPQRADFRLTLRDLPAQDIL--SQGQQKLVTYALHFAQG 287

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            L+   TG +PI L+D++ A LD +KR+ +  +V  + SQ+F++G D +
Sbjct: 288 LLLKEKTGISPIYLIDDLPAELDANKRDCVIDLVNCLESQVFISGIDPN 336


>gi|291536987|emb|CBL10099.1| recF protein [Roseburia intestinalis M50/1]
          Length = 368

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 163/355 (45%), Gaps = 28/355 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + ++ FRNY +L++ FD    I  GDN  GKTNILEA       +  + +   ++ R
Sbjct: 3   IQSIELNNFRNYENLQISFDEGTNILFGDNAQGKTNILEAAYLSGTTKSHKGSKDKEMIR 62

Query: 67  IGS-PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+  +   T     G +   D+ +K     +RS + + +N + ++   EL   L I + 
Sbjct: 63  FGTNEAHLRTMVLKNGKQYQIDMHLK----HNRS-KGIAVNKIPMKKASELFGILNIVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERR FLD  +  +D  +   + ++ +++  RN+LL +  +      +
Sbjct: 118 SPEDLNIIKNGPSERRHFLDAELCQLDKIYLSDLSNYNKILNQRNKLLKDMVYRPELSDT 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + Q+ + G KI   R + +  L+ L+ E        H ++S      G  ++ F +
Sbjct: 178 LPVWDMQLIDTGKKIIRRREQFVKELNELVHEI-------HYRIS------GGREELFLS 224

Query: 243 LKEEYAKKLFDG-----RKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
            +   +  L +      +  D    +T +GPHR DL+       I    GS G+Q+   +
Sbjct: 225 YEPSVSADLLEQELERVKPRDLKQCQTSVGPHRDDLLFSIAGVDIR-KFGSQGQQRTSAL 283

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            + L+   L+  +    P+LLLD++ + LD +++N L   + D  + I  TG D+
Sbjct: 284 SLKLSEIELVRKSIHDTPVLLLDDVLSELDSNRQNYLLNSICDTQTIITCTGLDE 338


>gi|27466921|ref|NP_763558.1| recombination protein F [Staphylococcus epidermidis ATCC 12228]
 gi|38258564|sp|Q8CQK5|RECF_STAES RecName: Full=DNA replication and repair protein recF
 gi|27314463|gb|AAO03600.1|AE016744_3 DNA repair and genetic recombination protein [Staphylococcus
           epidermidis ATCC 12228]
          Length = 371

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 168/384 (43%), Gaps = 29/384 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYEQVTLDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FKSDYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQIGQKTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q  E  +K+ + R   I  L +L            E +  +  P +KLS   
Sbjct: 176 TMLEVLNQQFVEYALKVTLRREHFIKELETLAQPIHAGITNDQETLTLDYVPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                ++ +   L EE    L D  + +      L GPHR DL  +  +      +GS G
Sbjct: 233 ----NYEANQSELIEEVLALLNDNLQREKERGVCLYGPHRDDLSFN-VNGMDAQTYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRISNHQAL 373
                D  +   AK  RIS  + L
Sbjct: 347 SVEGIDHEIMNNAKLYRISQGEIL 370


>gi|327463824|gb|EGF10140.1| recombination protein F [Streptococcus sanguinis SK1057]
          Length = 364

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 164/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENDLLVS-GLLEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L          L
Sbjct: 178 LDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEELTVK---YLSSIPLHQIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLLSSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q L 
Sbjct: 351 KIFTIQQGQILS 362


>gi|329117358|ref|ZP_08246075.1| DNA replication and repair protein RecF [Streptococcus parauberis
           NCFD 2020]
 gi|326907763|gb|EGE54677.1| DNA replication and repair protein RecF [Streptococcus parauberis
           NCFD 2020]
          Length = 364

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/365 (24%), Positives = 163/365 (44%), Gaps = 13/365 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L ++ FRNY  L + F     IF+G+N  GKTNILEAI F++  R  R  S  ++ +
Sbjct: 3   LKELTLNHFRNYNDLNINFSEGLNIFIGNNAQGKTNILEAIYFIALTRSHRTRSDKELIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F +    +EG       +I LE       R  +IN +    + E    + +    
Sbjct: 63  -----FSTDRLSIEGKLNRLSGNISLEINLSDKGRITKINSLKQAKLSEYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG-YFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D  +   
Sbjct: 118 PEDLQLVKGAPSLRRKFIDIDLGQIKPVYLSDLSNYNHILKQRNAYLKAARTIDFDFLVV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQ--KENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q++  G ++   R++ I  L      + Q        +++     +D    Q    +
Sbjct: 178 LDQQLSYYGSRVIQQRIQFIADLEKEADAHHQAISNELESLQIKYISSIDTSQSQ---LI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E++ ++L   R+ D   + T IGPHR D  +++    +     S G+ + +++ I +A 
Sbjct: 235 QEKFMEQLERNRQRDIFRKNTSIGPHRDD--IEFYINNMNANFASQGQHRSLILSIKMAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             L+   TG  PILLLD++ + LD  ++  L   V     Q F+T T       L +T K
Sbjct: 293 VSLMKILTGDNPILLLDDVMSELDNTRQTKLIETVIQENVQTFITTTSLEHLSQLPKTLK 352

Query: 364 FMRIS 368
              ++
Sbjct: 353 TFHVT 357


>gi|299143459|ref|ZP_07036539.1| DNA replication and repair protein RecF [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298517944|gb|EFI41683.1| DNA replication and repair protein RecF [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 361

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 181/377 (48%), Gaps = 26/377 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI  L +S FRNY  L      Q  +  G+N +GKTN+LEAI  L+ G+ FR    +++
Sbjct: 1   MKILNLELSNFRNYKYLYYNPKGQINVITGENAMGKTNLLEAIYVLTVGKSFRTVKDSEL 60

Query: 65  TRI-GSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            +I G  +     +     E   D++I  + ++  S+    +N      + +  +     
Sbjct: 61  IQIGGEQTNLKALSINFEYEDYLDVNIYKDKKNKYSINSDDMN------LSQYRRDFSSV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              PS   +      ERR++LD ++  +   +   +  + +++  RN+LL +   +    
Sbjct: 115 IFSPSDLNMVKFSPSERRKYLDSLILKLSSVYEHNLYRYRKIIFERNKLLKKN-INYDLL 173

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
              + Q+A+ GVKI   R++++    +    YV+   +  + LS    L   +  +   +
Sbjct: 174 EVYDFQLAKYGVKILRERLKILKEFEN----YVK---YHFLNLSGGESLKITYLSTIPLM 226

Query: 244 K-EEYAKKLF-----DGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVL 296
             EE  +K+F     + RK D   + T IGPHR D  +D+  + ++   +GS GE + V+
Sbjct: 227 SDEEEMEKIFLDSLKNCRKRDLEIKFTTIGPHRDD--IDFKIENLSAKTYGSQGEIRTVV 284

Query: 297 VGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD 356
           + + L+   +I N    +P+LLLD++ + LD+++ + L   + ++ + I  T  ++  F 
Sbjct: 285 LSLKLSEVDIIKNYQKNSPLLLLDDVFSELDKNRASYLINSLKNMQTFITSTNLNEENFR 344

Query: 357 SLNETAKFMRISNHQAL 373
           SLN  A F  I N Q +
Sbjct: 345 SLN--ADFYEIKNGQII 359


>gi|149012798|ref|ZP_01833743.1| recombination protein F [Streptococcus pneumoniae SP19-BS75]
 gi|147763229|gb|EDK70168.1| recombination protein F [Streptococcus pneumoniae SP19-BS75]
          Length = 365

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 87/373 (23%), Positives = 170/373 (45%), Gaps = 22/373 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSIRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENF------PHIKLSLTGFLDGKFDQS 239
           ++ Q+ + G ++   R++ I  L S    + +K++F        + +S    ++    Q+
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVNITDKQN 233

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              L E +   L   +  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 234 ---LSESFKIALEKSKSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRISNHQA 372
           E      I + +A
Sbjct: 348 ENLSIFTIQDGKA 360


>gi|220930854|ref|YP_002507762.1| DNA replication and repair protein RecF [Halothermothrix orenii H
           168]
 gi|254790480|sp|B8CZN7|RECF_HALOH RecName: Full=DNA replication and repair protein recF
 gi|219992164|gb|ACL68767.1| DNA replication and repair protein RecF [Halothermothrix orenii H
           168]
          Length = 375

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 165/356 (46%), Gaps = 17/356 (4%)

Query: 12  ISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPS 71
           + +FRN     +  D +  +FVG NG GKTN LEA+  +      R  +  ++ R     
Sbjct: 8   LKDFRNLTENLIKLDNRLNVFVGLNGQGKTNFLEAVYLMGTASSHRTNADRELIRWNQDR 67

Query: 72  FFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDR 131
                  V+  E L  IS+++    ++ V+ L+INDV    V EL  +L +    P   +
Sbjct: 68  AVVQLYLVKRDEKLK-ISLEI----NKKVKKLEINDVPQERVSELLGNLNVVLFSPEDLK 122

Query: 132 IFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDSSWCSSIE 187
           +       RR+FLD  +  + P +   +  +  ++  RN LL E       D++     +
Sbjct: 123 LVKEGPHFRRKFLDTELSQVKPYYHYLLKKYNHILSQRNNLLKELMTGNKSDTTLLEVWD 182

Query: 188 AQMAELGVKINIARVEMINALSSLI-MEYVQ-KENFPHIKLSLTGFL-DGKFDQSFCALK 244
            Q+ E+G KI   R+E+I+ L  L  + + Q  +   +I LS    L D   ++    +K
Sbjct: 183 EQLVEIGAKIIQNRIEVIDKLKILARLSHRQITDGLENITLSYESSLSDRIEEKELEEIK 242

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
             +  KL + R  +     TL GP R DL +      I   +GS G+Q+   + + LA  
Sbjct: 243 IIFRNKLVNNRNEEITRGYTLAGPQRDDLKITMNGIDIR-KYGSQGQQRTAALSLKLAEL 301

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
             + +  G  P+LLLD++ + LD  +R+ L  I+     Q F+T TD   F +LNE
Sbjct: 302 EFMKSEQGEYPVLLLDDVFSELDNKRRHRLIDIMAH-RVQTFITATD---FFNLNE 353


>gi|296110747|ref|YP_003621128.1| recombination protein F [Leuconostoc kimchii IMSNU 11154]
 gi|295832278|gb|ADG40159.1| recombination protein F [Leuconostoc kimchii IMSNU 11154]
          Length = 372

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 169/372 (45%), Gaps = 55/372 (14%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNYA L+L F     +F+G+N  GKTN+LE+I  L+  R  R +S  ++
Sbjct: 1   MELTSLKLVNYRNYADLKLDFSDGVNVFLGENAQGKTNLLESIYVLALTRSHRTSSDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R       +   RV+       +S+    +  R+    ++N +    + +    L +  
Sbjct: 61  IRWHEKE-ATISGRVKKNISETPLSLHFSNKGKRA----RVNHLEQSKLSQYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN----RLLTEGYFDS 180
             P    +  G    RRRF+D     ++P +      + R+++ RN    RL  +   D+
Sbjct: 116 FAPEDLELVKGAPSVRRRFIDMEFGQMNPLYLYNTTQYRRILKERNAYLKRLQMKQTTDT 175

Query: 181 SWCSSIEAQMAELGVKINIAR---------------VEMINALSSLIMEYVQKENFPH-- 223
            +   +  Q+ ++G ++ +AR                E+ N L  L + Y    +F    
Sbjct: 176 VFLDVLTEQLVDVGAQVILARQAFTERLQAAAQPIHAEIANQLEQLTLIYQTSVDFESGD 235

Query: 224 ----IKLSLTGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDY 277
               +KL+        F+Q   ALK++ A+++  G         TL+GPHR DL  IV+ 
Sbjct: 236 ELATVKLA--------FEQ---ALKKQQAREIMQG--------STLVGPHRDDLQFIVND 276

Query: 278 CDKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRI 337
            D AI    GS G+Q+   + + LA   L+   TG  PILLLD++ + LD +++  L   
Sbjct: 277 NDVAI---FGSQGQQRTTALAVKLAEIDLMQQETGEYPILLLDDVLSELDANRQTHLLLA 333

Query: 338 VTDIGSQIFMTG 349
           + D   Q F+T 
Sbjct: 334 IQD-KVQTFITS 344


>gi|153940655|ref|YP_001389373.1| recombination protein F [Clostridium botulinum F str. Langeland]
 gi|166220705|sp|A7G9B3|RECF_CLOBL RecName: Full=DNA replication and repair protein recF
 gi|152936551|gb|ABS42049.1| DNA replication and repair protein RecF [Clostridium botulinum F
           str. Langeland]
 gi|295317480|gb|ADF97857.1| DNA replication and repair protein RecF [Clostridium botulinum F
           str. 230613]
          Length = 364

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 168/362 (46%), Gaps = 39/362 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D+ +
Sbjct: 3   IKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +   
Sbjct: 63  WDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W + 
Sbjct: 118 SPEDLRIIKDYPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNWNNK 171

Query: 186 I-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLSLTG 230
           I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    LT 
Sbjct: 172 INDIIDIYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY----LTN 226

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             D  FD +    ++E    L   RK D     T IGPHR D  V   +   T   GS G
Sbjct: 227 IKD--FDNA----EKELLIVLKKNRKKDLERNSTSIGPHRDDFEVS-INNIDTRIFGSQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  TG 
Sbjct: 280 QQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQKFVLNSIDKIQTIITCTGI 339

Query: 351 DK 352
           ++
Sbjct: 340 EE 341


>gi|303230615|ref|ZP_07317365.1| putative DNA replication and repair protein RecF [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302514670|gb|EFL56662.1| putative DNA replication and repair protein RecF [Veillonella
           atypica ACS-049-V-Sch6]
          Length = 366

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 163/364 (44%), Gaps = 26/364 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  L + +FRNY  L L    +  +  G NG GKTNILEAI   + G+  R    +D+
Sbjct: 1   MRINSLQLFQFRNYKDLTLDLQPEIIVLYGTNGAGKTNILEAIYVGTIGKSHRTNDTSDM 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
               +          E  E L  ++IKL  +  + +R   +ND  I    EL   L    
Sbjct: 61  LLFNANE-AGIVVNFEKKETLQKVNIKLFRQGPKDIR---LNDTKIS-QKELIGTLNTVI 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSW-C 183
             P   ++  G    RRRFLD  +      +  +++ + RL++ RN LL E     +   
Sbjct: 116 FCPEDLQLIKGSPSGRRRFLDMEISQTSATYYHQLLQYNRLLQQRNTLLKEYRGKQNIPL 175

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG---KFDQSF 240
           +  + Q+A++   I   R+E +  ++ LI    +K         LTG L+     ++Q +
Sbjct: 176 AEWDVQLADMAAFIVKKRMESLKKINLLIDLMNRK---------LTGGLENLTIGYEQPY 226

Query: 241 ------CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
                    KE +   L +    D     T +GPHR DL   + D       GS G+Q+ 
Sbjct: 227 GEEGHMVYTKEAFYDLLQEALPQDRHRMTTSVGPHRDDLRF-FSDAIDLKKFGSQGQQRT 285

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
            ++ + L+    I +  G  P+LLLD++ + LDE +RN L + +     Q  +T TD   
Sbjct: 286 AVLSLKLSELEFIKSEVGEYPVLLLDDVLSELDEARRNNLLQFIHK-RIQTVITTTDIHD 344

Query: 355 FDSL 358
           F+++
Sbjct: 345 FENM 348


>gi|222153952|ref|YP_002563129.1| recombination protein F [Streptococcus uberis 0140J]
 gi|254790492|sp|B9DWE6|RECF_STRU0 RecName: Full=DNA replication and repair protein recF
 gi|222114765|emb|CAR43930.1| DNA replication and repair protein RecF [Streptococcus uberis
           0140J]
          Length = 364

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 161/360 (44%), Gaps = 39/360 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK L +  FRNY ++   F     +F+G+N  GKTN LEAI FL+  R  R  +  ++ +
Sbjct: 3   IKELQLRNFRNYGTVDTEFSPGLNVFIGNNAQGKTNFLEAIYFLALTRSHRTRTDKELIQ 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             S +      ++  + G   + ++L  +     R  +IN +    + +    + +    
Sbjct: 63  F-SKNNLQLIGKLNRISGALSLELQLSDKG----RITKINALKQARLSDYIGTMMVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L T    +S + S 
Sbjct: 118 PEDLQLIKGAPSLRRKFIDIDLGQIKPIYLSDLSNYNYVLKQRNTYLKTISTINSDFLSV 177

Query: 186 IEAQMAELGVKINIARVEMI---------------NALSSLIMEYVQKENFPHIKLSLTG 230
           ++ Q+A+ G K+   R++ I               N L SLI+ Y         + S+T 
Sbjct: 178 LDEQLADYGSKVIKHRIDFIGELTREANKHHEAISNGLESLIITY---------ESSVT- 227

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                  Q    +KE +   L   R+ D   + T IGPHR D+     D     A  S G
Sbjct: 228 ------QQDHQTIKEAFLLNLQKNRQRDIFKKNTSIGPHRDDIHFFINDMNANFA--SQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           + + +++ + +A   L+   TG  PILLLD++ + LD  ++  L   V +   Q F+T T
Sbjct: 280 QHRSLILSLKMAEVSLMKEMTGDNPILLLDDVMSELDNTRQIKLLETVINENVQTFITTT 339


>gi|325686466|gb|EGD28495.1| recombination protein F [Streptococcus sanguinis SK72]
          Length = 364

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 165/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENDLLVS-GILEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L     Q    L
Sbjct: 178 LDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEKLTVK---YLSSIPLQKIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLISSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIMS 362


>gi|227549439|ref|ZP_03979488.1| recombination protein F [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078516|gb|EEI16479.1| recombination protein F [Corynebacterium lipophiloflavum DSM 44291]
          Length = 394

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 103/392 (26%), Positives = 182/392 (46%), Gaps = 35/392 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++ +FR++  L L  +   T+F G NG GKTNI+EA+ + S     R ++ A + R
Sbjct: 3   VRDLDLRDFRSWPELTLTLEQGATVFAGRNGHGKTNIVEALHYTSTLGSHRVSTDAPLIR 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G S +  S     +G E    + IK            QIN   ++   E+   LR    
Sbjct: 63  SGCSDARVSVTTVNDGRELTTHLLIKAN-----GANQAQINRTRLKSAREVLGVLRTVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------GYF 178
            P   ++ +G   ERRRFLD +  +  PR      D+++++R RN LL         GY 
Sbjct: 118 SPEDLKLVAGEPAERRRFLDDLATSRAPRLGGAKADYDKVLRQRNALLRSSAHELRRGYG 177

Query: 179 DSSWCSSI------EAQMAELGVKINIARVEMINALSSLIME---YVQKENFPHIKLSLT 229
           D +  S++      + Q+A LG ++   R+E+++ LS  I E    V  E+ P   +S +
Sbjct: 178 DDTGASALATLDVWDLQLARLGAEVTAGRLELLDVLSPHIAESYAAVAPESRP-ASVSYS 236

Query: 230 GFLD-------GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAI 282
             +D       G+  +    ++     +L   R+ +     TL+GPHR D+++   D   
Sbjct: 237 STVDDAVRSLAGEPSRDPGVIEAAMLTELARRRREEIERTTTLVGPHRDDMVLMLGDTPA 296

Query: 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG 342
              + S GE     + + LA   L++ + G  P+L+LD++ A LD  +R  L  +     
Sbjct: 297 K-GYASHGETWSYALALHLAEYELLA-SEGSHPVLILDDVFAELDALRRQRLVAVAHSAE 354

Query: 343 SQIFMTGTDKSVFDSLNE--TAKFMRISNHQA 372
             +        + D+L +  +A+++ +S H+A
Sbjct: 355 QVLITAAVGDDLPDNLADAVSARYL-VSMHEA 385


>gi|307707884|ref|ZP_07644361.1| DNA replication and repair protein RecF [Streptococcus mitis NCTC
           12261]
 gi|307616144|gb|EFN95340.1| DNA replication and repair protein RecF [Streptococcus mitis NCTC
           12261]
          Length = 365

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 87/367 (23%), Positives = 163/367 (44%), Gaps = 16/367 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  IF+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNIFLGRNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFP---HIKLSLTGFLDGKFDQSFCA 242
           ++ Q+ + G ++   R++ I  L      + +K++F     I+     +           
Sbjct: 178 LDDQLVDYGCRVMNHRLDFIKKLE----HFGRKKHFELSNQIEELSISYQSSVKSTEKED 233

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I LA
Sbjct: 234 LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSIKLA 291

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
              L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L E  
Sbjct: 292 EIELMESITTESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLPENL 350

Query: 363 KFMRISN 369
               I +
Sbjct: 351 SIFTIQD 357


>gi|154707128|ref|YP_001423442.1| DNA replication and repair protein [Coxiella burnetii Dugway
           5J108-111]
 gi|226737784|sp|A9KEV0|RECF_COXBN RecName: Full=DNA replication and repair protein recF
 gi|154356414|gb|ABS77876.1| DNA replication and repair protein [Coxiella burnetii Dugway
           5J108-111]
          Length = 357

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 94/349 (26%), Positives = 156/349 (44%), Gaps = 24/349 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRN A + +   +Q   F G NG GKT+ILE+I +LS GR FR      + +  +
Sbjct: 7   LKVNQFRNLADVDITPHSQFNFFFGQNGAGKTSILESIYYLSVGRSFRTHLPQRLIQDNT 66

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F        G +    I + +E RD    RCL+IN           K L +  L    
Sbjct: 67  DRFLIFITLYNGTQF---IPLGVE-RDCHGDRCLRINGETASSWSLAAKRLPLCSLSAMS 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
            R        RR+FLD ++F ++P         +R ++ RN  L +        +  +  
Sbjct: 123 HRFLLDGPRVRRQFLDWLMFHVEPSFFSIWQRLQRSLKQRNAAL-KAKLPLGEITHWDKM 181

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           + E G +++  R  ++     L  + +Q+    +P I     G+             E+Y
Sbjct: 182 LVEDGERLHQLRQNVVTEFRPLFTQMLQQFLPAYPLIGHYFRGW------------SEKY 229

Query: 248 A--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCD-KAITIAHGSTGEQKVVLVGIFLAHA 304
           +  ++L    K D     T  GP R+D  +   D  A  I   S G+QK+V   +  A  
Sbjct: 230 SLMEQLQINLKQDLQRGYTQAGPQRADFRLTLRDLPAQDIL--SQGQQKLVTYALHFAQG 287

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            L+   TG +PI L+D++ A LD +KR+ +  +V  + SQ+F++G D +
Sbjct: 288 LLLKEKTGISPIYLIDDLPAELDANKRDCVIDLVNYLESQVFISGIDPN 336


>gi|327467748|gb|EGF13242.1| recombination protein F [Streptococcus sanguinis SK330]
          Length = 364

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 165/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENDLLVS-GILEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L         +L
Sbjct: 178 LDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEELTVK---YLSSIPLHQIDSL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLLSSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIIS 362


>gi|165924210|ref|ZP_02220042.1| DNA replication and repair protein RecF [Coxiella burnetii RSA 334]
 gi|165916344|gb|EDR34948.1| DNA replication and repair protein RecF [Coxiella burnetii RSA 334]
          Length = 357

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 94/349 (26%), Positives = 156/349 (44%), Gaps = 24/349 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +++FRN A + +   +Q   F G NG GKT+ILE+I +LS GR FR      + +  +
Sbjct: 7   LKVNQFRNLADVDITPHSQFNFFFGQNGAGKTSILESIYYLSVGRSFRTHLPQRLIQDNT 66

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F        G +    I + +E RD    RCL+IN           K L +  L    
Sbjct: 67  DRFLIFITLYNGTQF---IPLGVE-RDCHGDRCLRINGETASSWSLAAKRLPLCSLSAMS 122

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEAQ 189
            R        RR+FLD ++F ++P         +R ++ RN  L +        +  +  
Sbjct: 123 HRFLLDGPRVRRQFLDWLMFHVEPSFFSIWQRLQRSLKQRNASL-KAKLPLGEITHWDKM 181

Query: 190 MAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEEY 247
           + E G +++  R  ++     L  + +Q+    +P I     G+             E+Y
Sbjct: 182 LVEDGERLHQLRQNVVTEFKPLFTQMLQQFLPAYPLIGHYFRGW------------SEKY 229

Query: 248 A--KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCD-KAITIAHGSTGEQKVVLVGIFLAHA 304
           +  ++L    K D     T  GP R+D  +   D  A  I   S G+QK+V   +  A  
Sbjct: 230 SLMEQLQINLKQDLQRGYTQAGPQRADFRLTLRDLPAQDIL--SQGQQKLVTYALHFAQG 287

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKS 353
            L+   TG +PI L+D++ A LD +KR+ +  +V  + SQ+F++G D +
Sbjct: 288 LLLKEKTGISPIYLIDDLPAELDANKRDCVIDLVNCLESQVFISGIDPN 336


>gi|150387857|ref|YP_001317906.1| DNA replication and repair protein RecF [Alkaliphilus
           metalliredigens QYMF]
 gi|166918718|sp|A6TJ79|RECF_ALKMQ RecName: Full=DNA replication and repair protein recF
 gi|149947719|gb|ABR46247.1| DNA replication and repair protein RecF [Alkaliphilus
           metalliredigens QYMF]
          Length = 368

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 159/333 (47%), Gaps = 11/333 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L +  FRNY  L+L    +  IFVG+N  GKTN+LEA+   + G+ FR +   ++  
Sbjct: 3   IEGLKLINFRNYEQLQLQLHPKLNIFVGENAQGKTNVLEAVYLSAIGKSFRTSKDQEMIF 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           +        + +V+    + + +I+L    D+  + +++N V +  + EL  +L I    
Sbjct: 63  VDK---HQAYVQVKVKRVVYENNIELRLNVDKK-KNIKVNQVPLLKLGELLGNLNIVLFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P   +I      ERR+F+D  +  I P++   +  + ++++ RN+LL             
Sbjct: 119 PEDLKIIKEGPGERRKFIDGEISQIAPKYYYNLNQYNKILQQRNKLLKYHKGKKLDLEVW 178

Query: 187 EAQMAELGVKINIARVEMINALSSL--IMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
             Q+A +G  + I R   I  ++ L  +M     +    +++     +  K   +   ++
Sbjct: 179 NEQLANIGASLIIYRRNFIKRIAILAKLMHRKITDGIETLEIEYKSSVLIKDHDTVDQIR 238

Query: 245 EEYAKKLFDGRKMDSMSRR--TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
             + K+L   +  D   RR  TL+GPHR DL  +     +   +GS G+Q+  ++ + LA
Sbjct: 239 VGFLKEL--NQSADEERRRGVTLVGPHRDDLNFNINGLEVK-TYGSQGQQRTAVLSLKLA 295

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALF 335
              LI    G  P+LLLD++ + LD  ++N L 
Sbjct: 296 ELELIKGEVGEYPVLLLDDVMSELDMKRQNDLI 328


>gi|327438159|dbj|BAK14524.1| recombinational DNA repair ATPase [Solibacillus silvestris StLB046]
          Length = 372

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 177/381 (46%), Gaps = 31/381 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I+ L ++ +RNY SL L F  +  +F+G+N  GKTN++E+I  L+  +  R A+  ++
Sbjct: 1   MNIERLQLTNYRNYESLTLDFSDKINVFIGENAQGKTNVMESIYVLAMAKSHRTANDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     + + + ++EG+       + +E    +  +  +IN +    +      + +  
Sbjct: 61  IR-----WDADYGKIEGVVNKRYGGVPIELTISKKGKKGKINHLEQTKLSNYIGQMNVVM 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCS 184
             P    I  G    RRRF+D  +  I P +   ++ F+++++ RN LL +     S  S
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMEIGQISPVYLHDLLTFQKILKQRNHLLKKNMGKQSLAS 175

Query: 185 SI-----EAQMAELGVKINIARVEMINALSSLIMEYVQKENF----PHIKLSLTGFLDGK 235
            +       Q  +  ++I   R + I     L+ ++ +  +F       KL +       
Sbjct: 176 DVMFEIYTEQYVQAAIQIIRKRFQFI----ELLQDWAEPIHFGISRGLEKLVIKYRPVTG 231

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRR------TLIGPHRSDLIVDYCDKAITIAHGST 289
            D S+ A  EE A  L   +K++ + +R      TLIGPHR DL     D  + + +GS 
Sbjct: 232 MDASWTA--EEMADYL--TKKLEEVKQREIERGVTLIGPHRDDLQFFVNDYDVQV-YGSQ 286

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           G+Q+   + + LA   LI   T   PILLLD++ + LD+ +++ L   +     Q F+T 
Sbjct: 287 GQQRTTALSLKLAEIELIKQETKETPILLLDDVLSELDDYRQSHLLNTIQG-EVQTFVTT 345

Query: 350 TD-KSVFDSLNETAKFMRISN 369
           T  + +     + AK  R++ 
Sbjct: 346 TSVEGIHHDTIQHAKLFRVTQ 366


>gi|120552948|ref|YP_957299.1| DNA replication and repair protein RecF [Marinobacter aquaeolei
           VT8]
 gi|166220714|sp|A1TWJ3|RECF_MARAV RecName: Full=DNA replication and repair protein recF
 gi|120322797|gb|ABM17112.1| DNA replication and repair protein RecF [Marinobacter aquaeolei
           VT8]
          Length = 373

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 96/355 (27%), Positives = 169/355 (47%), Gaps = 15/355 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L    FRN  S  + F     +  G NG GKT++LEAI +L  GR FR + +  V   G 
Sbjct: 6   LQTQHFRNLLSAPVEFSPSFNLLYGANGSGKTSVLEAIGYLGLGRSFRVSRHQAVVAHGQ 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETR----DDRSVR--CLQINDVVIRVVDELNKHLRIS 123
            S  + F  ++      + S K+E R     D S++   L+++   +R +  L  HL +S
Sbjct: 66  -SKLTVFGALDSGLLAQESSEKVEHRIGISRDVSLKETQLRVDGEAVRSLSFLAMHLPVS 124

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
            + P +  I +G   +RR+FLD +VF ++P         +R+   RN++L  G  D S  
Sbjct: 125 VIDPGVFDIVAGGPGKRRQFLDWLVFHVEPSFSSLWQQVQRVTSQRNQMLRNGRLDESLM 184

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
              ++Q   L   ++  R  +           + + + P ++     F  G +D+S  AL
Sbjct: 185 RVWDSQYGALAESLSDIRETVFQRFKIAFESVLAELDAPWVEGLKMDFYPG-WDRS-TAL 242

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            E     L + R+ +     TL GP+R+D+ + +  + +     S G+QK +++ + +A 
Sbjct: 243 TE----VLVNHREQERRMGHTLYGPNRADIRLKFGGRPVAETF-SRGQQKTLVILMKIAQ 297

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
            +++S+  G     LLD+I+A LD   R  L R + ++  Q+F+T  +    D+L
Sbjct: 298 GKVLSD-LGKQVTFLLDDINAELDVRHRVMLARNLQELRCQVFITSIEHPEPDTL 351


>gi|311897310|dbj|BAJ29718.1| putative DNA replication and repair protein RecF [Kitasatospora
           setae KM-6054]
          Length = 387

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 173/360 (48%), Gaps = 26/360 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA + +  D   T FVG NG GKTN++EA+ +++     R A+ A +
Sbjct: 1   MHVAHLSLADFRSYARVEVPLDPGVTAFVGPNGQGKTNLVEAVGYVATLGSHRVATDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+       + V G  G A + ++LE    ++ R        +R  D L   LR   
Sbjct: 61  IRLGAERAVIRASVVAGG-GRATL-VELELTAGKANRARLNRSDNVRPRDVLGV-LRTVL 117

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-------EGY 177
             P    +  G   ERRRFLD ++ A  PR      D+ER+++ RN LL         G 
Sbjct: 118 FAPEDLALVKGDPGERRRFLDELLTARTPRLAGVRSDYERVLKQRNALLKTAATARRAGG 177

Query: 178 FDSSWCSSIE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG 234
             S+  +++E     +A  G ++   R++++ AL  L+ E   ++  P    ++  +   
Sbjct: 178 GKSADLATLEVWDGHLARAGAELTAFRIQLVAALQPLVAE-AYRQLAPDGGDTVLEYRS- 235

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRR------TLIGPHRSDLIVDYCDKAITIAHGS 288
            F+      +E+  ++L D   + S+ R+      TL+GPHR +L++          + S
Sbjct: 236 SFEGELPTSREQAERQLLD--ALQSLRRQEIERGLTLVGPHRDELLL-RLGPLPAKGYAS 292

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            GE     + + LA   L+    G  P+L+LD++ A LD  +R+ L  +V   G Q+ +T
Sbjct: 293 HGESWSYALALRLASYELL-RAEGEEPVLVLDDVFAELDARRRDRLAELVAG-GEQVLVT 350


>gi|15922994|ref|NP_370528.1| recombination protein F [Staphylococcus aureus subsp. aureus Mu50]
 gi|15925709|ref|NP_373242.1| recombination protein F [Staphylococcus aureus subsp. aureus N315]
 gi|21281733|ref|NP_644819.1| recombination protein F [Staphylococcus aureus subsp. aureus MW2]
 gi|49482257|ref|YP_039481.1| recombination protein F [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49484916|ref|YP_042137.1| recombination protein F [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57651112|ref|YP_184915.1| recombination protein F [Staphylococcus aureus subsp. aureus COL]
 gi|88193827|ref|YP_498612.1| recombination protein F [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148266451|ref|YP_001245394.1| recombination protein F [Staphylococcus aureus subsp. aureus JH9]
 gi|150392484|ref|YP_001315159.1| recombination protein F [Staphylococcus aureus subsp. aureus JH1]
 gi|151220215|ref|YP_001331038.1| recombination protein F [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156978335|ref|YP_001440594.1| recombination protein F [Staphylococcus aureus subsp. aureus Mu3]
 gi|161508270|ref|YP_001573929.1| recombination protein F [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141519|ref|ZP_03566012.1| recombination protein F [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253316842|ref|ZP_04840055.1| recombination protein F [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253733835|ref|ZP_04868000.1| recombination protein F [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|254663938|ref|ZP_05143410.1| recombination protein F [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257424200|ref|ZP_05600629.1| recombination protein F [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426877|ref|ZP_05603279.1| recombination protein F [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429513|ref|ZP_05605900.1| recombination protein F [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432160|ref|ZP_05608523.1| recombination protein F [Staphylococcus aureus subsp. aureus E1410]
 gi|257435121|ref|ZP_05611172.1| recombination protein F [Staphylococcus aureus subsp. aureus M876]
 gi|257793542|ref|ZP_05642521.1| recombination protein RecF [Staphylococcus aureus A9781]
 gi|258411152|ref|ZP_05681431.1| recombination protein RecF [Staphylococcus aureus A9763]
 gi|258420944|ref|ZP_05683878.1| recombination protein F [Staphylococcus aureus A9719]
 gi|258438583|ref|ZP_05689806.1| recombination protein F [Staphylococcus aureus A9299]
 gi|258443961|ref|ZP_05692299.1| recombination protein F [Staphylococcus aureus A8115]
 gi|258446223|ref|ZP_05694383.1| recombination protein F [Staphylococcus aureus A6300]
 gi|258449118|ref|ZP_05697224.1| recombination protein RecF [Staphylococcus aureus A6224]
 gi|258451363|ref|ZP_05699394.1| recombination protein F [Staphylococcus aureus A5948]
 gi|258454404|ref|ZP_05702372.1| recombination protein F [Staphylococcus aureus A5937]
 gi|262049436|ref|ZP_06022308.1| DNA replication and repair protein [Staphylococcus aureus D30]
 gi|262051892|ref|ZP_06024107.1| DNA replication and repair protein [Staphylococcus aureus 930918-3]
 gi|269201694|ref|YP_003280963.1| recombination protein F [Staphylococcus aureus subsp. aureus ED98]
 gi|282894283|ref|ZP_06302513.1| DNA replication and repair protein recF [Staphylococcus aureus
           A8117]
 gi|282907051|ref|ZP_06314899.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282910030|ref|ZP_06317838.1| recombination protein RecF [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282912278|ref|ZP_06320074.1| recombination protein RecF [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282912918|ref|ZP_06320710.1| RecF protein [Staphylococcus aureus subsp. aureus M899]
 gi|282920723|ref|ZP_06328442.1| DNA replication and repair protein recF [Staphylococcus aureus
           A9765]
 gi|282922546|ref|ZP_06330236.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus C101]
 gi|282927754|ref|ZP_06335368.1| DNA replication and repair protein recF [Staphylococcus aureus
           A10102]
 gi|283959488|ref|ZP_06376929.1| RecF protein [Staphylococcus aureus subsp. aureus A017934/97]
 gi|284023041|ref|ZP_06377439.1| recombination protein F [Staphylococcus aureus subsp. aureus 132]
 gi|293497971|ref|ZP_06665825.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293511561|ref|ZP_06670255.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus M809]
 gi|293550170|ref|ZP_06672842.1| RecF protein [Staphylococcus aureus subsp. aureus M1015]
 gi|294849832|ref|ZP_06790572.1| DNA replication and repair protein recF [Staphylococcus aureus
           A9754]
 gi|295406868|ref|ZP_06816672.1| DNA replication and repair protein recF [Staphylococcus aureus
           A8819]
 gi|295429301|ref|ZP_06821923.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296275683|ref|ZP_06858190.1| recombination protein F [Staphylococcus aureus subsp. aureus MR1]
 gi|297209448|ref|ZP_06925846.1| recombination protein F [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245903|ref|ZP_06929765.1| DNA replication and repair protein recF [Staphylococcus aureus
           A8796]
 gi|297589197|ref|ZP_06947838.1| recombination protein F [Staphylococcus aureus subsp. aureus MN8]
 gi|300911472|ref|ZP_07128921.1| recombination protein F [Staphylococcus aureus subsp. aureus TCH70]
 gi|304379952|ref|ZP_07362681.1| recombination protein F [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|56749543|sp|Q6GD86|RECF_STAAS RecName: Full=DNA replication and repair protein recF
 gi|56749590|sp|Q6GKU1|RECF_STAAR RecName: Full=DNA replication and repair protein recF
 gi|56753681|sp|P68861|RECF_STAAM RecName: Full=DNA replication and repair protein recF
 gi|56753682|sp|P68862|RECF_STAAN RecName: Full=DNA replication and repair protein recF
 gi|56753685|sp|P68863|RECF_STAAU RecName: Full=DNA replication and repair protein recF
 gi|56753686|sp|P68864|RECF_STAAW RecName: Full=DNA replication and repair protein recF
 gi|81695634|sp|Q5HJZ2|RECF_STAAC RecName: Full=DNA replication and repair protein recF
 gi|122540544|sp|Q2G275|RECF_STAA8 RecName: Full=DNA replication and repair protein recF
 gi|166221868|sp|A7WWN1|RECF_STAA1 RecName: Full=DNA replication and repair protein recF
 gi|172048751|sp|A6QD43|RECF_STAAE RecName: Full=DNA replication and repair protein recF
 gi|189039645|sp|A6TXF4|RECF_STAA2 RecName: Full=DNA replication and repair protein recF
 gi|189039646|sp|A5INP5|RECF_STAA9 RecName: Full=DNA replication and repair protein recF
 gi|189039647|sp|A8YYS7|RECF_STAAT RecName: Full=DNA replication and repair protein recF
 gi|13699921|dbj|BAB41220.1| DNA repair and genetic recombination protein [Staphylococcus aureus
           subsp. aureus N315]
 gi|14245771|dbj|BAB56166.1| DNA repair and genetic recombination protein [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|21203168|dbj|BAB93869.1| DNA repair and genetic recombination protein [Staphylococcus aureus
           subsp. aureus MW2]
 gi|49240386|emb|CAG39032.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|49243359|emb|CAG41776.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|57285298|gb|AAW37392.1| recF protein [Staphylococcus aureus subsp. aureus COL]
 gi|87201385|gb|ABD29195.1| DNA replication and repair protein, putative [Staphylococcus aureus
           subsp. aureus NCTC 8325]
 gi|147739520|gb|ABQ47818.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149944936|gb|ABR50872.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus JH1]
 gi|150373015|dbj|BAF66275.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus str. Newman]
 gi|156720470|dbj|BAF76887.1| DNA repair and genetic recombination protein [Staphylococcus aureus
           subsp. aureus Mu3]
 gi|160367079|gb|ABX28050.1| recombination protein RecF [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253728138|gb|EES96867.1| recombination protein F [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257273218|gb|EEV05320.1| recombination protein F [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276508|gb|EEV07959.1| recombination protein F [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279994|gb|EEV10581.1| recombination protein F [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257283039|gb|EEV13171.1| recombination protein F [Staphylococcus aureus subsp. aureus E1410]
 gi|257285717|gb|EEV15833.1| recombination protein F [Staphylococcus aureus subsp. aureus M876]
 gi|257787514|gb|EEV25854.1| recombination protein RecF [Staphylococcus aureus A9781]
 gi|257840037|gb|EEV64502.1| recombination protein RecF [Staphylococcus aureus A9763]
 gi|257843134|gb|EEV67549.1| recombination protein F [Staphylococcus aureus A9719]
 gi|257848142|gb|EEV72134.1| recombination protein F [Staphylococcus aureus A9299]
 gi|257850845|gb|EEV74789.1| recombination protein F [Staphylococcus aureus A8115]
 gi|257855049|gb|EEV77992.1| recombination protein F [Staphylococcus aureus A6300]
 gi|257857551|gb|EEV80446.1| recombination protein RecF [Staphylococcus aureus A6224]
 gi|257860893|gb|EEV83710.1| recombination protein F [Staphylococcus aureus A5948]
 gi|257863498|gb|EEV86258.1| recombination protein F [Staphylococcus aureus A5937]
 gi|259160219|gb|EEW45248.1| DNA replication and repair protein [Staphylococcus aureus 930918-3]
 gi|259162433|gb|EEW47003.1| DNA replication and repair protein [Staphylococcus aureus D30]
 gi|262073984|gb|ACY09957.1| recombination protein F [Staphylococcus aureus subsp. aureus ED98]
 gi|269939530|emb|CBI47888.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus TW20]
 gi|282314767|gb|EFB45153.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus C101]
 gi|282323018|gb|EFB53337.1| RecF protein [Staphylococcus aureus subsp. aureus M899]
 gi|282323974|gb|EFB54290.1| recombination protein RecF [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326096|gb|EFB56401.1| recombination protein RecF [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329950|gb|EFB59471.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282590514|gb|EFB95592.1| DNA replication and repair protein recF [Staphylococcus aureus
           A10102]
 gi|282594131|gb|EFB99119.1| DNA replication and repair protein recF [Staphylococcus aureus
           A9765]
 gi|282763328|gb|EFC03458.1| DNA replication and repair protein recF [Staphylococcus aureus
           A8117]
 gi|283789080|gb|EFC27907.1| RecF protein [Staphylococcus aureus subsp. aureus A017934/97]
 gi|290919217|gb|EFD96293.1| RecF protein [Staphylococcus aureus subsp. aureus M1015]
 gi|291096902|gb|EFE27160.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291465519|gb|EFF08051.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus M809]
 gi|294823380|gb|EFG39809.1| DNA replication and repair protein recF [Staphylococcus aureus
           A9754]
 gi|294968333|gb|EFG44358.1| DNA replication and repair protein recF [Staphylococcus aureus
           A8819]
 gi|295127060|gb|EFG56704.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus EMRSA16]
 gi|296885909|gb|EFH24844.1| recombination protein F [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177268|gb|EFH36521.1| DNA replication and repair protein recF [Staphylococcus aureus
           A8796]
 gi|297577708|gb|EFH96421.1| recombination protein F [Staphylococcus aureus subsp. aureus MN8]
 gi|298693326|gb|ADI96548.1| recF protein [Staphylococcus aureus subsp. aureus ED133]
 gi|300887651|gb|EFK82847.1| recombination protein F [Staphylococcus aureus subsp. aureus TCH70]
 gi|302331776|gb|ADL21969.1| DNA repair and genetic recombination protein [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|302749915|gb|ADL64092.1| DNA repair and genetic recombination protein [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304341532|gb|EFM07442.1| recombination protein F [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312436855|gb|ADQ75926.1| recombination protein F [Staphylococcus aureus subsp. aureus TCH60]
 gi|312828567|emb|CBX33409.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|315129547|gb|EFT85539.1| recombination protein F [Staphylococcus aureus subsp. aureus CGS03]
 gi|315195230|gb|EFU25618.1| recombination protein F [Staphylococcus aureus subsp. aureus CGS00]
 gi|315197922|gb|EFU28255.1| recombination protein F [Staphylococcus aureus subsp. aureus CGS01]
 gi|320141421|gb|EFW33264.1| recombination protein F [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320144404|gb|EFW36169.1| recombination protein F [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323439695|gb|EGA97413.1| recombination protein F [Staphylococcus aureus O11]
 gi|323443268|gb|EGB00885.1| recombination protein F [Staphylococcus aureus O46]
 gi|329312727|gb|AEB87140.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus T0131]
 gi|329725526|gb|EGG62005.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329731646|gb|EGG68006.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus 21189]
          Length = 370

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 162/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSVDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|167031026|ref|YP_001666257.1| recombination protein F [Pseudomonas putida GB-1]
 gi|189039633|sp|B0KEV1|RECF_PSEPG RecName: Full=DNA replication and repair protein recF
 gi|166857514|gb|ABY95921.1| DNA replication and repair protein RecF [Pseudomonas putida GB-1]
          Length = 367

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 92/353 (26%), Positives = 163/353 (46%), Gaps = 16/353 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ + ++  RN   + L+   +  I  G NG GKT++LEA+  L   R FR +    V
Sbjct: 1   MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSSRLNPV 60

Query: 65  TRIGSPSFFSTFARVEGMEG-LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            +   P+  + F  VE  EG    + +  E + + ++R   I+    R   +L + L + 
Sbjct: 61  IQYEQPAC-TVFGEVELTEGGTCKLGVSRERQGEFTIR---IDGQNARSAAQLAELLPLQ 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
            + P   R+  G    RR+FLD  VF ++PR        ++ +R RN  L  G  D +  
Sbjct: 117 LINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALRQRNSWLRHGTLDPASQ 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ + ++     +I+  R   I AL   + E    E      L+L+ +     D+    L
Sbjct: 177 AAWDRELCLASAEIDEYRRNYIKALKP-VFERTLSELVELDGLTLSYYRGWDKDRE---L 232

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC-DKAITIAHGSTGEQKVVLVGIFLA 302
           +E  A  L   ++M      T  GP R+DL +    + A  I   S G+QK+V+  + +A
Sbjct: 233 QEVLASSLLRDQQMGH----TQAGPQRADLRLRLAGNNAADIL--SRGQQKLVVCALRIA 286

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVF 355
              L+S       I L+D++ + LD+  R AL R++ ++  Q+F+T  D  + 
Sbjct: 287 QGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELRCQVFITCVDHELL 339


>gi|302388603|ref|YP_003824424.1| DNA replication and repair protein RecF [Thermosediminibacter
           oceani DSM 16646]
 gi|302199231|gb|ADL06801.1| DNA replication and repair protein RecF [Thermosediminibacter
           oceani DSM 16646]
          Length = 367

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 160/352 (45%), Gaps = 25/352 (7%)

Query: 14  EFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFF 73
           +FRN+    + F     +  GDNG GKTN+LEAI FL   R  R     DV      ++ 
Sbjct: 10  DFRNFREAEVEFSGGLNVLYGDNGQGKTNLLEAIHFLCNLRPVRTTREQDVI-----AWD 64

Query: 74  STFARVEGM----EGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
            T A ++G+     G  D  + L   D + VR   +       + EL   +   +  P  
Sbjct: 65  KTKAYLKGVFDTSSGPVDRELLLVAGDRKKVRECGVER---HRLSELYWQIHAVFFSPDD 121

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA- 188
             +  G   ERRRFLD ++  + P++ R + ++ R +  RNRLL +   + +  ++++A 
Sbjct: 122 LSLVKGRPSERRRFLDLIIARLKPQYGRYLSEYNRALFHRNRLLKDLKKNRTLITALDAW 181

Query: 189 --QMAELGVKINIARVEMINALSSLIMEYV----QKENFPHIKLSLTGFLDGKFDQSFCA 242
             Q++ LG  I   R      L  L+ +Y     ++E    IK + +    G   +S   
Sbjct: 182 DEQLSSLGTVILKTRAAFTEKLFPLVRKYYLYFSREEREIEIKYAGSIVSTGTSPES--- 238

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           + E +   L      D  S  T +GPHR DL      + +    GS GEQ+ + + +  A
Sbjct: 239 IHEAFLAALRKSLPQDLASGYTRVGPHRDDLQFLLGGRDLRY-FGSQGEQRTLSLSLKFA 297

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
             R+   TTG  PILLLD+  + LD ++R  +  +  +   Q+F+T  D S 
Sbjct: 298 ERRVFFETTGVYPILLLDDAMSELDANRRRWI--LEGEEPCQVFVTTVDLSA 347


>gi|325698042|gb|EGD39923.1| recombination protein F [Streptococcus sanguinis SK160]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 164/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                F      V G+       + L+       R  ++N +    + +    + +    
Sbjct: 63  -----FTENELVVSGILEKKTSKVPLDINLTPKGRITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ E G ++   R++ +  L S   +  +   +N   + +    +L         +L
Sbjct: 178 LDDQLVEYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEELTVK---YLSSIPLHQIDSL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYCSSLLSNRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIIS 362


>gi|170755060|ref|YP_001779630.1| recombination protein F [Clostridium botulinum B1 str. Okra]
 gi|226737780|sp|B1IDU6|RECF_CLOBK RecName: Full=DNA replication and repair protein recF
 gi|169120272|gb|ACA44108.1| DNA replication and repair protein RecF [Clostridium botulinum B1
           str. Okra]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 168/362 (46%), Gaps = 39/362 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D+ +
Sbjct: 3   IKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +   
Sbjct: 63  WDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W + 
Sbjct: 118 SPEDLRIIKDSPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNWNNK 171

Query: 186 I-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLSLTG 230
           I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    LT 
Sbjct: 172 INDIIDIYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY----LTN 226

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             D  FD +    ++E    L   RK D     T IGPHR D  V   +   T   GS G
Sbjct: 227 IKD--FDNT----EKELLIVLKKNRKKDLERNSTSIGPHRDDFEVS-INNIDTRIFGSQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  TG 
Sbjct: 280 QQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQKFVLNSIDKIQTIITCTGI 339

Query: 351 DK 352
           ++
Sbjct: 340 EE 341


>gi|89898370|ref|YP_515480.1| recombination protein F [Chlamydophila felis Fe/C-56]
 gi|123483260|sp|Q254F3|RECF_CHLFF RecName: Full=DNA replication and repair protein recF
 gi|89331742|dbj|BAE81335.1| DNA replication and repair protein [Chlamydophila felis Fe/C-56]
          Length = 367

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 92/342 (26%), Positives = 150/342 (43%), Gaps = 11/342 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  FRNY   ++          G+N  GKTN+LEA+  LS GR FR +   +    GS
Sbjct: 6   LRLKNFRNYKEAKISLSPNMNYIFGENAQGKTNLLEALYVLSLGRSFRTSHLTEAISFGS 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             FF     +E        S KL    D+  + +  +   I+ + +L   + I  L  S 
Sbjct: 66  AYFF-----LEMTCEKDGFSHKLSIYVDKHGKKILSDQSPIKTLSQLIGMVPIV-LFSSK 119

Query: 130 DRIF-SGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIEA 188
           DR+  SG   +RR FL+ ++   DP+++  +  + R +  RN LL       S  S  + 
Sbjct: 120 DRLLISGSPSDRRLFLNLLLSQCDPQYKHTLSYYHRALLQRNSLLKTKQI--STLSVWDE 177

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           Q+A LG  + ++R      L+ L+ +        HI++     L  +   S  ++ EE  
Sbjct: 178 QLATLGAYLTLSRFTCCEQLNQLVQKLWNNSLSEHIRIKFKSSLIKQDKLSKESIIEELR 237

Query: 249 KKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARLIS 308
           K+L      D     T +GPHR D  +   D  ++    S G++  +L  + LA    I 
Sbjct: 238 KQLTSSLHRDLELGSTSVGPHREDFTLMINDLPVS-QFSSEGQKHSLLAILRLAECLYIK 296

Query: 309 NTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           N     P+  +D+I + LD  + + L  +   +G Q  MT T
Sbjct: 297 NIHNVCPLFCMDDIHSGLDNHRISQLLDLAPTLG-QTLMTST 337


>gi|187777364|ref|ZP_02993837.1| hypothetical protein CLOSPO_00920 [Clostridium sporogenes ATCC
           15579]
 gi|187774292|gb|EDU38094.1| hypothetical protein CLOSPO_00920 [Clostridium sporogenes ATCC
           15579]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 168/362 (46%), Gaps = 39/362 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D+ +
Sbjct: 3   IKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +   
Sbjct: 63  WDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W + 
Sbjct: 118 SPEDLRIIKDSPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNWNNK 171

Query: 186 I-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLSLTG 230
           I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    LT 
Sbjct: 172 INDIIDIYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY----LTN 226

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             D  FD +    ++E    L   RK D     T IGPHR D  V   +   T   GS G
Sbjct: 227 IKD--FDNA----EKELLIALKKNRKKDLERNSTSIGPHRDDFEVS-INNIDTRIFGSQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  TG 
Sbjct: 280 QQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQRFVLNSIDKIQTIITCTGI 339

Query: 351 DK 352
           ++
Sbjct: 340 EE 341


>gi|238926600|ref|ZP_04658360.1| possible recombination protein RecF [Selenomonas flueggei ATCC
           43531]
 gi|238885546|gb|EEQ49184.1| possible recombination protein RecF [Selenomonas flueggei ATCC
           43531]
          Length = 377

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/371 (26%), Positives = 161/371 (43%), Gaps = 34/371 (9%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           ++I  L +  +R+Y +L L FD    IF+G N  GKTNI+EA+ + + GR  R +S A++
Sbjct: 1   MQITELTLRSYRSYETLHLAFDPGVQIFLGANAQGKTNIIEALYYAAFGRSHRTSSDAEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+                A I++     D              R ++   + LR   
Sbjct: 61  IRVGADG--------------AHIALSFRRHDVPGALSFTFARGARRRIEYAGESLRQRD 106

Query: 125 LV---------PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT- 174
           LV         P    +  G    RRR+LD  +    P +   ++ + R+++ RN +L  
Sbjct: 107 LVGILPMVLFSPEDLFLVKGAPALRRRYLDAELSQASPAYYGELLRYTRILKQRNAVLKD 166

Query: 175 --EGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFL 232
             E           +AQ+A+    I   R   +  L +L    VQ       +L+L   +
Sbjct: 167 IRERLAAPDDLLPWDAQLAKSAAYIVTRRTSAVAQLGALSAR-VQSVLAAGEELTLVYDI 225

Query: 233 DGKFDQSFCA--LKEE----YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAH 286
            G   +S     + E+    Y K L +GR  D     T +GPH  DL++      +  + 
Sbjct: 226 AGAAPESGAKDDMTEQLYLWYNKMLREGRARDIARAATGVGPHLDDLVLRVGGMNLR-SF 284

Query: 287 GSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIF 346
           GS G+Q+   + + LA    +    G APILLLD++ + LD D+R AL   +     Q F
Sbjct: 285 GSQGQQRTGALALKLAELFYLQENVGEAPILLLDDVMSELDADRRRALLDFIRHENIQTF 344

Query: 347 MTGTDKSVFDS 357
           +T TD + F +
Sbjct: 345 ITATDAAYFPA 355


>gi|104779319|ref|YP_605817.1| recombination protein F [Pseudomonas entomophila L48]
 gi|122985999|sp|Q1IH46|RECF_PSEE4 RecName: Full=DNA replication and repair protein recF
 gi|95108306|emb|CAK13000.1| DNA replication, recombinaison and repair protein [Pseudomonas
           entomophila L48]
          Length = 367

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/349 (26%), Positives = 162/349 (46%), Gaps = 16/349 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + ++ L+++  RN   + L    +  I  G NG GKT++LEA+  L   R FR      V
Sbjct: 1   MSLRRLSVTAVRNLHPVTLSPSPRINILYGANGSGKTSVLEAVHLLGLARSFRSTRLNPV 60

Query: 65  TRIGSPSFFSTFARVEGMEG-LADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            +    +  + F +VE  EG  +++ +  E + + ++R   I+    R   +L + L + 
Sbjct: 61  IQYEQQTC-TVFGQVELAEGGTSNLGVSRERQGEFTIR---IDGQNARSAAQLAEMLPLQ 116

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
            + P   R+  G    RR+FLD  VF ++PR        ++ +R RN  L  G  D+   
Sbjct: 117 LINPDSFRLLEGAPKVRRQFLDWGVFHVEPRFMATWQRLQKALRQRNSWLRHGTLDAVSQ 176

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ + ++     +I+  R   I AL   + E    E      L+L+ +     D+    L
Sbjct: 177 AAWDRELCLASAEIDEYRRNYIKALKP-VFERTLSELVELDGLTLSYYRGWDKDRE---L 232

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDY-CDKAITIAHGSTGEQKVVLVGIFLA 302
            E  A  L   ++M      T  GP R+DL +    + A  I   S G+QK+V+  + +A
Sbjct: 233 NEVLATSLLRDQQMGH----TQAGPQRADLRLRLGANNAADIL--SRGQQKLVVCALRIA 286

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
              L+S       I L+D++ + LDE  R AL R++ ++  Q+F+T  D
Sbjct: 287 QGHLVSQVRRGQCIYLVDDLPSELDEQHRRALCRLLEELNCQVFITCVD 335


>gi|170016362|ref|YP_001727281.1| recombinational DNA repair ATPase (RecF pathway) [Leuconostoc
           citreum KM20]
 gi|226737812|sp|B1MW32|RECF_LEUCK RecName: Full=DNA replication and repair protein recF
 gi|169803219|gb|ACA81837.1| Recombinational DNA repair ATPase (RecF pathway) [Leuconostoc
           citreum KM20]
          Length = 378

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 164/354 (46%), Gaps = 19/354 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNYA+L L F     +F+G+N  GKTN+LE+I  L+  R  R +S  D+
Sbjct: 1   MELTSLKLVNYRNYANLELDFSPGVNVFLGENAQGKTNLLESIYVLALARSHRTSSDKDL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
               +    +   R++       +S+   ++  ++    ++N +    + +    L +  
Sbjct: 61  INWTAKE-TTISGRIKKNISETPLSLHFSSKGKKA----RVNHLEQSKLSQYVGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN----RLLTEGYFDS 180
             P    +  G    RRRF+D     ++P +   +  + R+++ RN    RL  +   D+
Sbjct: 116 FAPEDLELVKGAPSVRRRFIDMEFGQMNPLYLYNITQYRRILKDRNAYLKRLQLKQTKDT 175

Query: 181 SWCSSIEAQMAELGVKINIAR---VEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD 237
            +   +  Q+  +G ++ +AR   V  + A +  I   V  +    + L     +D +  
Sbjct: 176 VFLDVLTDQLVSVGAEVILARQLFVRRLQAAAQPIHAEVSNQR-EQLTLVYQTSIDFEEH 234

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGSTGEQKVV 295
                +K  +A  L   R  + M   T++GPHR DL  IV+  D A+    GS G+Q+  
Sbjct: 235 ADLEQIKATFAATLNRQRTREVMQGSTVVGPHRDDLQFIVNENDVAV---FGSQGQQRTT 291

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
            + I LA   L++  TG  PILLLD++ + LD  ++  L   + D   Q F+T 
Sbjct: 292 ALAIKLAEIDLMAQETGEYPILLLDDVLSELDASRQTHLLLAIQD-KVQTFITA 344


>gi|325689344|gb|EGD31350.1| recombination protein F [Streptococcus sanguinis SK115]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 164/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENDLLVS-GLLEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNTYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L          L
Sbjct: 178 LDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEELTVK---YLSSIPLHQIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLISSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIMS 362


>gi|283469233|emb|CAQ48444.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus ST398]
          Length = 370

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 162/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKETLSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSIDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|302559663|ref|ZP_07312005.1| RecF protein [Streptomyces griseoflavus Tu4000]
 gi|302477281|gb|EFL40374.1| RecF protein [Streptomyces griseoflavus Tu4000]
          Length = 373

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/361 (27%), Positives = 160/361 (44%), Gaps = 27/361 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+Y  + +      T FVG NG GKTN++EA+ +L+     R +S A +
Sbjct: 1   MHVTHLSLADFRSYPRVEVPLGPGVTAFVGPNGQGKTNLVEAVGYLATLGSHRVSSDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R +  +G     ++LE    R+ R        +R  D L   +R   
Sbjct: 61  VRMGA---DRAIVRAQVRQGERQQLVELELNPGRANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY------- 177
             P    +  G   ERRRFLD ++ A  PR      D++R+++ RN LL           
Sbjct: 117 FAPEDLALIKGDPGERRRFLDELITARSPRMAGVRSDYDRVLKQRNTLLKSAALARRHGG 176

Query: 178 --FDSSWCSSIEAQMAELGVKINIARVEMINALSSL---IMEYVQKENFP---HIKLSLT 229
              D S     +  +A  G ++   R+++I AL  L     E +     P     K S  
Sbjct: 177 RTLDLSTLDVWDQHLAHAGAELLARRLDLIGALQPLADKAYEQLAPGGGPLTLEYKPSAP 236

Query: 230 GFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGST 289
           G  D + D     L E+    L + RK +     TL+GPHR DL++    +     + S 
Sbjct: 237 GEADTRED-----LFEQLMAALAEARKQEIERGVTLVGPHRDDLLLK-LGRLPAKGYASH 290

Query: 290 GEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTG 349
           GE     + + LA   L+    G  P+L+LD++ A LD  +R  L  +V   G Q+ +T 
Sbjct: 291 GESWSYALALRLASYDLL-RAEGNEPVLVLDDVFAELDTRRRERLAELVAP-GEQVLVTA 348

Query: 350 T 350
            
Sbjct: 349 A 349


>gi|269118645|ref|YP_003306822.1| DNA replication and repair protein RecF [Sebaldella termitidis ATCC
           33386]
 gi|268612523|gb|ACZ06891.1| DNA replication and repair protein RecF [Sebaldella termitidis ATCC
           33386]
          Length = 362

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/353 (22%), Positives = 168/353 (47%), Gaps = 15/353 (4%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L+++ FR   + ++ FD    +  G NG GKT+++EA+ FL+ G+ FR     ++
Sbjct: 1   MKLKQLSLNNFRCLENKKIEFDPDFNLIYGKNGQGKTSLIEAVYFLATGKSFRTKKVKEL 60

Query: 65  T---RIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLR 121
           T   +I +  + S  +++ G       +I ++  +D+    +  N    + +D +   L 
Sbjct: 61  TSYDKIRTIVYGSFESKLSGK------TIAIDFNNDKKEYYVDKNKT--KYIDYVG-ILN 111

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           +   +P    I  G    RR F +  +      + + ++DFE++++ RN+L+ E   +  
Sbjct: 112 VISFIPEDIEIIIGNPSVRRGFFNYEISQTKNIYLKTLVDFEKILKTRNKLIKERKTNKE 171

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQS 239
                  +  E G KI + R E +  +S L+    +K  +    ++L    F+D     +
Sbjct: 172 LYHIYNEKFIEEGSKIILMRKEYVKNISRLLNLNYRKLFDANSELRLKYDSFIDNIDKMT 231

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              +KE++ ++       +     TL+GP + D + +   K    A  S GE+K ++  +
Sbjct: 232 LEEIKEKFREETVKKHDREKRYGYTLVGPQKEDFVFELNGKNAK-AFSSQGEKKSIIFSL 290

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            +A   ++       P+ L+D+IS++ DE ++N++     +   Q F+T T+K
Sbjct: 291 KIAEIDMLIKEKNEIPVFLIDDISSYFDEIRKNSILNYFKNKNIQCFITSTEK 343


>gi|300780156|ref|ZP_07090012.1| recombination protein F [Corynebacterium genitalium ATCC 33030]
 gi|300534266|gb|EFK55325.1| recombination protein F [Corynebacterium genitalium ATCC 33030]
          Length = 392

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 170/378 (44%), Gaps = 32/378 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++ +FR++  L L  +   T+F G NG GKTNI+EA  + +     R +    + R
Sbjct: 3   LRELDLRDFRSWPELNLALEPGVTVFSGRNGHGKTNIVEAAIYTATLASHRVSQDQPLIR 62

Query: 67  IGSPSFFSTFARVE-GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+ +   +   V  G E    + IK+     R     QIN   ++   E+   LR    
Sbjct: 63  TGANNARISATTVNAGRELTTHLLIKV-----REQNQAQINRTRLKSPREMLGVLRTVVF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------GYF 178
            P    + +G   ERRRFLD +     PR      D+++++R RN LL         GY 
Sbjct: 118 APEDLALVTGEPAERRRFLDTLASIRTPRFGGAKADYDKVLRQRNALLRSSNMALRRGYN 177

Query: 179 DSSWCSSI------EAQMAELGVKINIARVEMINALSSLI---MEYVQKENFP-HIKLSL 228
           D S  +++      +AQ+A  G ++   R  +I+ LS  +      V  E+ P  I+ S 
Sbjct: 178 DDSGAAALSTLDAWDAQLAAFGAQVVAGRRMLIDVLSDPVHNSYSSVAPESRPAAIEYSS 237

Query: 229 T-----GFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSR-RTLIGPHRSDLIVDYCDKAI 282
           T       L G+       L+  + ++L   R+ D + R  TL+GPHR DL++   D+  
Sbjct: 238 TLDKAVAELAGEPSNDPAILEAAFLQELAR-RRRDEIDRGTTLVGPHRDDLLLTLGDQPA 296

Query: 283 TIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIG 342
              + S GE     + + LA   L+S   G  P+L+LD++ A LD  +R  L  +     
Sbjct: 297 K-GYASHGETWSFALALHLAEYALLSE-DGVDPVLILDDVFAELDAKRRERLVAVAQQAE 354

Query: 343 SQIFMTGTDKSVFDSLNE 360
             +        + D+L+E
Sbjct: 355 QVLITAAVGDDLPDNLDE 372


>gi|149375633|ref|ZP_01893402.1| recombination protein F [Marinobacter algicola DG893]
 gi|149360035|gb|EDM48490.1| recombination protein F [Marinobacter algicola DG893]
          Length = 379

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/358 (25%), Positives = 163/358 (45%), Gaps = 18/358 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L    FRN +   + F     +  G NG GKT++LEAI +L  GR FR + +  V   G 
Sbjct: 6   LQSENFRNLSPAPVSFSPSINLLYGANGSGKTSVLEAIGYLGLGRSFRVSRHQAVVSHGQ 65

Query: 70  PSFFSTFARVEGMEGL------ADISIKLETRDDRSVR--CLQINDVVIRVVDELNKHLR 121
                     +GM G        +++ ++    D + +   L+++   +R +  L +HL 
Sbjct: 66  HKLTVFGGLDQGMSGAEQKPSSGELNHRVGISRDVTAKETTLRVDGEAVRNLSSLARHLP 125

Query: 122 ISWLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS 181
           +S + P +  I +G   +RR+FLD  VF ++P         +R+   RN++L  G  D +
Sbjct: 126 VSVIDPGVFDIVAGGPGKRRQFLDWAVFHVEPSFASVWQQCQRVTSQRNQILRNGRIDDA 185

Query: 182 WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIK-LSLTGFLDGKFDQSF 240
                ++Q  EL  ++  AR E     +      + + + P +  L L  ++     QS 
Sbjct: 186 LMKVWDSQYTELAERLTQARNETFRLFTKAFHSLLGEIDAPWVDGLKLDYYVGWDASQSL 245

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             +       L   R+ +     TL GP+R+D+ + Y  + +     S G+QK +++ + 
Sbjct: 246 VEV-------LRSHREQEQKMGHTLYGPNRADIRLRYQGRPVAETF-SRGQQKTLVILMK 297

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSL 358
           +A   ++S+  G     LLD+I+A LD   R  L + + ++  Q+F+T  +    D L
Sbjct: 298 IAQGMVLSD-LGKQVTFLLDDINAELDVVHRAMLAQKLHELRCQVFVTSIEAPRPDEL 354


>gi|168183730|ref|ZP_02618394.1| DNA replication and repair protein RecF [Clostridium botulinum Bf]
 gi|237793324|ref|YP_002860876.1| recombination protein F [Clostridium botulinum Ba4 str. 657]
 gi|259563360|sp|C3KXR0|RECF_CLOB6 RecName: Full=DNA replication and repair protein recF
 gi|182673206|gb|EDT85167.1| DNA replication and repair protein RecF [Clostridium botulinum Bf]
 gi|229261280|gb|ACQ52313.1| DNA replication and repair protein RecF [Clostridium botulinum Ba4
           str. 657]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 167/362 (46%), Gaps = 39/362 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D+ +
Sbjct: 3   IKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +   
Sbjct: 63  WDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W + 
Sbjct: 118 SPEDLRIIKDSPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNWNNK 171

Query: 186 I-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLSLTG 230
           I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    LT 
Sbjct: 172 INDIIDIYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY----LTN 226

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             D  FD +   L   + K     RK D     T IGPHR D  V   +   T   GS G
Sbjct: 227 IKD--FDNAEKELLMFFKK----NRKKDFERNSTSIGPHRDDFEVS-INNIDTRIFGSQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  TG 
Sbjct: 280 QQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQKFVLNSIDKIQTIITCTGI 339

Query: 351 DK 352
           ++
Sbjct: 340 EE 341


>gi|153933867|ref|YP_001382414.1| recombination protein F [Clostridium botulinum A str. ATCC 19397]
 gi|153935303|ref|YP_001385966.1| recombination protein F [Clostridium botulinum A str. Hall]
 gi|168181119|ref|ZP_02615783.1| DNA replication and repair protein RecF [Clostridium botulinum NCTC
           2916]
 gi|226947226|ref|YP_002802317.1| DNA replication and repair protein RecF [Clostridium botulinum A2
           str. Kyoto]
 gi|166220704|sp|A7FPF3|RECF_CLOB1 RecName: Full=DNA replication and repair protein recF
 gi|254790469|sp|C1FPH6|RECF_CLOBJ RecName: Full=DNA replication and repair protein recF
 gi|152929911|gb|ABS35411.1| DNA replication and repair protein RecF [Clostridium botulinum A
           str. ATCC 19397]
 gi|152931217|gb|ABS36716.1| DNA replication and repair protein RecF [Clostridium botulinum A
           str. Hall]
 gi|182668165|gb|EDT80144.1| DNA replication and repair protein RecF [Clostridium botulinum NCTC
           2916]
 gi|226842327|gb|ACO84993.1| DNA replication and repair protein RecF [Clostridium botulinum A2
           str. Kyoto]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 168/362 (46%), Gaps = 39/362 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D+ +
Sbjct: 3   IKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +   
Sbjct: 63  WDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W + 
Sbjct: 118 SPEDLRIIKDSPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNWNNK 171

Query: 186 I-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLSLTG 230
           I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    LT 
Sbjct: 172 INDIIDIYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY----LTN 226

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             D  FD +    ++E    L   RK D     T IGPHR D  V   +   T   GS G
Sbjct: 227 IKD--FDNA----EKELLIVLKKNRKKDLERNSTSIGPHRDDFEVS-INNIDTRIFGSQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  TG 
Sbjct: 280 QQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQKFVLNSIDKIQTIITCTGI 339

Query: 351 DK 352
           ++
Sbjct: 340 EE 341


>gi|322804282|emb|CBZ01832.1| DNA recombination and repair protein RecF [Clostridium botulinum
           H04402 065]
          Length = 364

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 167/362 (46%), Gaps = 39/362 (10%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  FRNY  + L       IFVG+N  GKTNILE+I + S G+  R     D+ +
Sbjct: 3   IKNVHLINFRNYDDMYLELSPNTNIFVGNNAQGKTNILESIYYSSIGKSHRTNKDKDLIK 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
              + ++  T+   E ++   DI+I    +     + + +N + I+ + EL  +L +   
Sbjct: 63  WDKNNTYLRTYVSRERLDKTIDINIFKNGK-----KAITVNKIKIKKISELMGNLNVVMF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P   RI       RR+FLD  +  I+  +   ++ + +++  RN  L       +W + 
Sbjct: 118 SPEDLRIIKDSPGNRRKFLDIELCKINNVYYHDLVQYNKILSERNTAL------KNWNNK 171

Query: 186 I-------EAQMAELGVKINIARVEMINALSSLIMEYVQKE--------NFPHIKLSLTG 230
           I       + Q+++ G  I   R + ++ L ++I + + K+        NF +    LT 
Sbjct: 172 INDIIDVYDEQLSKYGAFIIKERNKYLDKL-NIIGKNIHKKITNDLEDINFRY----LTN 226

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
             D  FD +   L   + K     RK D     T IGPHR D  V   +   T   GS G
Sbjct: 227 IKD--FDNAEKELLMLFKK----NRKKDLERNSTSIGPHRDDFEVS-INNIDTRIFGSQG 279

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+  ++ +  A   +I N  G  P+LLLD++ + LD +++  +   +  I + I  TG 
Sbjct: 280 QQRTAVLTLKFASLEIIKNIIGEYPVLLLDDVLSELDSNRQKFVLNSIDKIQTIITCTGI 339

Query: 351 DK 352
           ++
Sbjct: 340 EE 341


>gi|210624033|ref|ZP_03294150.1| hypothetical protein CLOHIR_02102 [Clostridium hiranonis DSM 13275]
 gi|210153240|gb|EEA84246.1| hypothetical protein CLOHIR_02102 [Clostridium hiranonis DSM 13275]
          Length = 368

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 177/370 (47%), Gaps = 24/370 (6%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  +RNY  L + F+ +  + +G NG GKTNI E+I  L+ G+ FR     ++
Sbjct: 1   MKLKNLQLVNYRNYDKLYIEFNDRINLLLGSNGQGKTNIAESIYLLAFGKSFRTNRDREL 60

Query: 65  TRIGSPSFFSTFA-RVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            +  + + +        G  G+ +I+I       ++ + +++N + I  + EL  ++ + 
Sbjct: 61  IKFNTENLYVGGGYEKNGRNGMVEIAIS------KAKKGIKVNKIPIVKLAELLGNINVV 114

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              P   R+       RR F+DR +  I P +   +  + +++  RN+LL     D +  
Sbjct: 115 IFSPEDLRLVKDGPKIRRSFIDREISQIVPGYYGLLTGYNKILANRNKLLKNMNPDLNLL 174

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYV-----QKENFPHIKLSLTGFLDGKFDQ 238
              +  +A+ G KI + R + I  ++ +  +        KE+   I  S     D     
Sbjct: 175 DVYDESLADYGSKIFMFRKKFIERIAEISKDMHARLTDNKEDLNVIYKSQIQINDE---- 230

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
              ++K+++   L D RK D   R +  G H+ D+++      + + +GS G+Q+   + 
Sbjct: 231 --SSVKDKFINILKDKRKHDLDMRISGYGIHKDDILIQINGLDVRL-YGSQGQQRTASIS 287

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD---KSVF 355
           + L+   LI+   G  P+L+LD++ + LDE ++  L   + D+  Q+F+T  +   K+V 
Sbjct: 288 LKLSEIELINREVGEYPLLILDDVFSELDEKRQKLLVDNLKDV--QMFITTAEYLHKNVL 345

Query: 356 DSLNETAKFM 365
           D  N T  ++
Sbjct: 346 DMNNTTVFYI 355


>gi|167748046|ref|ZP_02420173.1| hypothetical protein ANACAC_02784 [Anaerostipes caccae DSM 14662]
 gi|167652526|gb|EDR96655.1| hypothetical protein ANACAC_02784 [Anaerostipes caccae DSM 14662]
          Length = 361

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/353 (26%), Positives = 164/353 (46%), Gaps = 24/353 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L +  +RNY  L + F +   I  GDN  GKTNILEA+   +  +  R +   ++ R
Sbjct: 3   IQSLELKNYRNYDRLIIEFSSGTNILYGDNAQGKTNILEAVYLGATTKSHRGSKDKEIIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G      +  R+  M+      I +  +  R+ +   I+ + I+   +L   + + +  
Sbjct: 63  FGENE---SHIRIHLMKQDIGHQIDMHLKKSRT-KGAAIDRIPIKRSSDLLGFVPVIFFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I      ERR+FLD  +  ++  +  ++  + R+M  RN LL +  +      ++
Sbjct: 119 PEDLSIIKNGPSERRKFLDIELSQLEKMYLHQLSSYNRVMAQRNNLLKQLAYQRELLDTL 178

Query: 187 EA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDG---KFDQSF 240
           ++   Q+ + G ++   R + I  L+ +I E         I  +LTG  +    K+D S 
Sbjct: 179 DSWDLQLVKYGSEVIRYRQKFIEDLNEIIRE---------IHKNLTGKKEKIVLKYDYSV 229

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI-AHGSTGEQKVVLVGI 299
               +E+   L   R++D     T  GPHR D  +++    I I   GS G+Q+   + +
Sbjct: 230 NY--DEFLTVLQRKREIDLKYASTGAGPHRDD--IEFLVNGIDIRKFGSQGQQRTAALSL 285

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            LA   L+   TG  PILLLD++ + LD  ++N L   + DI + I  TG ++
Sbjct: 286 KLAQIELVKRQTGETPILLLDDVLSELDSSRKNYLLDSIKDIQTLITCTGLEE 338


>gi|295402120|ref|ZP_06812079.1| DNA replication and repair protein RecF [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312109155|ref|YP_003987471.1| DNA replication and repair protein RecF [Geobacillus sp. Y4.1MC1]
 gi|294975803|gb|EFG51422.1| DNA replication and repair protein RecF [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311214256|gb|ADP72860.1| DNA replication and repair protein RecF [Geobacillus sp. Y4.1MC1]
          Length = 374

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 96/379 (25%), Positives = 169/379 (44%), Gaps = 25/379 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  +RNY S  + F     I +G+N  GKTN++EAI  L+  +  R A+  D+ R   
Sbjct: 6   LSLKNYRNYKSETIQFANNVNIILGENAQGKTNMMEAIYVLAMAKSHRTANDKDLIR--- 62

Query: 70  PSFFSTFARVEGMEGLADISIKLE---TRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +   +A++EG       ++ LE   ++  +  +C   N V  + + +   HL I    
Sbjct: 63  --WDEDYAKIEGRATTKSGALSLELIISKKGKKAKC---NHVEQQRLSQYVGHLNIVMFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL----TEGYFDSSW 182
           P    +  G    RRRF+D  +  + P +   +  +++L++ RN  L    T    D + 
Sbjct: 118 PEDLNLVKGSPQVRRRFVDMEIGQVSPVYIHDLSQYQKLLQQRNHYLKMLQTREQQDETV 177

Query: 183 CSSIEAQMAELGVKINIARVE---MINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
              +  Q+  L  KI + R E   ++   ++ I   + +     +++     +D      
Sbjct: 178 LDILTEQLIPLAAKITLKRHEFLLLLEKWAAPIHREISR-GLETLQIQYRPSVDVSERME 236

Query: 240 FCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
              + E Y++K    ++ +     TL GPHR D++     K +    GS G+Q+   + I
Sbjct: 237 LSRIIEAYSEKFATIKEREIQRGMTLAGPHRDDILFSVNGKDVQ-TFGSQGQQRTTALSI 295

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT--DKSVFDS 357
            LA   LI +  G  PILLLD++ + LD+ ++  L   +     Q F+T T  D    D 
Sbjct: 296 KLAEIELIFSEIGDYPILLLDDVLSELDDFRQTHLLDAIRQ-KVQTFVTTTSIDGIEHDI 354

Query: 358 LNETAKFMRISNH--QALC 374
           + E A +   S H    LC
Sbjct: 355 IKEAAIYKVHSGHVTAPLC 373


>gi|19551253|ref|NP_599255.1| recombination protein F [Corynebacterium glutamicum ATCC 13032]
 gi|62388896|ref|YP_224298.1| recombination protein F [Corynebacterium glutamicum ATCC 13032]
 gi|51316227|sp|Q6M8X7|RECF_CORGL RecName: Full=DNA replication and repair protein recF
 gi|21322768|dbj|BAB97397.1| Recombinational DNA repair ATPase [Corynebacterium glutamicum ATCC
           13032]
 gi|41324229|emb|CAF18569.1| DNA REPAIR AND GENETIC RECOMBINATION PROTEIN [Corynebacterium
           glutamicum ATCC 13032]
          Length = 394

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 105/392 (26%), Positives = 176/392 (44%), Gaps = 43/392 (10%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + I+ L + ++R++  L++  +   T+F+G NG GKTNI+EAI +L+     R +S A +
Sbjct: 1   MHIRSLELRDYRSWPELKVDLEPGITVFIGRNGFGKTNIVEAIGYLAHLSSHRVSSDAPL 60

Query: 65  TRIGSPSF-FSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRIS 123
            R  + +   S  A  +G E  A + IK    +  S     +N   +R   EL   ++  
Sbjct: 61  VRAHAENARVSAVAVNQGRELAAHLLIKPHAANQAS-----LNRTKVRTPRELLGVVKTV 115

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT--------- 174
              P    +  G   ERRR+LD ++    PR      D++++++ RN LL          
Sbjct: 116 LFAPEDLALVKGEPAERRRYLDDIIATRQPRMAGVKADYDKVLKQRNALLKTATIALRRG 175

Query: 175 ----EGYFDSSWCSSIEAQMAELGVKINIARVEMINALSSLIME---YVQKENFPH---- 223
               EG    S   + + Q+A LG ++  AR  ++N L   I E    +  E+ P     
Sbjct: 176 YGTEEGAAALSTLDTWDGQLARLGAEVMAARFALLNELGPKIYEAYTTIAPESRPAAVNY 235

Query: 224 ---IKLSLTGFLDGKFDQSF--CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYC 278
              I   L+ F   +FD       L  E A K    R+ +     +L+GPHR D+ +   
Sbjct: 236 KTTIDQGLSQF--SEFDAGIIEATLLTELAAK----RQREIERGSSLVGPHRDDVDLMLG 289

Query: 279 DKAITIAHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIV 338
           D+       S GE     + + +A   L+  + G  PIL+LD++ + LD  +R  L  I 
Sbjct: 290 DQPAK-GFASHGETWSFALSLRIAEFNLL-KSDGTDPILILDDVFSELDAGRREKLVGIA 347

Query: 339 TDIGSQIFMTGTDKSVFDSLNETAKFMRISNH 370
            ++  Q+ +T    +V D L E  K +  + H
Sbjct: 348 QEV-EQVLITA---AVHDDLPENLKKVLTAQH 375


>gi|262193329|ref|YP_003264538.1| DNA replication and repair protein RecF [Haliangium ochraceum DSM
           14365]
 gi|262076676|gb|ACY12645.1| DNA replication and repair protein RecF [Haliangium ochraceum DSM
           14365]
          Length = 382

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 95/362 (26%), Positives = 162/362 (44%), Gaps = 26/362 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L +   RN A L L    +  +F GDNG GKTN+LE I  +   R FR    A++  
Sbjct: 3   VRALKLEGIRNLAPLTLTPGPRFNVFHGDNGQGKTNLLETIYVVGALRSFRTQRLAELIA 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                 +   AR++   GL  +   ++ +  R VR   ++   +R + +      +    
Sbjct: 63  FERDRAY-IGARIQ-RGGLERVYELVQRQRGRQVR---LDGKAVRPISKYFGDFNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-GYFDSS---- 181
           P   ++  G   ERRRFLDR VF   PR+   +  ++++++ RN LL E G    S    
Sbjct: 118 PEDLQVPRGSPAERRRFLDRAVFNRSPRYLGEVQAYDKVVKNRNALLRELGSGKRSLRQA 177

Query: 182 --WCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
             + +  + Q+AELG  +   RV  ++ +     E  Q  +  H  L++        D +
Sbjct: 178 GDFLAVFDQQLAELGALLMRYRVHFLDEIRPRFQEAFQ--SITHTGLAVDVSYASAVDIT 235

Query: 240 FCA-----------LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
             +           L    A  + + R  D     + +GPHR DL+ +  D     A  S
Sbjct: 236 QASDSAESGPGSEQLTRALAAAIAERRPRDLARGSSSVGPHRDDLVFE-LDGHPAAAFAS 294

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            G+ + +++    A  +L+++T G  P+LLLD++S+ LD  +   LF  +     Q F+T
Sbjct: 295 QGQLRALVLAWKTAEMQLLAHTHGEEPVLLLDDVSSELDATRNGYLFEFLKARRGQCFIT 354

Query: 349 GT 350
            T
Sbjct: 355 TT 356


>gi|157959833|ref|YP_001499867.1| recombination protein F [Shewanella pealeana ATCC 700345]
 gi|189039643|sp|A8GYE5|RECF_SHEPA RecName: Full=DNA replication and repair protein recF
 gi|157844833|gb|ABV85332.1| DNA replication and repair protein RecF [Shewanella pealeana ATCC
           700345]
          Length = 360

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 103/355 (29%), Positives = 167/355 (47%), Gaps = 25/355 (7%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L+I  FRN +S +L       +  G NG GKT+ILEAI FL  GR FR      V +   
Sbjct: 6   LHIESFRNISSAQLQPGDGLNLIYGHNGSGKTSILEAIYFLGMGRSFRSHLSQRVIK-ND 64

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVP-S 128
               + FA +E  +  + I ++     D  V+   IN   ++ +  L + L I  + P S
Sbjct: 65  DDALTLFANMESGDEQSKIGLRRFRSGDIEVK---INGDKVKRLSTLAETLPIQVITPES 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSS---WCSS 185
              +F G    RR+F+D   F  DPR     ++  R+++ RN+LL +G   SS   W   
Sbjct: 122 FSLLFEG-PKSRRQFIDWGAFHSDPRFYAAWVNVRRILKQRNQLLRDGSPYSSIQFWDKE 180

Query: 186 IEAQMAELGVKINIARVEMINA-LSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALK 244
              + AEL   I    V+ +N  L  +I E++ + +   +K+S T   D          K
Sbjct: 181 F-IRYAELVTDIRKQYVDSLNELLKGIIGEFLPQVD---VKVSFTRGWDA---------K 227

Query: 245 EEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
            EYA+ L      D  +  T+ GPH++DL +         A  S G+ K+++  + +A  
Sbjct: 228 TEYAQLLETQYPRDLATGYTVSGPHKADLRLRVGTLPAQDAL-SRGQLKLLVCALRIAQG 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK-SVFDSL 358
           +L+        I L+D++ + LD   R  L + + D G+Q+F+T  +  ++ DSL
Sbjct: 287 KLLKQQIDKKSIYLVDDLPSELDAKHRKLLLQQLADTGAQVFVTAIEPAAIVDSL 341


>gi|332365084|gb|EGJ42849.1| recombination protein F [Streptococcus sanguinis SK355]
          Length = 364

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 163/372 (43%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENELLVS-GILEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHILKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L          L
Sbjct: 178 LDEQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEELTVK---YLSSIPLHQIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYCSSLLSSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD  ++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNKRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIIS 362


>gi|253730403|ref|ZP_04864568.1| recombination protein F [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253725883|gb|EES94612.1| recombination protein F [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 370

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 162/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  P+LLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPVLLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSVDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|251794040|ref|YP_003008771.1| DNA replication and repair protein RecF [Paenibacillus sp. JDR-2]
 gi|247541666|gb|ACS98684.1| DNA replication and repair protein RecF [Paenibacillus sp. JDR-2]
          Length = 369

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 94/350 (26%), Positives = 155/350 (44%), Gaps = 14/350 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K + +  +RNY  L LV D +  +FVG N  GKTN+LEAI  L+  +  R +   D   
Sbjct: 3   LKSIQLQNYRNYKELELVTDNKVNLFVGPNAQGKTNLLEAIFALALTKSHRTSK--DKEL 60

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           IG   + +  AR+ G       ++KL+       +  +IN +  R + +    L +    
Sbjct: 61  IG---WEADSARIHGEVEKRYGTLKLDLMYSSQGKKAKINGLEQRKLSDFIGSLNVVMFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I  G    RRRFLD  +  + P +   +  + +++  RN  L       S  + +
Sbjct: 118 PEDLEIVKGTPGIRRRFLDMEIGQVQPGYLHTLTQYTKVLAQRNNYLKTATPGGSQQAML 177

Query: 187 E---AQMAELGVKINIARVEMINALSSLIMEYVQK---ENFPHIKLSLTGFLDGKFDQSF 240
           E    Q+AE GVKI   R   I+ L     E++          + +      DG   +  
Sbjct: 178 EIWNMQLAEHGVKIMKKRKHFIHKLQRW-AEHIHSGITAGGERLTIEYRPSFDGGASEDE 236

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
             L E++  KL   +  +     +L+GPHR D+      K   + +GS G+Q+   + + 
Sbjct: 237 TVLFEQFMLKLSQVKDQEIRRGMSLVGPHRDDMAFFINGKEAAV-YGSQGQQRTTALSLK 295

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           LA   LI    G  P+LLLD++ + LD++++  L         Q F+T T
Sbjct: 296 LAEIELICEEIGEYPLLLLDDVLSELDQNRQTQLIETFQS-KVQTFITTT 344


>gi|322515803|ref|ZP_08068748.1| recombination protein F [Streptococcus vestibularis ATCC 49124]
 gi|322125765|gb|EFX97083.1| recombination protein F [Streptococcus vestibularis ATCC 49124]
          Length = 366

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/344 (25%), Positives = 155/344 (45%), Gaps = 14/344 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++I  FRNY    + F     IF+G N  GKTNILEAI FL+  R  R  S  ++ +   
Sbjct: 6   IDIQHFRNYTEASVSFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTRSDKELIQ--- 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F     ++ G+       + LE       R  ++N +    + +   H+ +    P  
Sbjct: 63  --FQQNTLKLNGIVHRHSGKLPLEISLSNKGRITKVNHLKQAKLSDYIGHMTVVLFAPED 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   +  +  +++ RN  L +    D ++ S ++ 
Sbjct: 121 LQLVKGSPSLRRKFIDIDLGQIKPVYLSDLSSYNHVLKQRNAYLKSTDNVDINFLSVLDE 180

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           Q+++ G ++   R+E I  L      +          +K+S    +     ++   ++E 
Sbjct: 181 QLSDFGTRVIEHRLEFIKQLEEEADRHHSNLSNQIERLKISYESNIPL---ENNNGIRES 237

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           +   L    K D   + T IGPHR DL     D  +  + GS G+Q+ +++ + +A   L
Sbjct: 238 FLTTLKQNHKRDIFKKNTGIGPHRDDLTFYIND--MNASFGSQGQQRSLILSLKMAEIAL 295

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           I   TG  PILLLD++ + LD  ++  L   + D   Q FMT T
Sbjct: 296 IKKVTGEFPILLLDDVMSELDNHRQLKLLESI-DEEVQTFMTTT 338


>gi|332363594|gb|EGJ41375.1| recombination protein F [Streptococcus sanguinis SK1059]
          Length = 364

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 164/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTENDLLVS-GILEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVLKQRNSYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L          L
Sbjct: 178 LDEQLVDYGCRVIKHRLDFLQKLESFAQDKHWDISQNLEKLTVK---YLSSIPLHQIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLISSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIMS 362


>gi|228478114|ref|ZP_04062725.1| DNA replication and repair protein RecF [Streptococcus salivarius
           SK126]
 gi|228250294|gb|EEK09547.1| DNA replication and repair protein RecF [Streptococcus salivarius
           SK126]
          Length = 366

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/363 (25%), Positives = 162/363 (44%), Gaps = 14/363 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++I  FRNY    + F     IF+G N  GKTNILEAI FL+  R  R  S  ++ +   
Sbjct: 6   IDIQHFRNYTETSVSFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTRSDKELIQ--- 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F     ++ G+       + LE       R  ++N +    + +   H+ +    P  
Sbjct: 63  --FQQNTLKLNGIVHRHSGKLPLEISLSNKGRITKVNHLKQAKLSDYIGHMTVVLFAPED 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   +  +  +++ RN  L +    D ++ S ++ 
Sbjct: 121 LQLVKGSPSLRRKFIDIDLGQIKPVYLSDLSSYNHVLKQRNAYLKSTDNVDINFLSVLDE 180

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           Q+++ G ++   R+E I  L      +          +K+S    +  + ++    ++E 
Sbjct: 181 QLSDFGARVIEHRLEFIKQLEEEADRHHSNLSNQIERLKISYESNIPLENNK---VIRES 237

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           +   L    K D   + T +GPHR DL     D  +  + GS G+Q+ +++ + +A   L
Sbjct: 238 FLTTLKQNHKRDIFKKNTGVGPHRDDLTFYIND--MNASFGSQGQQRSLILSLKMAEIAL 295

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
           I   TG  PILLLD++ + LD  ++  L   + D   Q FMT T      +L    K   
Sbjct: 296 IKKVTGEFPILLLDDVMSELDNHRQLKLLESI-DEEVQTFMTTTSLDHLSNLPSDLKTFL 354

Query: 367 ISN 369
           ++N
Sbjct: 355 VNN 357


>gi|227502244|ref|ZP_03932293.1| recombination protein F [Corynebacterium accolens ATCC 49725]
 gi|227077068|gb|EEI15031.1| recombination protein F [Corynebacterium accolens ATCC 49725]
          Length = 396

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 96/376 (25%), Positives = 171/376 (45%), Gaps = 29/376 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L++ +FR++  L+L      T+FVG NG GKTNI+EA+ + +     R +  + + R
Sbjct: 3   IRDLDVRDFRSWPELKLELGPGITLFVGRNGFGKTNIVEAVGYTAHLSSHRVSHDSPLVR 62

Query: 67  IGSPSFFSTFARV-EGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+ S   +   V +G E    + I+       +    QIN   +R   EL   ++    
Sbjct: 63  QGAQSARVSLTAVNQGRELTTHLLIQ-----PHAANQAQINRTRLRSPRELLGVVKTVLF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE-------GYF 178
            P    +  G    RR +LD ++ +  PR      D++++++ RN LL         GY 
Sbjct: 118 SPEDLALVRGEPAGRRAYLDSIIASRTPRLAGVKADYDKVLKQRNALLKSASASLRRGYG 177

Query: 179 DSSWCSSI------EAQMAELGVKINIARVEMINALSSLIMEY---VQKENFP-HIKLSL 228
           DS   S++      +AQ+A LG ++  AR+ +++AL   I      +  E+ P H++   
Sbjct: 178 DSDGASALSTLDTWDAQLARLGAQVIAARLALVDALLDHIPAAYAGLAPESRPAHVEYKS 237

Query: 229 TGFLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
           T  +D    +   A+      +L   R+ +     +L+GPHR DL++   D+       S
Sbjct: 238 T--IDTSDREVLEAV---MLTELASARQREIERGISLVGPHRDDLVLHLGDQPAK-GFAS 291

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            GE     + + LA   L+    G  P+L+LD++ A LD  +R  L  +       +   
Sbjct: 292 HGETWSYAIALRLAEFELLREEGGSDPVLILDDVFAELDAKRRTQLVHLAATAEQVLITA 351

Query: 349 GTDKSVFDSLNETAKF 364
             D+ + D+L    ++
Sbjct: 352 AVDEDLPDNLEPIVRY 367


>gi|312864128|ref|ZP_07724363.1| DNA replication and repair protein RecF [Streptococcus vestibularis
           F0396]
 gi|311100360|gb|EFQ58568.1| DNA replication and repair protein RecF [Streptococcus vestibularis
           F0396]
          Length = 366

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/346 (25%), Positives = 157/346 (45%), Gaps = 18/346 (5%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           ++I  FRNY    + F     IF+G N  GKTNILEAI FL+  R  R  S  ++ +   
Sbjct: 6   IDIQHFRNYTEASVSFSPHLNIFLGRNAQGKTNILEAIYFLALTRSHRTRSDKELIQ--- 62

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             F     ++ G+       + LE       R  ++N +    + +   H+ +    P  
Sbjct: 63  --FQQNTLKLNGIVHRHSGKLPLEISLSNKGRITKVNHLKQAKLSDYIGHMTVILFAPEN 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   +  +  +++ RN  L +    D ++ S ++ 
Sbjct: 121 LQLVKGSPSLRRKFIDIDLGQIKPVYLSDLSSYNHVLKQRNAYLKSTDNVDINFLSVLDE 180

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           Q+++ G ++   R+E I  L      +          +K+S    +  + +     ++E 
Sbjct: 181 QLSDFGTRVIEHRLEFIKQLEEEADRHHSNLSNQIERLKISYESNIPLENNN---VIRES 237

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           +   L    K D   + T +GPHR DL     D  +  + GS G+Q+ +++ + +A   L
Sbjct: 238 FLTTLKQNHKRDIFKKNTGVGPHRDDLTFYIND--MNASFGSQGQQRSLILSLKMAEIAL 295

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGS--QIFMTGT 350
           I   TG  PILLLD++ + LD  ++    +++  IG   Q FMT T
Sbjct: 296 IKKVTGEFPILLLDDVMSELDNHRQ---LKLLESIGEEVQTFMTTT 338


>gi|332364154|gb|EGJ41931.1| recombination protein F [Streptococcus sanguinis SK49]
          Length = 364

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 165/372 (44%), Gaps = 16/372 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY    + F     +F+G N  GKTNILEA+ FL+  R  R  S  D+  
Sbjct: 3   LQSLKIKHFRNYQEADIDFHPGLNVFLGQNAQGKTNILEAVYFLALTRSHRTRSDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   +   +E   G   + I L  +     R  ++N +    + +    + +    
Sbjct: 63  FTDNDLLVS-GILEKKTGKVPLDINLTPKG----RITKVNHLKQSKLSDYIGTMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ + 
Sbjct: 118 PEDLQLIKGSPSLRRKFIDIELGQIKPVYLSDLSNYNHVIKQRNAYLKANDKVDETFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIME--YVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+ + G ++   R++ +  L S   +  +   +N   + +    +L     Q    L
Sbjct: 178 LDDQLVDYGCRVIRHRLDFLQKLESFAQDKHWDISQNLEKLTVK---YLSSIPLQKIDNL 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E Y   L   RK D   + T +GPHR D  + +    +    GS G+ + +++ + LA 
Sbjct: 235 EETYRSSLISSRKRDLFKKNTGVGPHRDD--IAFFINQMDANFGSQGQHRSLVLSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVT-DIGSQIFMTGTDKSVFDSLNETA 362
            +LI + T   PILLLD++ + LD +++  L   ++ DI  Q F+T T      +L +  
Sbjct: 293 IKLIESITKETPILLLDDVMSELDNNRQLKLLETISQDI--QTFITTTTLEHLKNLPQDI 350

Query: 363 KFMRISNHQALC 374
           K   I   Q + 
Sbjct: 351 KIFTIQQGQIVS 362


>gi|285815731|gb|ADC36218.1| DNA recombination and repair protein RecF [Staphylococcus aureus
           04-02981]
          Length = 370

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 162/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEVLSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSVDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|330685260|gb|EGG96921.1| DNA replication and repair protein RecF [Staphylococcus epidermidis
           VCU121]
          Length = 371

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 93/379 (24%), Positives = 167/379 (44%), Gaps = 29/379 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + +    +  I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYEQVTIDCHPEVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FDSEYAKIEGDLNYRHGTMPLTMFITKRGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    I  G  + RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPLIRRRFIDMELGQISAVYLNDLSQYQRILKQKNNYLKQLQIGNKTDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q AE  +K+ + R   I  L  L            E +  +  P +KLS   
Sbjct: 176 TMLEVLNQQFAEYALKVTLRREHFIKELEQLAQPIHAGITNEREQLALKYLPSLKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                 DQ+   + EE    L D  + +      L GPHR DL  +  +      +GS G
Sbjct: 233 ----HQDQTESEMLEEILTLLNDNLQREKDRGVCLFGPHRDDLGFN-VNGMDAQTYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRIS 368
                D  +   AK  RI+
Sbjct: 347 SVDGIDHEIMNNAKLYRIN 365


>gi|212637853|ref|YP_002314373.1| recombination protein F [Anoxybacillus flavithermus WK1]
 gi|212559333|gb|ACJ32388.1| Recombinational DNA repair ATPase RecF [Anoxybacillus flavithermus
           WK1]
          Length = 379

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 156/348 (44%), Gaps = 15/348 (4%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  +RNY      F  +  + +G+N  GKTNI+E+I  LS  +  R  +  D+ R   
Sbjct: 14  LTLKNYRNYEQGCWQFQNKVNVILGENAQGKTNIMESIYVLSMAKSHRTTNDKDLIR--- 70

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
             +   +A++EG  G  + SI L+    +  +  ++N +    +     H+ +    P  
Sbjct: 71  --WDEDYAKIEGKVGKKNGSIFLQLTVSKKGKKAKLNHIEQAKLSRYVGHMNVVMFAPED 128

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL----TEGYFDSSWCSS 185
             +  G    RRRF+D  +  + P +   +  ++++++ RN+ L    ++   D ++   
Sbjct: 129 LNLVKGSPQIRRRFIDMEIGQVSPVYMHELGQYQKVLQQRNQYLKLLQSKKQTDETFLDV 188

Query: 186 IEAQMAELGVKINIARVEMINALSSL---IMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +  Q+ EL  KI + R E I  L +    I   + + N   + +     +     Q +  
Sbjct: 189 LTEQLVELAAKITLKRYEFIELLQTWAKPIHAEISRGN-EQLAIHYCPSVHVLDKQQWSR 247

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
           + E Y  K    +  +     TLIGPHR DL      K +    GS G+Q+   + + LA
Sbjct: 248 IVEVYNDKFARIKTKEIERGTTLIGPHRDDLSFTINGKDVQ-TFGSQGQQRTTALSLKLA 306

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
              LI +  G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 307 EIDLIFSEIGEYPILLLDDVLSELDDFRQTHLLNAIQG-KVQTFVTTT 353


>gi|307710347|ref|ZP_07646788.1| DNA replication and repair protein recF [Streptococcus mitis SK564]
 gi|307618939|gb|EFN98074.1| DNA replication and repair protein recF [Streptococcus mitis SK564]
          Length = 363

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/372 (23%), Positives = 165/372 (44%), Gaps = 26/372 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      SI LE    +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFP--------HIKLSLTGFLDGKFD 237
           ++ Q+   G ++   R++ I  L S    + +K++F          I    +  L  K D
Sbjct: 178 LDDQLVNYGCRVMNHRLDFIKKLES----FGRKKHFELSNQIEELSISYQSSVKLTDKED 233

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
                L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++
Sbjct: 234 -----LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVL 286

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
            I LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +
Sbjct: 287 SIKLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISH-SIQTFITTTSLDHLQN 345

Query: 358 LNETAKFMRISN 369
           L E      I +
Sbjct: 346 LPENLSIFTIQD 357


>gi|262200049|ref|YP_003271257.1| DNA replication and repair protein RecF [Gordonia bronchialis DSM
           43247]
 gi|262083396|gb|ACY19364.1| DNA replication and repair protein RecF [Gordonia bronchialis DSM
           43247]
          Length = 397

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 162/364 (44%), Gaps = 32/364 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++ +FR++ +  L   A+ T+F G NG GKTNILEA+ +L+  R  R ++ A +  
Sbjct: 3   VRELHLRDFRSWRTADLELAAEPTVFTGRNGFGKTNILEALQYLATLRSHRVSTDAPLVH 62

Query: 67  IGSPSFFSTFARVE--GMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            G+ S   T A VE  G E  A + I  E  +  S     IN+   R   E+   LR   
Sbjct: 63  SGATSALVT-ATVENSGRELTAQLRINAEGANKAS-----INNGPPRRAREVIGILRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT-------EGY 177
             P    +  G   +RRRF+D +V    P H     D++R++R R  LL         G 
Sbjct: 117 FAPEDLSLVRGDPTDRRRFIDELVAQRGPLHVAARSDYDRVLRQRAALLKTAGAAMRRGG 176

Query: 178 FDSSWCSSI----EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD 233
            D++   S     +AQ+AE G  +  ARV+++N L   + E       PH + +   +L 
Sbjct: 177 GDAASVISTLDVWDAQLAEHGAAVTAARVDVLNELRPHVTE-AYASIAPHSRPTDLAYLP 235

Query: 234 GKFDQ---------SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITI 284
                            A+ E    +L   R  +      L+GPHR D+ +   D  I  
Sbjct: 236 AAGPDVLPPAGARADVAAIGETLLAQLAQVRTKEIERGVCLVGPHRDDVGIILGDD-IAK 294

Query: 285 AHGSTGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQ 344
              S GE   + + + L    L +   G  P+++LD++ A LD  +R  L    +D   Q
Sbjct: 295 GFASHGESWSLALALRLGSVAL-TRAEGVEPVIMLDDVFAELDATRRRKLATFTSD-AEQ 352

Query: 345 IFMT 348
           + +T
Sbjct: 353 LLVT 356


>gi|322377917|ref|ZP_08052405.1| DNA replication and repair protein RecF [Streptococcus sp. M334]
 gi|321281093|gb|EFX58105.1| DNA replication and repair protein RecF [Streptococcus sp. M334]
          Length = 365

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/377 (23%), Positives = 169/377 (44%), Gaps = 26/377 (6%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ +++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FLS  R  R  +  ++  
Sbjct: 3   LQHISLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLSLTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                       + G+      S+ LE +  +  R  ++N +    + +   H+ +    
Sbjct: 63  FDEEQL-----HLSGLVQKKTGSVPLEIKLTQKGRVTKVNHLKQARLSDYVGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSTQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFP--------HIKLSLTGFLDGKFD 237
           ++ Q+ + G ++   R++ I  L +    + +K++F          I    +  +  K D
Sbjct: 178 LDEQLVDYGCRVMNHRLDFIKKLEA----FGRKKHFELSNQIEELSISYQSSVKITDKED 233

Query: 238 QSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLV 297
                L E +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++
Sbjct: 234 -----LSESFKIALEKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVL 286

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
            I LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +
Sbjct: 287 SIKLAEIELMESITTESPILLLDDVMSELDNTRQLKLLETISH-SIQTFITTTSLDHLQN 345

Query: 358 LNETAKFMRISNHQALC 374
           L E      I   Q + 
Sbjct: 346 LPENLSIFTIQGGQVVV 362


>gi|309388285|gb|ADO76165.1| DNA replication and repair protein RecF [Halanaerobium praevalens
           DSM 2228]
          Length = 374

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 164/352 (46%), Gaps = 30/352 (8%)

Query: 15  FRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFS 74
           FRN+  L L  +    IF+G NG GKTN LE+I  ++     R +  +++          
Sbjct: 11  FRNFKELMLDLNPNLNIFLGANGQGKTNFLESIYLMATANSHRSSISSEMINWQQNKSLV 70

Query: 75  TFA--RVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRI 132
                R EG        IKL  R +++ + ++IND  +  V EL  +L      P   ++
Sbjct: 71  QLLLRRREG-------KIKLAMRLEKNNKQVEINDNPLDKVKELFGYLNAVLFSPEDLKL 123

Query: 133 FSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFDSSWCSSI-EA 188
                  RR F+D  +  + P +   +  ++ L+  RN+LL    EG   +     + + 
Sbjct: 124 IKEGPSHRREFIDLEISQVSPYYNHLLSKYDHLLSQRNKLLKSIREGKSKNREMLPVWDE 183

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKEEYA 248
           Q+A +G KI + R+E+IN L   I+  + +      + +L    D   +     + E   
Sbjct: 184 QLATIGTKIILKRIEVINKLK--ILARLSQRKITEGRENLELEYDTSLNHFSPKMGEAEL 241

Query: 249 KKLFDGRKMDSM-SRR--------TLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           + LF    +DS+ S+R        T+IGPHR D+I+   +  +   +GS G+Q+   + +
Sbjct: 242 RNLF----IDSLISKRDQEISRGYTVIGPHRDDIILRVNEMNLR-KYGSQGQQRTAALAL 296

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
            LA    + + TG  P+LLLD++ + LD  +R AL  I+ D   Q  +T TD
Sbjct: 297 KLAELEFMKSETGEYPVLLLDDVFSELDGLRRKALINIIAD-KIQTIITATD 347


>gi|77407728|ref|ZP_00784483.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           COH1]
 gi|77173727|gb|EAO76841.1| DNA replication and repair protein RecF [Streptococcus agalactiae
           COH1]
          Length = 369

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 165/366 (45%), Gaps = 14/366 (3%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           IK +++  +RNY   ++ F     IF+G N  GKTN LEAI FL+  R  R  S  ++  
Sbjct: 3   IKNISLKHYRNYEEAQVDFSPNLNIFIGRNAQGKTNFLEAIYFLALTRSHRTRSDKELVH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
                   T   V    G  ++ I+L  +     R  ++N +    + +    + +    
Sbjct: 63  FKHHDVQIT-GEVIRKSGHLNLDIQLSEKG----RITKVNHLKQAKLSDYIGAMTVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+FLD  +  I   +   + ++  +++ RN  L T    D ++ + 
Sbjct: 118 PEDLQLVKGAPSLRRKFLDIDIGQIKSTYLAELSNYNHVLKQRNTYLKTTNNVDKTFLTV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLI--MEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           ++ Q+A+ G ++   R + I AL+       Y+      H+ +     ++   D+S  ++
Sbjct: 178 LDEQLADYGSRVIEHRFDFIQALNDEADKHHYIISTELEHLSIHYKSSIEFT-DKS--SI 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
           +E +  +L      D   + T IGPHR D+     D  I    GS G+Q+ +++ + LA 
Sbjct: 235 REHFLNQLSKSHSRDIFKKNTSIGPHRDDITFFIND--INATFGSQGQQRSLILSLKLAE 292

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
             LI   T   PILLLD++ + LD  ++  L   + +   Q F+T T      +L +  K
Sbjct: 293 IELIKTVTNDYPILLLDDVMSELDNHRQLKLLEGIKE-NVQTFITTTSLEHLSALPDQLK 351

Query: 364 FMRISN 369
              +S+
Sbjct: 352 IFNVSD 357


>gi|332654822|ref|ZP_08420564.1| DNA replication and repair protein RecF [Ruminococcaceae bacterium
           D16]
 gi|332516165|gb|EGJ45773.1| DNA replication and repair protein RecF [Ruminococcaceae bacterium
           D16]
          Length = 372

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 92/377 (24%), Positives = 166/377 (44%), Gaps = 33/377 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  FRNYA +   F  +  +  GDN  GKTN+LEAI++LS  R  R     ++
Sbjct: 1   MKLNRLELDFFRNYAHVEATFHPRVNLIYGDNAQGKTNLLEAIAYLSSARSHRARYDREL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRIS 123
             +  P  +     ++G     + +  LE +  R   R L  N + ++   EL   L   
Sbjct: 61  IMLNEPQGY-----IKGEVDSRERTFILEAKLCRGKTRQLWSNGLRLKTAGELAGILTTV 115

Query: 124 WLVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
              P    +    +  RRRFLD  +  + PR+ + + ++ RL   + R+L +   + S  
Sbjct: 116 LFCPEDLYLIREGAAARRRFLDGAICQLRPRYAQALAEYNRLYEHKTRILRDWQENPSLL 175

Query: 184 SSIE---AQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD--GKFDQ 238
            +++    +MA+ G +I   R   +  L          E  P I    +G  +  G   +
Sbjct: 176 DTLDDFNLRMAQFGARIIHYRAHFVRRLG---------EQAPAIHADFSGGREQLGLRYE 226

Query: 239 SFCALKEEYA--KKLFDG--------RKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
           +   +++     + +F+         R+ +  SR+ L GPH+ DL+V+  D       GS
Sbjct: 227 TVSTVQDPLGSVQDIFESLMRHQESHRRAELDSRQCLSGPHKDDLVVE-LDGQSAKQFGS 285

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            G+ +   + + LA   +    TG  P+LLLD++ + LD  +++ +   +   G Q+F+T
Sbjct: 286 QGQTRTAALSLKLAQREIFQQETGEWPVLLLDDVLSELDGKRQSFVLNRIQ--GGQVFIT 343

Query: 349 GTDKSVFDSLNETAKFM 365
             +    D L     F 
Sbjct: 344 CCEPEKLDGLERGKSFQ 360


>gi|329732499|gb|EGG68849.1| DNA replication and repair protein RecF [Staphylococcus aureus
           subsp. aureus 21193]
          Length = 370

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 162/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   H+ +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHINVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSVDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|312142412|ref|YP_003993858.1| DNA replication and repair protein RecF [Halanaerobium sp.
           'sapolanicus']
 gi|311903063|gb|ADQ13504.1| DNA replication and repair protein RecF [Halanaerobium sp.
           'sapolanicus']
          Length = 373

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 95/348 (27%), Positives = 168/348 (48%), Gaps = 22/348 (6%)

Query: 15  FRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGSPSFFS 74
           FRN+  + L  ++   IF+GDNG GKTN+LEAI  ++     R +  +++          
Sbjct: 11  FRNFDEIILDLNSNLNIFLGDNGQGKTNLLEAIYIMATTNSHRSSVCSELINWKKEEALI 70

Query: 75  TFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSMDRIFS 134
               +E  EG    +IKL  R D+  R +++ND  +  V E+  +L      P   ++  
Sbjct: 71  QLL-LERREG----NIKLAMRLDKGGRRVELNDNPLDKVKEMVGYLNAVLFSPEDLKLVK 125

Query: 135 GLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLT---EGYFDSSWCSSI-EAQM 190
                RR F++  +  +   +   +  ++ +++ RN LL    +G   S    SI + Q+
Sbjct: 126 EGPSHRREFINLEISQVSRYYNHLLSKYDHILKQRNNLLKSIRDGKKSSENMLSIWDEQL 185

Query: 191 AELGVKINIARVEMINALSSL-------IMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           + +G KI + R+E+++ L  L       I E  ++    +  +SL GF +   +     L
Sbjct: 186 STIGAKIILKRIEVVDKLKILARLSQRQITEGKEELEIEY-DISLDGFSEKMGEAELRGL 244

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
              + K L + R+ +     T+IGPHR DLI+   +  +   +GS G+Q+   + + LA 
Sbjct: 245 ---FNKNLKEKREQEINRGYTVIGPHRDDLILKINEMDLR-KYGSQGQQRTAALALKLAE 300

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTD 351
              + + TG  P+LLLD++ + LD  +R AL  I+ +   Q  +T TD
Sbjct: 301 LEFMKSETGEYPVLLLDDVFSELDSLRRKALINIIAN-KIQTIITATD 347


>gi|126172260|ref|YP_001048409.1| recombination protein F [Shewanella baltica OS155]
 gi|160873129|ref|YP_001552445.1| recombination protein F [Shewanella baltica OS195]
 gi|166221862|sp|A3CYH7|RECF_SHEB5 RecName: Full=DNA replication and repair protein recF
 gi|189039641|sp|A9KU74|RECF_SHEB9 RecName: Full=DNA replication and repair protein recF
 gi|125995465|gb|ABN59540.1| DNA replication and repair protein RecF [Shewanella baltica OS155]
 gi|160858651|gb|ABX47185.1| DNA replication and repair protein RecF [Shewanella baltica OS195]
 gi|315265354|gb|ADT92207.1| DNA replication and repair protein RecF [Shewanella baltica OS678]
          Length = 360

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 168/362 (46%), Gaps = 25/362 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           LNI  FRN  S +L+      +  G NG GKT+ILEAI FL  GR FR      V     
Sbjct: 6   LNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVIN-ND 64

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVP-S 128
               + FA +    G + I ++     +  VR   I+   ++ +  L + L I  + P S
Sbjct: 65  DDKLTLFATLNLARGDSKIGLRRFRSGETEVR---IDGEKVKRLSTLAETLPIQVITPES 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG--YFDSSWCSSI 186
              +F G    RR+F+D   F  DP+      +  R+++ RN+LL  G  Y +  +    
Sbjct: 122 FSLLFEG-PKSRRQFIDWGAFHADPQFYGAWTNVRRVLKQRNQLLRNGSAYSNIQFWDQE 180

Query: 187 EAQMAELGVKINIARVEMINA-LSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
             + AE   +I    V+ +N  L  +I E++   +   +K+S T   D K D  F  L E
Sbjct: 181 FVRYAEQVTEIRNHYVDSLNELLKGIIGEFLPSVD---VKVSFTRGWDSKTD--FAELLE 235

Query: 246 -EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
            +Y++ L  G         T+ GPH++DL +         A  S G+ K+++  + +A  
Sbjct: 236 NQYSRDLATG--------HTVSGPHKADLRLRVGTLPAQDAL-SRGQLKLLVCALRIAQG 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK-SVFDSLNETAK 363
           +L+        I L+D++ + LD   R  L + +TD G+Q+F+T  D  ++ DSL+    
Sbjct: 287 KLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLTDTGAQVFVTAIDPAAIVDSLHTPPS 346

Query: 364 FM 365
            M
Sbjct: 347 RM 348


>gi|217971219|ref|YP_002355970.1| recombination protein F [Shewanella baltica OS223]
 gi|304412707|ref|ZP_07394310.1| DNA replication and repair protein RecF [Shewanella baltica OS183]
 gi|307305828|ref|ZP_07585574.1| DNA replication and repair protein RecF [Shewanella baltica BA175]
 gi|254790487|sp|B8E3P6|RECF_SHEB2 RecName: Full=DNA replication and repair protein recF
 gi|217496354|gb|ACK44547.1| DNA replication and repair protein RecF [Shewanella baltica OS223]
 gi|304348917|gb|EFM13332.1| DNA replication and repair protein RecF [Shewanella baltica OS183]
 gi|306911321|gb|EFN41747.1| DNA replication and repair protein RecF [Shewanella baltica BA175]
          Length = 360

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 168/362 (46%), Gaps = 25/362 (6%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           LNI  FRN  S +L+      +  G NG GKT+ILEAI FL  GR FR      V     
Sbjct: 6   LNIEAFRNIQSAQLIPAPGINLIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVIN-ND 64

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVP-S 128
               + FA +    G + I ++     +  VR   I+   ++ +  L + L I  + P S
Sbjct: 65  DDKLTLFATLNLARGDSKIGLRRFRSGETEVR---IDGEKVKRLSTLAETLPIQVITPES 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEG--YFDSSWCSSI 186
              +F G    RR+F+D   F  DP+      +  R+++ RN+LL  G  Y +  +    
Sbjct: 122 FSLLFEG-PKSRRQFIDWGAFHADPQFYGAWTNVRRVLKQRNQLLRNGSSYSNIQFWDQE 180

Query: 187 EAQMAELGVKINIARVEMINA-LSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
             + AE   +I    V+ +N  L  +I E++   +   +K+S T   D K D  F  L E
Sbjct: 181 FVRYAEQVTEIRNHYVDSLNELLKGIIGEFLPSVD---VKVSFTRGWDSKTD--FAELLE 235

Query: 246 -EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHA 304
            +Y++ L  G         T+ GPH++DL +         A  S G+ K+++  + +A  
Sbjct: 236 NQYSRDLATG--------HTVSGPHKADLRLRVGTLPAQDAL-SRGQLKLLVCALRIAQG 286

Query: 305 RLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK-SVFDSLNETAK 363
           +L+        I L+D++ + LD   R  L + +TD G+Q+F+T  D  ++ DSL+    
Sbjct: 287 KLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLTDTGAQVFVTAIDPAAIVDSLHTPPS 346

Query: 364 FM 365
            M
Sbjct: 347 RM 348


>gi|70725005|ref|YP_251919.1| recombination protein F [Staphylococcus haemolyticus JCSC1435]
 gi|82581561|sp|Q4LAL2|RECF_STAHJ RecName: Full=DNA replication and repair protein recF
 gi|68445729|dbj|BAE03313.1| DNA repair and genetic recombination protein [Staphylococcus
           haemolyticus JCSC1435]
          Length = 371

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 95/379 (25%), Positives = 164/379 (43%), Gaps = 29/379 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+K L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLKTLQLENYRNYEEVTLECHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F S +A++EG+      ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNSEYAKIEGVLNYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYVGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D+
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKQDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIM----------EYVQKENFPHIKLSLTG 230
           +    +  Q A+  + + + R   I  L SL            E +     P IKLS   
Sbjct: 176 TMLEVLNQQFAQYALNVTLRREHFIKELESLAKPIHAGITNERETLSLTYLPSIKLS--- 232

Query: 231 FLDGKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTG 290
                  +    L +E    L D  K +      L GPHR DL  +  D      +GS G
Sbjct: 233 ----DMSKGEQTLWDEVITLLNDNIKREMDRGVCLFGPHRDDLGFNVNDMDAQ-TYGSQG 287

Query: 291 EQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +Q+   + I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 288 QQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 346

Query: 351 DKSVFD-SLNETAKFMRIS 368
                D  +   AK  RI+
Sbjct: 347 SVDGIDHEIMNNAKLYRIN 365


>gi|289577269|ref|YP_003475896.1| DNA replication and repair protein RecF [Thermoanaerobacter
           italicus Ab9]
 gi|289526982|gb|ADD01334.1| DNA replication and repair protein RecF [Thermoanaerobacter
           italicus Ab9]
          Length = 362

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 163/354 (46%), Gaps = 21/354 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  FRN    R+ F     IF G N  GK+N+LE+I  LS GR FR +   ++ R
Sbjct: 3   VKELFVDNFRNLEKQRIEFCEGINIFYGLNAQGKSNLLESIRLLSMGRSFRGSKSTELVR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G   F   + +    +   D  I+   + D + + +++N   I+ + EL   L      
Sbjct: 63  FGENYF---YVKAIICQENNDKKIEFGYKKDGN-KVIKVNSNKIKSISELLGQLLTVIFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL---TEGYFDSSWC 183
           P    I       RR++LD  +  I+  +   ++ + +++  RN+LL    EG    +  
Sbjct: 119 PEDLNIIKEGPSHRRKYLDSCISIIEKNYLYNLMQYNKILMNRNKLLKNIKEGK-SKNIL 177

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEY---VQKENFPHIKLSLTGFLDGKFDQSF 240
              + Q+ E G KI + R   +  L   I ++   +  E    + L+  G  D   +++ 
Sbjct: 178 EIFDNQLVEYGAKIIMVRQNYLKNLEINIKKFLLEISNEKAEIVYLNSVGLKDASDEET- 236

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAHGSTGEQKVVLVG 298
             +K+   +KL     +D     T +GPHR D  +I++  D  +   + S G+Q+   + 
Sbjct: 237 --VKKRLKEKLSKNIDLDLKYLTTQVGPHREDFKIIINGYDSRV---YSSQGQQRTAALC 291

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           + L+   ++   T   P+LLLD++ + LDE+++  +   +   G Q F+T T K
Sbjct: 292 LKLSEFEILKKATNEKPVLLLDDVMSELDENRKKYVLEKLK--GFQTFITHTTK 343


>gi|315650189|ref|ZP_07903264.1| recombination protein F [Eubacterium saburreum DSM 3986]
 gi|315487546|gb|EFU77854.1| recombination protein F [Eubacterium saburreum DSM 3986]
          Length = 363

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 167/367 (45%), Gaps = 19/367 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ L + ++RNY +L +       IF GDN  GKTNILE+I   +  +  R +   D+ R
Sbjct: 3   IESLELKDYRNYENLNIKLSTGVNIFYGDNAQGKTNILESIYLATTSKSHRGSKDKDIIR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRS-VRCLQINDVVIRVVDELNKHLRISWL 125
            G+       + ++ M    D S++++    ++  + + IN + IR + EL     + + 
Sbjct: 63  FGAGE-----SHIKLMIKRMDASVRMDMHIKKNKAKGVAINGIPIRKLSELFGTCNVVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    I      ERR F+D  +  ++  +   ++ + +++  RN+LL E  F +    +
Sbjct: 118 SPEDLNIIKRSPKERRNFVDMELCQLNKVYVSTLVTYNKVLEQRNKLLKEIGFKTGLEDT 177

Query: 186 I---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCA 242
           +   + Q+ + G  +   R E +  L+ +I +         I   LTG    K       
Sbjct: 178 LDIWDMQLIKYGTDLISYREEFVKKLNEVIFD---------IHSRLTGGEKIKVIYEKNI 228

Query: 243 LKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLA 302
            K+ +  +L   R  D   + T +GPHR D      ++      GS G+Q+ + + + L+
Sbjct: 229 EKDNFEAELRKSRTNDIKYKTTNVGPHRDDFSFFLNNEMDLKKFGSQGQQRSLALSLKLS 288

Query: 303 HARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETA 362
              LI    G  P+LLLD++ + LD  +++ L   +  I + I  TG +  +  SL +  
Sbjct: 289 EIELIKVRYGEFPVLLLDDVLSELDGKRQSHLLESIRHIQTLITCTGVEDFLNKSL-DIG 347

Query: 363 KFMRISN 369
           K   ++N
Sbjct: 348 KVFNVTN 354


>gi|302384448|ref|YP_003820270.1| DNA replication and repair protein RecF [Clostridium
           saccharolyticum WM1]
 gi|302195076|gb|ADL02647.1| DNA replication and repair protein RecF [Clostridium
           saccharolyticum WM1]
          Length = 361

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/360 (25%), Positives = 160/360 (44%), Gaps = 34/360 (9%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           I+ + +  +RNY  L + F     I  GDN  GKTN+LEAI   +  +  R +   ++ +
Sbjct: 3   IESIELKNYRNYDELHMDFSQGTNILYGDNAQGKTNVLEAIYVCATTKSHRGSKDKEIIQ 62

Query: 67  IG-SPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
                S      R   +    D+ +K         + + +N V I+   EL   + + + 
Sbjct: 63  FDRDESHIKLNIRKNNIPYRIDMHLK-----KNKAKGVAVNGVPIKKASELFGIVNVVFF 117

Query: 126 VPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSS 185
            P    +      ERRRF+D  +  ++  +   ++ + R++  RN+LL +  F   +  +
Sbjct: 118 SPEDLNLIKNGPAERRRFVDLELCQLNRYYVHSLVQYNRIVTQRNKLLKDMAFRPDYEET 177

Query: 186 IEA---QMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGK------- 235
           ++    Q+ + G ++   R E I  L  +I              S+ G L G+       
Sbjct: 178 LDVWDMQLVQYGKEMIGYRKEFIEQLDGIIG-------------SIHGQLSGEKEHLRIL 224

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIA-HGSTGEQKV 294
           ++ +  A  EE+ + +   R+ D   + TL GPHR DL   +    I I  +GS G+Q+ 
Sbjct: 225 YEPNVGA--EEFEEAIRRSRQQDMKQKTTLTGPHRDDL--SFVINGIDIRRYGSQGQQRT 280

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSV 354
             + + LA   L+  T    PILLLD++ + LD  ++N L   +  I + I  TG ++ V
Sbjct: 281 AALSLKLAEIELVEKTVFDYPILLLDDVLSELDNSRQNQLLAGINHIQTVITCTGLEEFV 340


>gi|269303216|gb|ACZ33316.1| DNA replication and repair protein RecF [Chlamydophila pneumoniae
           LPCoLN]
          Length = 364

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 98/368 (26%), Positives = 161/368 (43%), Gaps = 13/368 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI  L +  FRN++ L +    +    VG N  GKTN+LEA+  LS GR FR     D 
Sbjct: 3   MKICSLKLKNFRNHSDLEISLAPKLNYIVGKNAQGKTNLLEALYVLSLGRSFRTQHLTDT 62

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
              GS  FF     +E       +   L    D+  + +  N + I+ + +L   + I  
Sbjct: 63  ITFGSSHFF-----LETQFEKDHLPQALSIYTDKQGKKIFYNQLPIKTLSQLIGKVPIV- 116

Query: 125 LVPSMDRIF-SGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWC 183
           L  S DR+  SG   +RR FL+ ++   D  +   +  + R ++ RN LL      +S  
Sbjct: 117 LFSSKDRLLISGAPADRRLFLNLLLSQCDSHYTLCLSYYHRALQQRNALLKSK--QTSTV 174

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           +  + Q+ + G  ++I R      LS L  E         + L     L    D S  A+
Sbjct: 175 AIWDEQLVKHGTYLSIQRFLCSQKLSDLSKELWSNNLKEQLALKFKSSLIKNSDISETAV 234

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAH 303
            EE+ K+L      D     T +GPHR D ++      ++    S G++  +L  + LA 
Sbjct: 235 AEEFHKQLSISLPRDLEWGSTSVGPHREDFLLTMNQMPVS-QFSSEGQKHSLLAILRLAE 293

Query: 304 ARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAK 363
              +  +   +P++ LD+I A LD ++   L  +   +G Q  +T T   +   L +T+ 
Sbjct: 294 CLYLKQSHHVSPLVCLDDIHAGLDNERVGQLLDLAPTLG-QTLITSTH--MHGELPKTSL 350

Query: 364 FMRISNHQ 371
            + I N Q
Sbjct: 351 VLSIENAQ 358


>gi|319936687|ref|ZP_08011100.1| DNA replication and repair protein recF [Coprobacillus sp. 29_1]
 gi|319808244|gb|EFW04809.1| DNA replication and repair protein recF [Coprobacillus sp. 29_1]
          Length = 369

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 95/356 (26%), Positives = 166/356 (46%), Gaps = 28/356 (7%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +KI  + +  FRNY    + F     IF+G N  GKTN+LEAI  LS  + F+     + 
Sbjct: 1   MKINHIELKNFRNYKDCSVDFAPFINIFIGKNAQGKTNLLEAIYILSLSKSFKTKVIEEF 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
                  F   FA++ G     +  I LE    +  +   IN   I+   +   +L +  
Sbjct: 61  I-----YFNEDFAKIHGRVNSHEKDIDLEVVLSKYGKKAIINHKEIKKTSDYVGYLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRN---RLLTEGY--FD 179
            +P    +  G    RR+ +D  +  I P +   +  + +L++ RN   ++L E +  +D
Sbjct: 116 FIPEDLMLIKGSPRLRRKLMDMEISKISPIYMYNLNKYNKLLKERNKYLKMLHEKHRRYD 175

Query: 180 SSWCSSIEAQMAELGVKINIARVE---MINALSSLIMEYV--QKENFPHIKLSLTGFLDG 234
             +   +  QMA L V +   R+E   ++N +SS + +Y+   KE     KL +      
Sbjct: 176 -EYLDVLSEQMARLQVDLIKKRIEFVDLLNDISSTMYDYISLHKE-----KLRIEYKCIY 229

Query: 235 KFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKV 294
           K D S+  + E+Y K      + D    +T+ G H+ D+++   DK   +A+ S G+Q+ 
Sbjct: 230 K-DLSYEGILEKYQK----NYQRDISYSQTVDGLHKDDMLMSLDDKD-AVAYASQGQQRS 283

Query: 295 VLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           +++ I +    LI    G  PILLLD++ + LD+ ++  L  ++     Q F+T T
Sbjct: 284 IVLAIKIGLLELIKKEIGEYPILLLDDVLSELDDVRKTKLLNLIQG-KVQTFLTST 338


>gi|90408444|ref|ZP_01216604.1| recombination protein F [Psychromonas sp. CNPT3]
 gi|90310428|gb|EAS38553.1| recombination protein F [Psychromonas sp. CNPT3]
          Length = 360

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 98/360 (27%), Positives = 164/360 (45%), Gaps = 31/360 (8%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L I +FRN  S  L F+ Q  +  GDNG GKT +LEAI FL  GR FR      +     
Sbjct: 6   LVIHQFRNIHSATLHFNKQINVITGDNGSGKTALLEAIYFLGLGRSFRSHLSNRIITHEH 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
           P F   FA ++       I +K +TR   S+  L+IN  +   + +L +HL +  + P  
Sbjct: 66  PEFI-LFAEIDEQGVQVPIGLK-KTRKGESI--LKINTRIATKLADLTQHLPLQLITPDS 121

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI-EA 188
             + SG    RR FLD  VF  DP   +     +RL++ RN  L +       C +  E 
Sbjct: 122 INLLSGSPKNRRAFLDWGVFYHDPLFYQTWARIKRLLKQRNAALKQ-------CKTYNEL 174

Query: 189 QMAE-----LGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCAL 243
           Q+ +     L  +I+  R      L  LI + +  +  P   + ++ F    +D +  +L
Sbjct: 175 QLWDNELCFLSTEISDQRQRYFQQLIPLIEKTI-ADFLPEFSIKMSFFCG--WDNTNKSL 231

Query: 244 KEEYAKKLFDGRKMDSMSRRTLIGPHRSDL---IVDYCDKAITIAHGSTGEQKVVLVGIF 300
           ++ +     D  + D     T  GP ++D+   I  Y    +     S G+ K+ +  + 
Sbjct: 232 QQYF----IDNFERDKQLGYTTAGPQKADIRFKIGSYPLADVL----SRGQLKLFVYALR 283

Query: 301 LAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNE 360
           LA    ++N      + L+D+ S+ LD+ K+  L + +    +Q+F++  DK+  ++L E
Sbjct: 284 LAQGLFLNNVNNKKCVFLIDDFSSELDQSKQQILAKHIIQSDAQLFISVIDKNHIENLFE 343


>gi|322386450|ref|ZP_08060079.1| recombination protein F [Streptococcus cristatus ATCC 51100]
 gi|321269536|gb|EFX52467.1| recombination protein F [Streptococcus cristatus ATCC 51100]
          Length = 371

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/363 (24%), Positives = 161/363 (44%), Gaps = 10/363 (2%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L I  FRNY +  + FD    IF+G N  GKTNILEAI FL+  R  R  +  D+  
Sbjct: 3   LKTLKIKHFRNYQAAEVDFDPGLNIFLGQNAQGKTNILEAIYFLALTRSHRTRTDKDLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
               +       +E   G   + I+L  +     R  +IN +    + +    + +    
Sbjct: 63  FQEKN-LQISGIIEKTTGKIPLDIELTPKG----RITKINHLKQGKLSDYIGIVNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   +  +  +++ RN  L      D ++ S 
Sbjct: 118 PEDLQLIKGAPALRRKFIDIELGQIKPIYLADLSSYNHVLKQRNAYLKANDKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFCALKE 245
           ++ Q+ + G ++   R++ I  L     E     +    KL++       F      L+ 
Sbjct: 178 LDEQLIDFGCRVMQHRLDFIEKLEDFAQESHSDISQGKEKLTIKYVSSVPF-SCLENLEA 236

Query: 246 EYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHAR 305
            +   L + R+ D   + T +GPHR D  +++    +    GS G+ + +++ + LA  +
Sbjct: 237 SFRSALSESRRRDLFKKNTGVGPHRDD--INFFINDMDAGFGSQGQHRSLVLSLKLAEIK 294

Query: 306 LISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFM 365
           LI + T   PILLLD++ + LD  ++  L   ++    Q F+T T      +L +     
Sbjct: 295 LIESLTKDTPILLLDDVMSELDNMRQLKLLETISQ-NIQTFITTTSLDHLQNLPDDINIF 353

Query: 366 RIS 368
           +IS
Sbjct: 354 QIS 356


>gi|160878166|ref|YP_001557134.1| DNA replication and repair protein RecF [Clostridium
           phytofermentans ISDg]
 gi|189039622|sp|A9KPP4|RECF_CLOPH RecName: Full=DNA replication and repair protein recF
 gi|160426832|gb|ABX40395.1| DNA replication and repair protein RecF [Clostridium
           phytofermentans ISDg]
          Length = 360

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 92/370 (24%), Positives = 170/370 (45%), Gaps = 29/370 (7%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +S FRNY +L L F     I  GDN  GKTNILEA+   +  +  + +   ++ +
Sbjct: 3   VKSLELSNFRNYENLSLEFSPSTNILYGDNAQGKTNILEAVFLCATTKSHKGSKDREIIK 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
           + S        R+       D  + +  + ++  + + I+ + I+   EL   + + +  
Sbjct: 63  LQSE---EAHIRMRINRDDVDHRLDMHLKKNKP-KGVAIDGIPIKRSSELFGIINVVFFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSI 186
           P    I      ERRRF+D  +  +   +   +I++ +++  RN LL +  F+ S   ++
Sbjct: 119 PEDLSIIKNGPSERRRFIDMELCQLSKLYLHNLINYNKVLNQRNNLLKQIGFNKSLLDTL 178

Query: 187 ---EAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQSFC-- 241
              + Q+   G  +   R   + +++ LI+         H KLS     DGK +      
Sbjct: 179 YVWDQQLIHFGSALIKERDAFMKSMNELIIAL-------HKKLS-----DGKEELEIVYE 226

Query: 242 --ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDL--IVDYCDKAITIAHGSTGEQKVVLV 297
               + E+  KL    + D   + T +GPHR DL  +++  D      +GS G+Q+   +
Sbjct: 227 ASVAESEFENKLKKSMERDIALKVTNVGPHRDDLSFLINGQD---VRKYGSQGQQRTAAL 283

Query: 298 GIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
            + LA   L+   T   PILLLD++ + LD  ++N L   +  I + +  TG ++ V + 
Sbjct: 284 SLKLAEIELVKQVTKDKPILLLDDVLSELDRKRQNQLLDSIVGIQTIVTCTGLEEFVNNR 343

Query: 358 LNETAKFMRI 367
           + ET +  ++
Sbjct: 344 I-ETDRIYKV 352


>gi|87161857|ref|YP_492726.1| recombination protein F [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|97180982|sp|Q2FKQ2|RECF_STAA3 RecName: Full=DNA replication and repair protein recF
 gi|87127831|gb|ABD22345.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus USA300_FPR3757]
          Length = 370

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 155/352 (44%), Gaps = 13/352 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTT 345


>gi|315612172|ref|ZP_07887087.1| recombination protein F [Streptococcus sanguinis ATCC 49296]
 gi|315315733|gb|EFU63770.1| recombination protein F [Streptococcus sanguinis ATCC 49296]
          Length = 365

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 91/368 (24%), Positives = 165/368 (44%), Gaps = 22/368 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L I  FRNY   ++ F+ +  +F+G N  GKTNILEAI FL+  R  R  +  ++  
Sbjct: 3   LQHLTIKTFRNYKEAKIDFNPKLNVFLGQNAQGKTNILEAIYFLALTRSHRTRTDKNLIH 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
             +     T     G+      SI LE       R  ++N +    + +   H+ +    
Sbjct: 63  FDNEQLHLT-----GLLQKKTSSIPLEIDLTPKGRVTKVNHLKQARLSDYIGHMNVVLFA 117

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSS 185
           P   ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S 
Sbjct: 118 PEDLQLIKGAPSVRRKFIDIELGQIKPIYLSDLSNYNHILKQRNTYLKSSQKIDETFLSV 177

Query: 186 IEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLS-LTGFLDGKFDQSFCALK 244
           ++ Q+ + G ++   R++ I  L     ++ QK+   H+++S     L   +  S     
Sbjct: 178 LDDQLIDYGCRVIKHRIKFIKDLE----KFGQKK---HLEISNKLEKLSISYQSSVNFTN 230

Query: 245 EEYAKKLF-----DGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGI 299
           EE     F       R  D   + T +GPHR D  + +    +  + GS G+ + +++ I
Sbjct: 231 EEQLTSSFKIALDKSRSRDLFKKNTGVGPHRDD--ISFYINGMDASFGSQGQHRSLVLSI 288

Query: 300 FLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLN 359
            LA   L+ + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L 
Sbjct: 289 KLAEIELMESITNESPILLLDDVMSELDNTRQLKLLETISQ-SIQTFITTTSLDHLQNLP 347

Query: 360 ETAKFMRI 367
           E      I
Sbjct: 348 ENLSIFNI 355


>gi|163751707|ref|ZP_02158926.1| DNA replication and repair protein RecF [Shewanella benthica KT99]
 gi|161328446|gb|EDP99602.1| DNA replication and repair protein RecF [Shewanella benthica KT99]
          Length = 365

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 106/359 (29%), Positives = 170/359 (47%), Gaps = 31/359 (8%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L+I  FRN AS +L+      +  G NG GKT+ILEAI FL  GR FR      V +  S
Sbjct: 6   LHIETFRNIASAQLLPGEGINLIYGLNGSGKTSILEAIYFLGMGRSFRSHLSQRVIQ-HS 64

Query: 70  PSFFSTFAR--VEGMEGLADISIKLETRDDRSVRC-LQINDVVIRVVDELNKHLRISWLV 126
               + FA   V+G E       K+  R  RS    ++I+   ++ +  L + L I  + 
Sbjct: 65  DDKLTLFANLTVQGKES------KIGLRRFRSGETEVKIDGDKVKRLSTLAEFLPIQVIT 118

Query: 127 P-SMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE--GYFDSSWC 183
           P S   +F G    RR+F+D   F  D R     I+ +R+++ RN+LL     Y    + 
Sbjct: 119 PESFALLFEG-PKSRRQFIDWGAFHCDERFHSAWINVKRILKQRNQLLKNEASYAQIQYW 177

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPH--IKLSLTGFLDGKFDQSFC 241
                + +E+   I   R + +N+L+ L+   ++ E  P   +K+S T   D K D    
Sbjct: 178 DRELVRYSEVVTDI---RTQYVNSLNELLKGIIE-EFLPQVDVKISFTRGWDSKTD---- 229

Query: 242 ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFL 301
                YA+ L      D  S  T  GPH++DL +      +  A  S G+ K+++  + +
Sbjct: 230 -----YAQLLETQYPRDVSSGNTASGPHKADLRLRVGTLPVQDAL-SRGQLKLLVCALRI 283

Query: 302 AHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK-SVFDSLN 359
           A  +L+        I L+D++ + LD   R  L + +TD G+Q+F+T  +  ++ DSLN
Sbjct: 284 AQGKLLKQQIDKNSIYLVDDLPSELDAKHRQLLLQQLTDTGAQVFVTAIEPAAILDSLN 342


>gi|297543502|ref|YP_003675804.1| DNA replication and repair protein RecF [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
 gi|296841277|gb|ADH59793.1| DNA replication and repair protein RecF [Thermoanaerobacter
           mathranii subsp. mathranii str. A3]
          Length = 362

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 163/354 (46%), Gaps = 21/354 (5%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           +K L +  FRN    R+ F     IF G N  GK+N+LE+I  LS GR FR +   ++ R
Sbjct: 3   VKELFVDNFRNLEKQRIEFCEGINIFYGLNAQGKSNLLESIRLLSMGRSFRGSKSTELVR 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G   F   + +    +   D  I+   + D + + +++N   I+ + EL   L      
Sbjct: 63  FGENYF---YVKAIICQENNDKKIEFGYKKDGN-KVIKVNSNKIKSISELLGQLLTVIFS 118

Query: 127 PSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL---TEGYFDSSWC 183
           P    I       RR++LD  +  I+  +   ++ + +++  RN+LL    EG    +  
Sbjct: 119 PEDLNIIKEGPSHRRKYLDSCISIIEKNYLYNLMQYNKILMNRNKLLKNIKEGK-SKNIL 177

Query: 184 SSIEAQMAELGVKINIARVEMINALSSLIMEY---VQKENFPHIKLSLTGFLDGKFDQSF 240
              + Q+ E G KI + R   +  L   I ++   +  E    + L+  G  D   +++ 
Sbjct: 178 EIFDDQLVEYGAKIIMVRQNYLKNLEINIKKFLLEISNEKAEIVYLNSVGLKDASDEET- 236

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSD--LIVDYCDKAITIAHGSTGEQKVVLVG 298
             +K+   +KL     +D     T +GPHR D  +I++  D  +   + S G+Q+   + 
Sbjct: 237 --VKKRLKEKLSKNIDLDLKYLTTQVGPHREDFKIIINGYDSRV---YSSQGQQRTAALC 291

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
           + L+   ++   T   P+LLLD++ + LDE+++  +   +   G Q F+T T K
Sbjct: 292 LKLSEFEILKKATNEKPVLLLDDVMSELDENRKKYVLEKLK--GFQTFITHTTK 343


>gi|162456448|ref|YP_001618815.1| RecF protein [Sorangium cellulosum 'So ce 56']
 gi|161167030|emb|CAN98335.1| RecF protein [Sorangium cellulosum 'So ce 56']
          Length = 383

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 97/359 (27%), Positives = 161/359 (44%), Gaps = 29/359 (8%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L+I EFRN   + +    +  +  G+NG GKT++LEAI F +  R FR    A++ R
Sbjct: 17  LERLHIREFRNLGRVDVEPAPRINVIAGNNGQGKTSLLEAIYFAATSRSFRTHRLAELVR 76

Query: 67  IGSPSFFSTFAR-VEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWL 125
            G+P   S  AR VE  + L  ++ + +T      RC      V+R+       L  S+ 
Sbjct: 77  HGAP-IASARARFVERRDALQPLA-REQTAAVEHKRC------VVRIDGNRPPSL-ASFA 127

Query: 126 VPSMDRIF--------SGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY 177
             S    F        +G +  RR  LDR+   +DP+       + + +R R+ LL  G 
Sbjct: 128 TRSPVVAFHAEELALSTGPASARRTLLDRLALFMDPQSADHRARYAQALRARHELLHRGG 187

Query: 178 FDSSWCS----SIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLD 233
              +  S    + EA  A  G  +  AR   + AL+  +     +   P + L+      
Sbjct: 188 GAQAQASAELDAFEALCALHGAALTRAREAAVQALAPELTHAFARIAAPDLTLAARYAPG 247

Query: 234 GKFDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQK 293
           G  D       E+  + L + R+ D+       GPHR DL+++       +   S G+ +
Sbjct: 248 GGGD------AEQAREALREQRRRDAHRPSAGYGPHRDDLLLELDGHPARVV-ASQGQHR 300

Query: 294 VVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDK 352
            + + +  A    I++  G  PILLLD++S+ LD D+  ALF  +     Q+F+T T +
Sbjct: 301 ALTLALKAAETAAIASVRGVEPILLLDDVSSELDPDRTAALFMFLGMARGQVFLTTTRR 359


>gi|158334838|ref|YP_001516010.1| recombination protein F [Acaryochloris marina MBIC11017]
 gi|189039615|sp|B0CB57|RECF_ACAM1 RecName: Full=DNA replication and repair protein recF
 gi|158305079|gb|ABW26696.1| DNA replication and repair protein RecF [Acaryochloris marina
           MBIC11017]
          Length = 374

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 93/359 (25%), Positives = 169/359 (47%), Gaps = 15/359 (4%)

Query: 7   IKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTR 66
           ++ L++ +FRNY + ++ F A  TI VG N  GK+N+LEA+  LS  +  R +   D+ +
Sbjct: 3   LQQLHLIQFRNYVAQQVEFSAPKTILVGPNAQGKSNLLEAVELLSTLKSHRVSRDRDLVK 62

Query: 67  IGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLV 126
            G  S     A ++   G  D+S+ L     R+V    +N   IR   +   HL I    
Sbjct: 63  DGE-SLSQVTATLQRESGPLDLSLTLRANGRRTVS---VNSETIRRQLDFLGHLNIVQFS 118

Query: 127 P-SMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE------GYFD 179
              MD +  G   ERR +LD ++  ++P +   +  ++++++ RN  L           D
Sbjct: 119 SLDMDLVRGG-PGERRNWLDAVLVQLEPVYAHLLQQYQQVLKQRNAYLKHHRADDAPQLD 177

Query: 180 SSWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFDQS 239
                    Q+A  G ++   R  M+  L  L   + Q  +    +L +    +  +D  
Sbjct: 178 PQQLVLWNQQLAASGSRVIQRRQRMLMRLVPLAGHWHQTISGHQEQLEILYTPNVSYDPQ 237

Query: 240 FC-ALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           F   L  ++  +L +   ++ +   +L+GPHR ++ +   +      +GS G+Q+ +++ 
Sbjct: 238 FPEQLYPQFLSQLEEKSMLEQLQGLSLVGPHRDEVTL-LINGTPARQYGSQGQQRTLVLA 296

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDS 357
           + LA  +LI    G AP+LLLD++ A LD +++N L   +     Q  +T T    FD+
Sbjct: 297 LKLAELKLIEEVVGEAPLLLLDDVLAELDLNRQNQLLDAI-QTRFQTLITTTHLGAFDA 354


>gi|328883700|emb|CCA56939.1| DNA recombination and repair protein RecF [Streptomyces venezuelae
           ATCC 10712]
          Length = 373

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 103/360 (28%), Positives = 159/360 (44%), Gaps = 29/360 (8%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           + +  L++++FR+YA + +  D   T FVG NG GKTN++EA+ +L+     R AS A +
Sbjct: 1   MHVTHLSLADFRSYARVEVPLDPGVTAFVGANGQGKTNLVEAVGYLATLSSHRVASDAPL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R+G+        R    +G     I+LE    R+ R        +R  D L   +R   
Sbjct: 61  VRMGAER---AVIRAAVTQGERSQLIELELNPGRANRARINRSSQVRPRDVLGI-VRTVL 116

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF------ 178
             P    +  G   ERRRFLD ++ A  PR      D+ER+++ RN LL           
Sbjct: 117 FAPEDLSLVKGDPGERRRFLDELITARTPRMAGVRSDYERVLKQRNTLLKSAAMARRHGG 176

Query: 179 ---DSSWCSSIEAQMAELGVKINIARVEMINALSSLI---MEYVQKENFPHIKLSLTGFL 232
              D S     +  +A  G ++   R+E+I  L  L     E +     P I L      
Sbjct: 177 RGMDLSTLDVWDQHLARAGAELLAQRLELIAVLQPLADKAYEQLAPGGGP-ILLEYRPSA 235

Query: 233 DGKFDQSFCALKEEYAKKLFDG----RKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGS 288
            G         +EE   +L D     RK +     TL+GPHR +L++   D      + S
Sbjct: 236 PGAGHT-----REELYAQLIDALAEVRKQEIERGVTLVGPHRDELLLKLGDLPAK-GYAS 289

Query: 289 TGEQKVVLVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMT 348
            GE     + + LA   L+  + G  P+L+LD++ A LD  +R  L  +V   G Q+ +T
Sbjct: 290 HGESWSYALALRLASYDLL-RSEGNEPVLVLDDVFAELDARRRERLAELVAG-GEQVLVT 347


>gi|289168901|ref|YP_003447170.1| recombination protein recF [Streptococcus mitis B6]
 gi|288908468|emb|CBJ23310.1| recombination protein recF [Streptococcus mitis B6]
          Length = 365

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 85/363 (23%), Positives = 164/363 (45%), Gaps = 14/363 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L++  FRNY   ++ F+ +  +F+G N  GKTN+LEAI FL+  R  R  +  ++     
Sbjct: 6   LSLKTFRNYKETKIDFNPKLNVFLGRNAQGKTNMLEAIYFLALTRSHRTRTDKNLIHFDE 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
                    + G+      SI LE    +  R  ++N +    + +   H+ +    P  
Sbjct: 66  EQL-----HLSGLVQKKTGSIPLEIELTQKGRVTKVNHLKQARLSDYVGHMNVVLFAPED 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGY-FDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   + ++  +++ RN  L      D ++ S ++ 
Sbjct: 121 LQLIKGAPSVRRKFIDMELGQIKPIYLSDLTNYNHILKQRNTYLKSAQKIDETFLSVLDD 180

Query: 189 QMAELGVKINIARVEMINALSSL-IMEYVQKEN-FPHIKLSLTGFLDGKFDQSFCALKEE 246
           Q+ + G ++   R++ I  L      ++ +  N    + +S    ++   +Q+   L E 
Sbjct: 181 QLVDYGCRVMNHRLDFIKKLEYFGCKKHFELSNQIEELSISYQSSVNITDNQN---LSES 237

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           +   L   R  D   + T +GPHR D  + +    +  + GS G+ + +++ I LA   L
Sbjct: 238 FKIALEKSRSRDLFKKNTGVGPHRDD--ISFYLNGMDASFGSQGQHRSLVLSIKLAEIEL 295

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
           + + T  +PILLLD++ + LD  ++  L   ++    Q F+T T      +L E      
Sbjct: 296 MESITTESPILLLDDVMSELDNTRQLKLLETISH-SIQTFITTTSLDHLQNLPENLSIFT 354

Query: 367 ISN 369
           I +
Sbjct: 355 IQD 357


>gi|146319836|ref|YP_001199548.1| recombination protein F [Streptococcus suis 05ZYH33]
 gi|146322027|ref|YP_001201738.1| recombination protein F [Streptococcus suis 98HAH33]
 gi|253752812|ref|YP_003025953.1| DNA replication and repair protein RecF [Streptococcus suis SC84]
 gi|253754637|ref|YP_003027778.1| DNA replication and repair protein RecF [Streptococcus suis P1/7]
 gi|253756570|ref|YP_003029710.1| DNA replication and repair protein RecF [Streptococcus suis BM407]
 gi|166221874|sp|A4W4P9|RECF_STRS2 RecName: Full=DNA replication and repair protein recF
 gi|166221876|sp|A4VYF9|RECF_STRSY RecName: Full=DNA replication and repair protein recF
 gi|145690642|gb|ABP91148.1| Recombinational DNA repair ATPase (RecF pathway) [Streptococcus
           suis 05ZYH33]
 gi|145692833|gb|ABP93338.1| Recombinational DNA repair ATPase (RecF pathway) [Streptococcus
           suis 98HAH33]
 gi|251817101|emb|CAZ52753.1| DNA replication and repair protein RecF [Streptococcus suis SC84]
 gi|251819034|emb|CAZ56881.1| DNA replication and repair protein RecF [Streptococcus suis BM407]
 gi|251820883|emb|CAR47649.1| DNA replication and repair protein RecF [Streptococcus suis P1/7]
 gi|292559432|gb|ADE32433.1| RecF protein [Streptococcus suis GZ1]
 gi|319759228|gb|ADV71170.1| recombination protein F [Streptococcus suis JS14]
          Length = 364

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 88/363 (24%), Positives = 162/363 (44%), Gaps = 14/363 (3%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L +  FRNY  L + F     +F+G+N  GKTNILE+I  L+  R  R  +  D+ +   
Sbjct: 6   LELQHFRNYNQLDIEFHKGLNVFLGENAQGKTNILESIYVLALTRSHRTRTDKDLLQFQE 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVPSM 129
               S    +    G   + I L  +     R  ++N +    +     H+ +    P  
Sbjct: 66  KE-LSISGLLHRTSGKVPLDIHLTDKG----RVTKVNHLKQAKLSNYIGHMNVVLFAPED 120

Query: 130 DRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLL-TEGYFDSSWCSSIEA 188
            ++  G    RR+F+D  +  I P +   + ++  +++ RN  L +    D ++ S ++ 
Sbjct: 121 LQLIKGAPALRRKFIDVELGQIKPLYLSDLSNYNHVLKQRNTYLKSTDKIDENFLSVLDQ 180

Query: 189 QMAELGVKINIARVEMINALSSLIMEYVQK--ENFPHIKLSLTGFLDGKFDQSFCALKEE 246
           Q+AE G ++   R++ +  L       VQ+   N   + +     ++   D     L ++
Sbjct: 181 QLAEYGSRVIQHRIDFLKKLEEFGNRKVQEISGNREELTIEYQTSIELTDD---VNLIDK 237

Query: 247 YAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIFLAHARL 306
           +  +L   RK D   + T +GPHR D  V +    +   + S G+ + +++ + LA   L
Sbjct: 238 FLTELEKSRKRDLFKKNTGVGPHRDD--VAFFINGMNAHYASQGQHRSLVLSLKLAEIEL 295

Query: 307 ISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFDSLNETAKFMR 366
           +   T   PILLLD++ + LD +++  L   +TD   Q F+T T       L ++ K   
Sbjct: 296 MKEVTREYPILLLDDVMSELDNNRQIKLLETITDT-IQTFITTTSLDHLHKLPDSLKIFH 354

Query: 367 ISN 369
           I +
Sbjct: 355 IES 357


>gi|282902635|ref|ZP_06310528.1| RecF protein [Staphylococcus aureus subsp. aureus C160]
 gi|282918072|ref|ZP_06325822.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus D139]
 gi|282921294|ref|ZP_06329012.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus C427]
 gi|283767794|ref|ZP_06340709.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus H19]
 gi|282315709|gb|EFB46093.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus C427]
 gi|282318357|gb|EFB48717.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus D139]
 gi|282597094|gb|EFC02053.1| RecF protein [Staphylococcus aureus subsp. aureus C160]
 gi|283461673|gb|EFC08757.1| DNA replication and repair protein recF [Staphylococcus aureus
           subsp. aureus H19]
          Length = 370

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 162/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +  A  E+    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEAARLEDIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSVDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|258423234|ref|ZP_05686126.1| recombination protein F [Staphylococcus aureus A9635]
 gi|257846563|gb|EEV70585.1| recombination protein F [Staphylococcus aureus A9635]
          Length = 370

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 161/371 (43%), Gaps = 14/371 (3%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +K+  L +  +RNY  + L       I +G+N  GKTN+LE+I  L+  +  R ++  ++
Sbjct: 1   MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYTLALAKSHRTSNDKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
            R     F + +A++EG       ++ L     +  + +++N +    + +   HL +  
Sbjct: 61  IR-----FNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRLTQYIGHLNVVL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYF----DS 180
             P    I  G    RRRF+D  +  I   +   +  ++R+++ +N  L +       D 
Sbjct: 116 FAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNYLKQLQLGQKKDL 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLTGFLDGKFD--Q 238
           +    +  Q AE  +K+   R   I  L SL              LSL      KFD  Q
Sbjct: 176 TMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALSLNYLPSLKFDYAQ 235

Query: 239 SFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVG 298
           +     EE    L D  + +     +L GPHR D+  D  +      +GS G+Q+   + 
Sbjct: 236 NEATRLEEIMSILSDNMQREKERGISLFGPHRDDISFD-VNGMDAQTYGSQGQQRTTALS 294

Query: 299 IFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGTDKSVFD-S 357
           I LA   L++   G  PILLLD++ + LD+ ++  L   +     Q F+T T     D  
Sbjct: 295 IKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQH-KVQTFVTTTSVDGIDHE 353

Query: 358 LNETAKFMRIS 368
           +   AK  RI+
Sbjct: 354 IMNNAKLYRIN 364


>gi|329576321|gb|EGG57836.1| DNA replication and repair protein RecF [Enterococcus faecalis
           TX1467]
          Length = 375

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 168/355 (47%), Gaps = 18/355 (5%)

Query: 5   IKIKFLNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADV 64
           +++  L +  +RNY ++ L F     +F+G+N  GKTN+LE+I  L+  R  R ++  ++
Sbjct: 1   MRLNELTLQHYRNYETVSLDFPKTLNLFLGENAQGKTNLLESIYVLAMTRSHRTSNEKEL 60

Query: 65  TRIGSPSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISW 124
             IG   +    A++ G+      ++ LE       R  ++N +  + +      L +  
Sbjct: 61  --IG---WEQAAAKISGVVEKKTGTVPLEILISNKGRKTKVNHIEQKRLSAYIGQLNVIL 115

Query: 125 LVPSMDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTE----GYFDS 180
             P    +  G    RR+F+D  +  + P +   ++ ++ +++ RN+ L +     Y D+
Sbjct: 116 FAPEDLSLVKGSPQVRRKFIDMELGQVSPIYLYDLVQYQSVLKQRNQYLKQLAEKKYPDT 175

Query: 181 SWCSSIEAQMAELGVKINIARVEMINALSSLIMEYVQKENFPHIKLSLT-----GFLDGK 235
            +   +  Q+AE G K+  AR+  +  L        QK    H + +LT           
Sbjct: 176 VYLDILTEQLAEFGGKVLYARLGFLKKLEHWANLLHQK--ISHGRETLTIDYASSIPIDN 233

Query: 236 FDQSFCALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVV 295
            D S  AL+ +  ++L + RK +     T +GPHR DL+     + +   +GS G+Q+  
Sbjct: 234 TDLSLEALQNQLLQQLMNNRKRELFKANTFLGPHRDDLLFIVNGQNVQ-TYGSQGQQRTT 292

Query: 296 LVGIFLAHARLISNTTGFAPILLLDEISAHLDEDKRNALFRIVTDIGSQIFMTGT 350
            + I LA   L+ + TG  P+LLLD++ + LD +++  L   + +   Q F+T T
Sbjct: 293 ALSIKLAEIDLMHSETGEYPVLLLDDVMSELDNERQIHLLETI-EGKVQTFLTTT 346


>gi|212632927|ref|YP_002309452.1| recombination protein F [Shewanella piezotolerans WP3]
 gi|226737834|sp|B8CH73|RECF_SHEPW RecName: Full=DNA replication and repair protein recF
 gi|212554411|gb|ACJ26865.1| DNA replication and repair protein RecF [Shewanella piezotolerans
           WP3]
          Length = 360

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 105/359 (29%), Positives = 167/359 (46%), Gaps = 33/359 (9%)

Query: 10  LNISEFRNYASLRLVFDAQHTIFVGDNGVGKTNILEAISFLSPGRGFRRASYADVTRIGS 69
           L+I  FRN  S +L       +  G NG GKT+ILEAI FL  GR FR      V    +
Sbjct: 6   LHIEAFRNITSAQLQPGDGLNVIYGQNGSGKTSILEAIYFLGMGRSFRSHLSQRVINNDA 65

Query: 70  PSFFSTFARVEGMEGLADISIKLETRDDRSVRCLQINDVVIRVVDELNKHLRISWLVP-S 128
            +  + FA ++  E  + I ++     +  V+   IN   ++ +  L + L I  + P S
Sbjct: 66  DA-LTLFANMQSAEDESKIGLRRFRSGEIEVK---INGDKVKRLSTLAETLPIQVITPES 121

Query: 129 MDRIFSGLSMERRRFLDRMVFAIDPRHRRRMIDFERLMRGRNRLLTEGYFDSSWCSSIE- 187
              +F G    RR+F+D   F  DPR     ++  R+++ RN+LL     D S  SSI+ 
Sbjct: 122 FSLLFEG-PKSRRQFIDWGAFHSDPRFYAAWVNVRRILKQRNQLLR----DESPYSSIQF 176

Query: 188 -----AQMAELGVKINIARVEMINALSSLIMEYVQKENFPH--IKLSLTGFLDGKFDQSF 240
                 + AEL  +I    V+ +N L   I+E    E  P   +K+S T   D       
Sbjct: 177 WDKEFIRYAELVTEIRKQYVDSLNELLKGIIE----EFLPQVDVKVSFTRGWDS------ 226

Query: 241 CALKEEYAKKLFDGRKMDSMSRRTLIGPHRSDLIVDYCDKAITIAHGSTGEQKVVLVGIF 300
              K EYA+ L      D  +  T+ GPH++DL