HHsearch alignment of GI: 254780768 and MMDB domain: 3doj_A_1-184

>3doj_A (A:1-184) AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana}
Probab=90.62  E-value=0.5  Score=26.90  Aligned_cols=152  Identities=8%  Similarity=-0.042  Sum_probs=93.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-CCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             973999977980389999999978997899995486673103-8856787389999999999864954067702423210
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRP   79 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP   79 (281)
                      |+||||| |.|.+=..+|+.+..+|+++++..........+. ..........+.      ...  ...++++-....  
T Consensus        21 ~~~I~iI-G~G~iG~~iA~~l~~~G~~V~v~~r~~~~~~~~~~~~~~~~~~~~~~------~~~--~~~i~~~~~~~~--   89 (184)
T 3doj_A           21 MMEVGFL-GLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEV------IKK--CKYTIAMLSDPC--   89 (184)
T ss_dssp             SCEEEEE-CCSHHHHHHHHHHHHTTCEEEEECSSGGGGHHHHHTTCEECSSHHHH------HHH--CSEEEECCSSHH--
T ss_pred             CCEEEEE-CHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEECCHHHH------HHC--CCCEEEECCCCH--
T ss_conf             6879887-07889999999999789938997599999999998699680899999------856--995388326614--


Q ss_pred             CHHHHCCC---HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             00111026---035789999998751048035899999999976974821122252420354334554653234788998
Q gi|254780768|r   80 NVQDLCFS---IKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILA  156 (281)
Q Consensus        80 ~~~~l~~D---~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~  156 (281)
                      ........   ...... ...+......................++..++.+.+-|...++.+.++...-  .+....+.
T Consensus        90 ~~~~~~~~~~~~~~~~~-~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~--~~~e~~~~  166 (184)
T 3doj_A           90 AALSVVFDKGGVLEQIC-EGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAA--GDKALFEE  166 (184)
T ss_dssp             HHHHHHHSTTCGGGGCC-TTCEEEECSCCCHHHHHHHHHHHHHTTCEEEECCEECCHHHHHHTCEEEEEE--ECHHHHHH
T ss_pred             HHHCCCCCCHHHHHCCC-CCCEEEECCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCHHHHCCCCEECCC--CCHHHHHH
T ss_conf             54101134125665058-9998995477748889999999996598697255778846886597321048--99999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999997332
Q gi|254780768|r  157 AMKSAEALSE  166 (281)
Q Consensus       157 g~~i~~~l~~  166 (281)
                      ...+++.+|.
T Consensus       167 ~~~l~~~~G~  176 (184)
T 3doj_A          167 SIPAFDVLGK  176 (184)
T ss_dssp             HHHHHHHHEE
T ss_pred             HHHHHHHHCC
T ss_conf             8678987538