HHsearch alignment for GI: 254780768 and conserved domain: PRK00881

>PRK00881 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional.
Probab=97.42  E-value=0.0061  Score=40.23  Aligned_cols=115  Identities=23%  Similarity=0.259  Sum_probs=81.1

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCC-----CHHHHHHHHHHHHHHCCCCCCCCEEE
Q ss_conf             3345546532347889989999997332672259998197488962534-----21799999997543123456677189
Q gi|254780768|r  139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIE-----GTDSMLQRIVDCRNNGRILAGKSGVL  213 (281)
Q Consensus       139 G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~e-----GTD~mi~R~~~~~~~~~~~~~~~~il  213 (281)
T Consensus       387 k~VT~~~p~~~e~~DL~FAwkv~k~vKSNAI---v~ak~~~tvGiGaGQ~sRVda~~iA~~ka~~~~~-----~~~g~vl  458 (514)
T PRK00881        387 KVVTKRQPTEQELKDLLFAWKVVKHVKSNAI---VYAKDGQTVGIGAGQMSRVDSAKIALEKAGDAGL-----DLKGSVL  458 (514)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHCCCCEE---EEEECCCEEEECCCCCCHHHHHHHHHHHHHHHCC-----CCCCCEE
T ss_conf             3113899898998656999999863665569---9994893898678975689999999999886345-----6678489


Q ss_pred             EEECCCCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEE
Q ss_conf             9934888753121066279999999984990999973977998589999999987968999
Q gi|254780768|r  214 VKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       214 vK~~K~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g  274 (281)
T Consensus       459 A------SDAFFPF----~D~ie~aa~~Gv~aIi-QPGGSi--rD~evI~aan~~gi~M~f  506 (514)
T PRK00881        459 A------SDAFFPF----RDGVEAAAKAGITAII-QPGGSI--RDQEVIAAADEHGIAMVF  506 (514)
T ss_pred             E------ECCCCCC----CHHHHHHHHCCCEEEE-CCCCCC--CHHHHHHHHHHCCCEEEE
T ss_conf             9------5677887----4479999985990998-999753--639999999970987998