HHsearch alignment of GI: 254780768 and MMDB domain: 1zcz_A_336-464

>1zcz_A (A:336-464) Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima}
Probab=97.02  E-value=0.013  Score=37.67  Aligned_cols=117  Identities=17%  Similarity=0.111  Sum_probs=78.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECC
Q ss_conf             33455465323478899899999973326722599981974889625342179999999754312345667718999348
Q gi|254780768|r  139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCK  218 (281)
Q Consensus       139 G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~~~~~~~~~~~~~ilvK~~K  218 (281)
                      .+.|.++|++++++|..++|.+.+..-+--|   +++.+|..+++=+-+=.-.-=.|.+- .+.+.  .-.|.++.    
T Consensus         5 ~vvt~~~p~~~~~~dl~Fa~~v~k~~kSNAI---~~~~~g~~~gig~Gq~srv~~~~~a~-~~a~~--~l~g~vla----   74 (129)
T 1zcz_A            5 ELVVGEPLSEKELEDLEFAYRVVEGAKSNAV---LIAKDGVTVGIGSGQPSRKRAAWIAT-VMAGE--KAKGAVAA----   74 (129)
T ss_dssp             EEEESCCCCHHHHHHHHHHHHHHHHSCSSCE---EEEETTEEEEEECSCSSHHHHHHHHH-HHHGG--GGTTCEEE----
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCE---EEECCCCEEEECCCCCCHHHHHHHHH-HHHHH--HCCCEEEE----
T ss_conf             0134789866666769999999976786757---99639938976889667799999999-98510--21787999----


Q ss_pred             CCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEE
Q ss_conf             88753121066279999999984990999973977998589999999987968999
Q gi|254780768|r  219 SQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       219 ~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g  274 (281)
                            -|=.-=-+++|+.++++|.+.|+ +.|+++  --+++|+.||++||.++=
T Consensus        75 ------SDAFFPF~D~v~~A~~~GV~~Ii-qPgGSi--rD~evI~aane~gi~mvf  121 (129)
T 1zcz_A           75 ------SDAFFPFPDSLEILAQAGVKAVV-APLGSI--RDEEVIEKARELGITFYK  121 (129)
T ss_dssp             ------ESSCCSSHHHHHHHHHTTCCEEE-ECCCCT--THHHHHHHHHHHTCEEEE
T ss_pred             ------ECCCCCCCHHHHHHHHCCCEEEE-CCCCCC--CHHHHHHHHHHHCCEEEE
T ss_conf             ------45687875589999983994999-798743--619999999975988998