HHsearch alignment of GI: 254780768 and MMDB domain: 1kjq_A_1-125

>1kjq_A (A:1-125) GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli}
Probab=93.60  E-value=0.32  Score=28.23  Aligned_cols=74  Identities=18%  Similarity=0.086  Sum_probs=58.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             973999977980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      |+|| +|.|+|.+-..+++++++.|++++++.-...+........+..+++-....+.++-++++|+=++.-+.-
T Consensus        11 ~kki-lIiG~G~~~~~l~~~a~~~g~~~~~~~~~~~~~~~~~ad~~~~~~~~d~~~i~~~a~~~~vd~v~~~~~~   84 (125)
T 1kjq_A           11 ATRV-MLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIVPEIEA   84 (125)
T ss_dssp             CCEE-EEESCSHHHHHHHHHHHTTTCEEEEEESSTTCGGGGGSSEEEECCTTCHHHHHHHHHHHCCSEEEECSSC
T ss_pred             CCEE-EEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEECCCCC
T ss_conf             9899-9989789999999999987998999979999826762550687178899999999998399999827762