Query         gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 281
No_of_seqs    128 out of 720
Neff          6.7 
Searched_HMMs 33803
Date          Wed Jun  1 13:53:55 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780768.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1zcz_A Bifunctional purine bi  97.0   0.013 3.7E-07   37.7  10.5  117  139-274     5-121 (129)
  2 >1g8m_A Aicar transformylase-I  96.0   0.016 4.8E-07   36.9   5.5  129  139-273     6-187 (196)
  3 >3pfk_A Phosphofructokinase; t  94.6    0.37 1.1E-05   27.8  13.8  143    1-183     1-175 (186)
  4 >2dwc_A PH0318, 433AA long hyp  94.1    0.17 4.9E-06   30.1   6.1   73    1-74     19-91  (108)
  5 >1zxx_A 6-phosphofructokinase;  93.7    0.56 1.7E-05   26.6  13.9  143    1-183     1-173 (182)
  6 >1kjq_A GART 2, phosphoribosyl  93.6    0.32 9.5E-06   28.2   6.9   74    1-75     11-84  (125)
  7 >1pfk_A Phosphofructokinase; t  90.7     1.3 3.8E-05   24.1  14.0  143    1-183     2-174 (185)
  8 >3doj_A AT3G25530, dehydrogena  90.6     0.5 1.5E-05   26.9   4.9  152    1-166    21-176 (184)
  9 >3eth_A Phosphoribosylaminoimi  90.2    0.63 1.9E-05   26.2   5.1   34    1-35      1-34  (53)
 10 >1orr_A CDP-tyvelose-2-epimera  85.9     2.6 7.7E-05   22.1   6.8   76    1-76      1-84  (347)
 11 >2c20_A UDP-glucose 4-epimeras  85.4     2.8 8.2E-05   21.9  13.1  170    1-184     1-176 (330)
 12 >1jfl_A Aspartate racemase; al  84.6       3 8.8E-05   21.7   6.7   77    1-77      1-86  (118)
 13 >2zsk_A PH1733, 226AA long hyp  81.1     2.3 6.7E-05   22.5   4.1   76    1-77      1-85  (115)
 14 >1hdo_A Biliverdin IX beta red  80.6     4.2 0.00012   20.7   6.2   37    1-37      3-39  (206)
 15 >3ff4_A Uncharacterized protei  79.6     4.1 0.00012   20.8   5.0   74    2-75      5-93  (122)
 16 >1gso_A Protein (glycinamide r  77.9     2.9 8.4E-05   21.8   3.8  178    1-188     2-222 (359)
 17 >3cky_A 2-hydroxymethyl glutar  77.1     2.7 7.9E-05   22.0   3.5  152    3-167     6-160 (166)
 18 >3ehe_A UDP-glucose 4-epimeras  74.7     3.2 9.6E-05   21.5   3.4   73    1-75      1-73  (166)
 19 >2pgd_A 6-phosphogluconate deh  74.7     5.7 0.00017   19.8   4.6  145    1-166     2-161 (173)
 20 >3g17_A Similar to 2-dehydropa  71.7     4.8 0.00014   20.3   3.7   37    1-38      1-38  (161)
 21 >3ggo_A Prephenate dehydrogena  71.4     7.3 0.00022   19.1   4.9   36    1-37     33-68  (204)
 22 >2yy7_A L-threonine dehydrogen  71.1     7.4 0.00022   19.0   6.0   76    1-76      1-79  (170)
 23 >1zcj_A Peroxisomal bifunction  70.7     7.3 0.00022   19.1   4.4   35    1-36     20-54  (202)
 24 >2nm0_A Probable 3-oxacyl-(acy  70.5     7.6 0.00023   18.9   9.6   76    1-76     20-98  (253)
 25 >1nns_A L-asparaginase II; ami  70.2     7.7 0.00023   18.9   4.7   54    3-67     12-65  (125)
 26 >1wdk_A Fatty oxidation comple  69.6     6.9  0.0002   19.2   4.1   35    1-36      3-37  (187)
 27 >2p4q_A 6-phosphogluconate deh  68.2     1.3   4E-05   24.0   0.2  148    1-166    10-169 (180)
 28 >3dii_A Short-chain dehydrogen  68.0     8.6 0.00025   18.6   7.9   83    1-83      1-92  (247)
 29 >2vns_A Metalloreductase steap  66.3     9.2 0.00027   18.4   4.7   51    1-52     28-78  (215)
 30 >3fwz_A Inner membrane protein  66.1     5.8 0.00017   19.8   3.1  119    2-136     7-134 (140)
 31 >2yv2_A Succinyl-COA synthetas  66.1     5.5 0.00016   19.9   3.0   22  106-127   107-128 (129)
 32 >2a35_A Hypothetical protein P  65.6     9.5 0.00028   18.3   4.5   38    1-38      5-42  (215)
 33 >1vm6_A DHPR, dihydrodipicolin  65.5     9.6 0.00028   18.3   5.2   76    1-76     12-88  (142)
 34 >4pga_A Glutaminase-asparagina  65.3     9.7 0.00029   18.2   4.4  103    3-119    12-125 (126)
 35 >2hmt_A YUAA protein; RCK, KTN  64.9     6.4 0.00019   19.4   3.2   72    3-75      7-80  (144)
 36 >2g1u_A Hypothetical protein T  64.7     9.9 0.00029   18.2   4.5  118    3-136    20-146 (155)
 37 >1rkx_A CDP-glucose-4,6-dehydr  62.9      11 0.00032   18.0   7.2   74    2-75     10-90  (357)
 38 >2oho_A Glutamate racemase; is  62.6      11 0.00032   17.9   4.9   71    2-75     13-84  (142)
 39 >2bka_A CC3, TAT-interacting p  62.5      11 0.00032   17.9   4.6   74    1-76     18-95  (242)
 40 >3llv_A Exopolyphosphatase-rel  62.4      11 0.00032   17.9   4.2   71    1-72      5-77  (141)
 41 >2qf7_A Pyruvate carboxylase p  62.1      11 0.00033   17.9   4.4   66    4-69     16-97  (124)
 42 >2pk3_A GDP-6-deoxy-D-LYXO-4-h  61.7      11 0.00032   17.9   3.8  244    3-268    14-267 (321)
 43 >3i83_A 2-dehydropantoate 2-re  61.5      11 0.00033   17.8   4.4   36    1-37      1-37  (179)
 44 >3dhn_A NAD-dependent epimeras  61.2      11 0.00034   17.8   4.1   37    1-37      4-40  (227)
 45 >2yv1_A Succinyl-COA ligase [A  61.0     4.7 0.00014   20.4   1.9   23    3-25     15-37  (128)
 46 >2jjm_A Glycosyl transferase,   59.4      12 0.00036   17.6   4.1   71    1-71     14-105 (216)
 47 >2jfq_A Glutamate racemase; ce  59.1      12 0.00037   17.5   4.2   71    2-75     23-94  (174)
 48 >3egl_A DEGV family protein; a  58.6      13 0.00037   17.5   3.9   66    1-73      3-70  (136)
 49 >2zyd_A 6-phosphogluconate deh  58.5      13 0.00037   17.5   4.4  154    1-166    15-173 (186)
 50 >2d59_A Hypothetical protein P  57.0      13  0.0004   17.3   6.8   74    2-75     23-111 (144)
 51 >3gpi_A NAD-dependent epimeras  56.2      14 0.00041   17.2   5.0   76    1-76      1-111 (286)
 52 >3c1o_A Eugenol synthase; phen  56.0      14 0.00041   17.2   5.2   35    1-35      4-38  (321)
 53 >1wsa_A Asparaginase, asparagi  54.2      15 0.00044   17.0   4.7   33    3-35     12-44  (125)
 54 >1y81_A Conserved hypothetical  54.0      14 0.00041   17.2   3.3   74    2-75     15-103 (138)
 55 >3dmy_A Protein FDRA; predicte  53.9     7.8 0.00023   18.9   2.0   69   44-142    39-107 (132)
 56 >2csu_A 457AA long hypothetica  53.8     8.7 0.00026   18.6   2.3   75    2-76      9-100 (126)
 57 >2zkl_A Capsular polysaccharid  53.5      15 0.00045   16.9   5.0   74    3-76      2-95  (130)
 58 >1o7j_A L-asparaginase; atomic  53.4      12 0.00037   17.5   3.0  102    3-119    12-119 (120)
 59 >2nu8_A Succinyl-COA ligase [A  53.3      11 0.00034   17.8   2.8  106    3-128     9-122 (122)
 60 >1uay_A Type II 3-hydroxyacyl-  53.3      15 0.00045   16.9   4.7   37    1-37      1-38  (242)
 61 >1r0k_A 1-deoxy-D-xylulose 5-p  52.7      12 0.00034   17.7   2.7   31    3-33      6-36  (150)
 62 >2duw_A Putative COA-binding p  52.5      15 0.00045   16.9   3.4   74    2-75     14-104 (145)
 63 >2d1y_A Hypothetical protein T  52.3      16 0.00047   16.8  13.6  168    2-178     6-181 (256)
 64 >1id1_A Putative potassium cha  52.2      16 0.00047   16.8   4.3  123    1-137     2-135 (153)
 65 >3ist_A Glutamate racemase; st  52.2      16 0.00047   16.8   4.5   71    2-75      6-77  (157)
 66 >1ff9_A Saccharopine reductase  51.6      16 0.00048   16.7   4.3  119    2-130     3-125 (175)
 67 >2iz1_A 6-phosphogluconate deh  51.5      16 0.00048   16.7   4.7  146    1-166     3-163 (178)
 68 >1xq6_A Unknown protein; struc  51.5      16 0.00048   16.7   4.8   71    1-73      4-77  (253)
 69 >1f0y_A HCDH, L-3-hydroxyacyl-  51.3      16 0.00049   16.7   4.6   35    1-36     15-49  (204)
 70 >2rc3_A CBS domain; in SITU pr  51.1      16 0.00046   16.9   3.2   35  158-196    12-46  (57)
 71 >3i6i_A Putative leucoanthocya  50.9      17 0.00049   16.7   5.2   76    1-76     10-121 (346)
 72 >1vi2_A Shikimate 5-dehydrogen  50.4      17  0.0005   16.6   5.5  116    2-125     4-133 (135)
 73 >2dzd_A Pyruvate carboxylase;   49.9      15 0.00043   17.0   2.9   70    4-74      8-87  (110)
 74 >3a28_C L-2.3-butanediol dehyd  49.0      18 0.00053   16.5   4.2  166    1-177     1-185 (258)
 75 >3ic5_A Putative saccharopine   48.8      18 0.00053   16.4   4.0   72    2-75      5-79  (101)
 76 >3l83_A Glutamine amido transf  48.6      18 0.00053   16.4   3.5   35    1-35      3-38  (250)
 77 >2q1w_A Putative nucleotide su  48.5      18 0.00054   16.4   8.9   76    1-76     21-100 (333)
 78 >2p5y_A UDP-glucose 4-epimeras  47.8      19 0.00055   16.3   6.2  170    3-186     2-179 (311)
 79 >2qip_A Protein of unknown fun  46.6      19 0.00057   16.2   3.3   54  110-176    63-116 (165)
 80 >2vpq_A Acetyl-COA carboxylase  46.4      19 0.00058   16.2   3.8   64    6-69      5-77  (104)
 81 >3eyw_A C-terminal domain of g  45.9      20 0.00059   16.1   4.4   73    1-74      3-77  (123)
 82 >1qdl_B Protein (anthranilate   45.3      20  0.0006   16.1   5.1   36    1-36      1-36  (195)
 83 >3dzb_A Prephenate dehydrogena  44.8      21 0.00061   16.0   3.7   36    1-37      5-40  (205)
 84 >2vvt_A Glutamate racemase; is  44.7      21 0.00061   16.0   4.5   70    3-75     26-96  (179)
 85 >1vpd_A Tartronate semialdehyd  44.6      21 0.00061   16.0   4.5  157    1-170     4-166 (167)
 86 >2pn1_A Carbamoylphosphate syn  44.4      21 0.00062   16.0   7.5   95    3-127     6-104 (104)
 87 >2vdc_G Glutamate synthase [NA  44.4      21 0.00062   16.0   5.1   65    2-67      7-72  (157)
 88 >1oi7_A Succinyl-COA synthetas  44.1      21 0.00062   16.0   3.5  105    3-128     9-122 (122)
 89 >1ulz_A Pyruvate carboxylase N  43.6      22 0.00064   15.9   3.3   73    1-74      1-81  (104)
 90 >1bg6_A N-(1-D-carboxylethyl)-  43.5      22 0.00064   15.9   4.6   34    1-35      4-37  (195)
 91 >3ghy_A Ketopantoate reductase  43.4      22 0.00064   15.9   4.7   35    1-36      3-37  (198)
 92 >2whl_A Beta-mannanase, baman5  43.1      22 0.00065   15.9   3.5   36  236-271   206-242 (258)
 93 >1iuk_A Hypothetical protein T  42.8      22 0.00065   15.8   5.3   74    2-75     14-104 (140)
 94 >1yco_A Branched-chain phospho  42.4      22 0.00066   15.8   8.9   76    1-76      1-79  (127)
 95 >3l4b_C TRKA K+ channel protie  42.3      22 0.00066   15.8   3.9   66    6-72      4-72  (117)
 96 >2zvr_A Uncharacterized protei  42.2      23 0.00067   15.8   3.2   35  216-250   228-264 (290)
 97 >3egq_A TETR family transcript  41.9      19 0.00057   16.3   2.5   53  106-158     6-58  (69)
 98 >1i36_A Conserved hypothetical  41.7      23 0.00068   15.7   4.2   38    3-41      2-39  (152)
 99 >1jay_A Coenzyme F420H2:NADP+   40.9      24  0.0007   15.6   3.9   35    3-37      2-36  (212)
100 >1cs1_A CGS, protein (cystathi  40.8      24  0.0007   15.6   5.1   56  219-274   114-172 (246)
101 >2b69_A UDP-glucuronate decarb  40.8      24  0.0007   15.6   5.2   39    1-39     27-65  (198)
102 >1uzm_A 3-oxoacyl-[acyl-carrie  40.6      24 0.00071   15.6   9.6  182    1-182    14-246 (247)
103 >1i60_A IOLI protein; beta bar  40.2      24 0.00071   15.6   3.5  202    3-249     2-246 (278)
104 >1rpn_A GDP-mannose 4,6-dehydr  40.0      24 0.00072   15.6   6.7   75    1-75     14-96  (189)
105 >3hno_A Pyrophosphate-dependen  39.9      24 0.00072   15.5   5.4  107    1-136     3-148 (211)
106 >3k96_A Glycerol-3-phosphate d  39.7      25 0.00073   15.5   4.6   33    1-34     29-61  (204)
107 >3bqs_A Uncharacterized protei  39.2      20 0.00058   16.2   2.2   19  226-244     8-26  (93)
108 >1iow_A DD-ligase, DDLB, D-ALA  38.8      25 0.00075   15.4   5.3   68    1-68      1-83  (100)
109 >1a8q_A Bromoperoxidase A1; ha  38.7      25 0.00075   15.4   5.1   63    9-74     30-93  (195)
110 >2qtq_A Transcriptional regula  38.6      17  0.0005   16.6   1.8   54  106-159    18-71  (81)
111 >2fd5_A Transcriptional regula  38.1      26 0.00077   15.4   3.8   50  106-155     9-58  (75)
112 >1xhc_A NADH oxidase /nitrite   38.0      26 0.00077   15.3   3.5   56    6-70      4-59  (87)
113 >3c85_A Putative glutathione-r  37.8      18 0.00055   16.4   1.9  119    3-137    40-169 (183)
114 >3hbl_A Pyruvate carboxylase;   37.7      26 0.00078   15.3   6.1   66    4-69      6-81  (107)
115 >3dew_A Transcriptional regula  37.6      14  0.0004   17.2   1.2   53  106-158    10-62  (72)
116 >2bll_A Protein YFBG; decarbox  37.4      27 0.00079   15.3   5.3   74    3-76      2-78  (345)
117 >1zuw_A Glutamate racemase 1;   37.4      27 0.00079   15.3   4.6   70    3-75      5-76  (160)
118 >3bqz_B HTH-type transcription  37.4      18 0.00052   16.5   1.7   49  106-154     4-52  (71)
119 >1evy_A Glycerol-3-phosphate d  37.3      21 0.00062   16.0   2.1  152    1-166    15-190 (199)
120 >2of7_A Putative TETR-family t  36.7      11 0.00034   17.7   0.7   46  105-150    49-94  (95)
121 >1sb8_A WBPP; epimerase, 4-epi  36.7      27 0.00081   15.2   6.0   37    1-37     27-63  (352)
122 >2hqm_A GR, grase, glutathione  36.1      28 0.00082   15.1   5.0   56    5-68      5-60  (64)
123 >2c5a_A GDP-mannose-3', 5'-epi  36.0      28 0.00083   15.1   6.9   74    2-75     30-104 (379)
124 >3gaa_A Uncharacterized protei  36.0      28 0.00083   15.1   4.7   77   54-132   107-190 (252)
125 >2d1p_B TUSC, hypothetical UPF  35.8      28 0.00083   15.1   2.6   39    1-39      1-46  (119)
126 >2cfc_A 2-(R)-hydroxypropyl-CO  35.7      28 0.00084   15.1   4.9   72    1-72      1-87  (250)
127 >3dfu_A Uncharacterized protei  35.4      22 0.00066   15.8   2.0  116    1-125     6-129 (132)
128 >2g5c_A Prephenate dehydrogena  35.1      29 0.00086   15.0   4.9   34    2-36      2-35  (172)
129 >2hy5_B Intracellular sulfur o  34.6      16 0.00048   16.7   1.2   37    1-37      5-48  (136)
130 >3kd9_A Coenzyme A disulfide r  34.4      30 0.00088   15.0   6.3   56    4-67     30-85  (120)
131 >1geg_A Acetoin reductase; SDR  34.3      30 0.00088   15.0   4.8  165    1-177     1-183 (256)
132 >1vl0_A DTDP-4-dehydrorhamnose  34.2      30 0.00088   15.0   2.7   37    1-37     12-48  (292)
133 >3fiw_A Putative TETR-family t  34.0      23 0.00068   15.7   1.9   52  103-154    24-75  (88)
134 >2jah_A Clavulanic acid dehydr  34.0      30 0.00089   14.9  12.0  176    2-180     7-247 (247)
135 >1oc2_A DTDP-glucose 4,6-dehyd  33.9      30 0.00089   14.9   6.0   74    1-76      4-86  (329)
136 >2qs7_A Uncharacterized protei  33.3      31 0.00091   14.9   5.2   33    1-33      7-44  (144)
137 >1yq2_A Beta-galactosidase; gl  33.1      31 0.00092   14.8   3.9   81   53-166    39-120 (299)
138 >1rkt_A Protein YFIR; transcri  33.1      31 0.00091   14.9   2.4   48  106-153    14-61  (82)
139 >1u1j_A 5-methyltetrahydropter  32.8      31 0.00093   14.8   4.3   89   70-163     6-97  (142)
140 >2pw9_A Putative formate dehyd  32.8      31 0.00093   14.8   9.7  107  154-279   104-216 (237)
141 >2pzm_A Putative nucleotide su  32.8      31 0.00093   14.8   2.4   68    2-69     21-92  (184)
142 >1wcn_A Transcription elongati  32.6      25 0.00075   15.4   1.9   22  225-246    10-31  (70)
143 >1agx_A Glutaminase-asparagina  32.5      32 0.00094   14.8   3.4  103    3-119    13-126 (127)
144 >1tqh_A Carboxylesterase precu  32.5      32 0.00094   14.8   3.8   72    4-75     19-94  (247)
145 >2dpo_A L-gulonate 3-dehydroge  32.5      32 0.00094   14.8   4.8   35    1-36      6-40  (190)
146 >3b81_A Transcriptional regula  32.4      19 0.00057   16.2   1.3   47  107-153    14-60  (80)
147 >1jdw_A L-arginine\:glycine am  32.2      28 0.00083   15.1   2.1   18  111-128    27-44  (50)
148 >3e48_A Putative nucleoside-di  32.0      32 0.00096   14.7   4.0   75    2-76      1-108 (289)
149 >2ras_A Transcriptional regula  31.9      28 0.00082   15.2   2.0   48  106-153    13-60  (66)
150 >1lss_A TRK system potassium u  31.7      33 0.00097   14.7   4.7   40    2-41      4-43  (140)
151 >2ef7_A Hypothetical protein S  31.5      33 0.00097   14.7   3.2   37  159-199    25-61  (77)
152 >1bwd_A ADT, protein (inosamin  31.4      30 0.00088   15.0   2.1   18  111-128    27-44  (50)
153 >1ko7_A HPR kinase/phosphatase  31.3      25 0.00075   15.4   1.7   43  233-278    71-113 (129)
154 >2pfi_A Chloride channel prote  31.3      33 0.00098   14.6   3.6   38  158-199    13-50  (67)
155 >2w70_A Biotin carboxylase; li  31.1      33 0.00099   14.6   3.6   69    1-69      1-78  (105)
156 >3h2s_A Putative NADH-flavin r  31.0      34 0.00099   14.6   3.5   35    2-36      1-35  (224)
157 >2g0w_A LMO2234 protein; 16411  30.9      34   0.001   14.6   2.9   16  232-247   241-256 (296)
158 >3l6d_A Putative oxidoreductas  30.7      34   0.001   14.6   4.6  153    1-166     9-162 (168)
159 >1nba_A N-carbamoylsarcosine a  30.6      15 0.00044   17.0   0.4   77   56-139   116-198 (226)
160 >1vkm_A Conserved hypothetical  30.3      33 0.00097   14.7   2.1  126   16-150    48-206 (297)
161 >2i10_A Putative TETR transcri  30.2      14 0.00041   17.2   0.2   50  104-153    11-60  (68)
162 >1t94_A Polymerase (DNA direct  30.1      22 0.00065   15.8   1.2   19  226-244    16-34  (70)
163 >2j9l_A Chloride channel prote  29.7      35   0.001   14.5   3.2   35  158-196    14-48  (71)
164 >1r89_A TRNA nucleotidyltransf  29.5      32 0.00096   14.7   2.0   61   54-133     9-69  (137)
165 >2oos_A Enoyl-acyl carrier red  29.5      36  0.0011   14.4   4.9   35    2-36     10-47  (338)
166 >1yqz_A Coenzyme A disulfide r  29.3      36  0.0011   14.4   5.4   56    5-68     29-84  (115)
167 >3ju2_A Uncharacterized protei  29.1      16 0.00047   16.8   0.4  204    3-249     7-249 (284)
168 >2yrx_A Phosphoribosylglycinam  28.8      36  0.0011   14.4   6.0  107    4-123    23-137 (379)
169 >1db3_A GDP-mannose 4,6-dehydr  28.6      37  0.0011   14.3   4.4   74    2-75      2-88  (190)
170 >3icj_A Uncharacterized metal-  28.4      37  0.0011   14.3   3.3   27  166-196    51-77  (144)
171 >2je8_A Beta-mannosidase; glyc  28.3      37  0.0011   14.3   4.1   20   52-71     45-64  (347)
172 >2pd4_A Enoyl-[acyl-carrier-pr  28.3      37  0.0011   14.3   4.9   36    2-37      6-44  (275)
173 >3ius_A Uncharacterized conser  28.2      37  0.0011   14.3   4.1   75    1-75      4-104 (286)
174 >3dk9_A Grase, GR, glutathione  27.5      38  0.0011   14.2   6.0   58    2-67      2-59  (62)
175 >1qtw_A Endonuclease IV; DNA r  27.2      20 0.00058   16.2   0.6   66    2-72      2-67  (285)
176 >1kew_A RMLB;, DTDP-D-glucose   27.0      39  0.0012   14.2   7.0  175    3-187     2-204 (342)
177 >1t2a_A GDP-mannose 4,6 dehydr  27.0      39  0.0012   14.2   6.7   76    1-76     24-113 (207)
178 >1ulu_A Enoyl-acyl carrier pro  26.9      39  0.0012   14.1   4.8  184    2-188     8-261 (261)
179 >2zuo_A MVP, major vault prote  26.5      13 0.00038   17.4  -0.5   15  228-242    40-54  (101)
180 >2ahr_A Putative pyrroline car  26.5      40  0.0012   14.1   3.9   39    2-41      4-42  (187)
181 >2p10_A MLL9387 protein; NP_08  26.5      38  0.0011   14.2   1.9   63  187-254   167-237 (261)
182 >1qyc_A Phenylcoumaran benzyli  26.3      40  0.0012   14.1   4.6   74    3-76      6-115 (308)
183 >1b22_A DNA repair protein RAD  26.3      31 0.00093   14.8   1.5   13   56-68     36-48  (114)
184 >1mo9_A ORF3; nucleotide bindi  26.2      40  0.0012   14.1   5.3   56    4-67     24-79  (120)
185 >2opt_A Actii protein; helical  26.1      22 0.00064   15.9   0.6   49  105-153     7-55  (67)
186 >2qcu_A Aerobic glycerol-3-pho  26.0      41  0.0012   14.0   3.2   34    1-34      1-35  (171)
187 >1gee_A Glucose 1-dehydrogenas  25.8      41  0.0012   14.0   4.0   75    2-76      7-96  (261)
188 >2bw0_A 10-FTHFDH, 10-formylte  25.6      41  0.0012   14.0   2.3  118    1-125    20-157 (232)
189 >1pbj_A Hypothetical protein;   25.6      42  0.0012   14.0   3.2   34  159-196    19-52  (58)
190 >2zb9_A Putative transcription  25.5      42  0.0012   14.0   2.8   50  106-155    25-74  (85)
191 >2a9g_A Arginine deiminase; ar  25.4      42  0.0012   14.0   4.6   39  241-279   139-178 (182)
192 >3bmj_A Pteridine reductase; P  25.3      42  0.0012   13.9   3.4   81    2-82     23-118 (288)
193 >2cb1_A O-acetyl homoserine su  25.1      42  0.0013   13.9   3.6   56  219-274   117-175 (277)
194 >1yx1_A Hypothetical protein P  24.8      43  0.0013   13.9   3.5  208    1-250     5-231 (264)
195 >2raf_A Putative dinucleotide-  24.4      44  0.0013   13.8   4.6   40    2-42     20-59  (209)
196 >3k31_A Enoyl-(acyl-carrier-pr  24.4      44  0.0013   13.8   4.8   36    2-37     30-68  (296)
197 >2h29_A Probable nicotinate-nu  23.7      45  0.0013   13.8   2.0   71    1-71      1-77  (189)
198 >2fq4_A Transcriptional regula  23.7      26 0.00076   15.4   0.7   48  106-153    14-61  (73)
199 >1fmc_A 7 alpha-hydroxysteroid  23.7      45  0.0013   13.8   7.2  164    2-176    11-189 (255)
200 >3gem_A Short chain dehydrogen  23.5      45  0.0013   13.7   4.2   37    2-38     27-64  (260)
201 >1qsg_A Enoyl-[acyl-carrier-pr  23.4      46  0.0013   13.7  11.4   81    2-82      9-104 (265)
202 >2z1m_A GDP-D-mannose dehydrat  23.3      46  0.0014   13.7   4.9   75    2-76      4-86  (178)
203 >2csu_A 457AA long hypothetica  23.2      46  0.0014   13.7   2.7  111    2-126    24-148 (148)
204 >1zmd_A Dihydrolipoyl dehydrog  23.1      46  0.0014   13.7   5.7   57    5-68     23-79  (120)
205 >2c29_D Dihydroflavonol 4-redu  23.1      46  0.0014   13.7   2.8   75    1-75      5-89  (337)
206 >1vdd_A Recombination protein   22.6      45  0.0013   13.7   1.7   14   94-107    25-38  (66)
207 >3g79_A NDP-N-acetyl-D-galacto  22.5      47  0.0014   13.6   5.9  162    1-164    18-217 (227)
208 >1zq1_A Glutamyl-tRNA(Gln) ami  22.4      47  0.0014   13.6   4.6  103    3-120     3-119 (135)
209 >3jrx_A Acetyl-COA carboxylase  22.4      48  0.0014   13.6   2.7   28    6-33     60-96  (169)
210 >1qyd_A Pinoresinol-lariciresi  22.4      48  0.0014   13.6   4.5   71    3-75      6-86  (313)
211 >1tks_A 3,4-dihydroxy-2-butano  22.4      48  0.0014   13.6   2.9   46  232-277   147-197 (204)
212 >3him_A Probable transcription  22.4      48  0.0014   13.6   2.6   48  106-153    18-65  (211)
213 >2bi7_A UDP-galactopyranose mu  22.3      48  0.0014   13.6   3.7   76    1-87      1-88  (119)
214 >2d6y_A Putative TETR family r  22.3      48  0.0014   13.6   2.4   51  106-156    10-60  (74)
215 >3grk_A Enoyl-(acyl-carrier-pr  22.2      48  0.0014   13.6   4.8  168    2-180    31-217 (293)
216 >2gag_A Heterotetrameric sarco  22.1      48  0.0014   13.5   3.2   34    5-38     52-85  (148)
217 >1jvn_A Glutamine, bifunctiona  22.1      48  0.0014   13.5   3.7   36    1-36      4-39  (218)
218 >3fio_A A cystathionine beta-s  21.8      49  0.0014   13.5   4.6   38  158-199    12-49  (70)
219 >3cgb_A Pyridine nucleotide-di  21.8      49  0.0014   13.5   4.5   25   50-74     12-36  (120)
220 >1j2r_A Hypothetical isochoris  21.6     9.6 0.00028   18.3  -1.9  112   16-134    50-199 (199)
221 >3hu5_A Isochorismatase family  21.5      20 0.00058   16.2  -0.3   77   56-139   116-198 (204)
222 >1pjq_A CYSG, siroheme synthas  21.3      50  0.0015   13.4   4.5   33    3-35     13-45  (108)
223 >1gpw_B Amidotransferase HISH;  21.2      50  0.0015   13.4   2.3   44    3-46      2-45  (201)
224 >2qko_A Possible transcription  21.1      49  0.0014   13.5   1.6   49  105-153    29-77  (215)
225 >1zuw_A Glutamate racemase 1;   21.1      50  0.0015   13.4   4.2   81    1-83     14-97  (112)
226 >2ekp_A 2-deoxy-D-gluconate 3-  21.0      51  0.0015   13.4  12.5  166    1-176     1-174 (239)
227 >1e7w_A Pteridine reductase; d  21.0      51  0.0015   13.4   4.0   35    2-36      9-44  (291)
228 >1q0q_A 1-deoxy-D-xylulose 5-p  20.9      51  0.0015   13.4   5.6   40    1-40      9-48  (133)
229 >2gqw_A Ferredoxin reductase;   20.9      51  0.0015   13.4   6.3   57    5-68     29-85  (116)
230 >3c24_A Putative oxidoreductas  20.8      51  0.0015   13.4   4.1   66    1-67     11-93  (195)
231 >3ccy_A Putative TETR-family t  20.8      51  0.0015   13.4   2.9   48  106-153    16-63  (203)
232 >2dgd_A 223AA long hypothetica  20.8      51  0.0015   13.4   2.4   20  110-129    15-34  (95)
233 >1yac_A Ycacgp, YCAC gene prod  20.7      31 0.00091   14.9   0.5  138   16-160    42-203 (208)
234 >1xp3_A Endonuclease IV; NFO,   20.7      51  0.0015   13.4   2.2   69    2-75     11-81  (307)
235 >2eq6_A Pyruvate dehydrogenase  20.6      52  0.0015   13.3   5.4   56    5-68     24-79  (119)
236 >2g7l_A TETR-family transcript  20.6      52  0.0015   13.3   1.9   50  104-153    19-68  (243)
237 >3bga_A Beta-galactosidase; NY  20.6      52  0.0015   13.3   4.1   26   51-76     36-61  (237)
238 >3dfz_A SIRC, precorrin-2 dehy  20.5      52  0.0015   13.3   3.6   31    4-34     33-63  (126)
239 >2r6j_A Eugenol synthase 1; ph  20.5      52  0.0015   13.3   5.0   69    2-72     12-86  (318)
240 >1tqj_A Ribulose-phosphate 3-e  20.5      52  0.0015   13.3   3.2   33    6-38     11-43  (230)
241 >1zk8_A Transcriptional regula  20.5      52  0.0015   13.3   1.9   49  105-153     9-57  (183)
242 >3dqp_A Oxidoreductase YLBE; a  20.1      53  0.0016   13.3   7.4  166    2-181     1-203 (219)
243 >1fmt_A Methionyl-tRNA FMet fo  20.1      53  0.0016   13.3   4.4  118    5-129     6-143 (204)

No 1  
>>1zcz_A Bifunctional purine biosynthesis protein PURH; TM1249; HET: PG4; 1.88A {Thermotoga maritima} (A:336-464)
Probab=97.02  E-value=0.013  Score=37.67  Aligned_cols=117  Identities=17%  Similarity=0.111  Sum_probs=78.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECC
Q ss_conf             33455465323478899899999973326722599981974889625342179999999754312345667718999348
Q gi|254780768|r  139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCK  218 (281)
Q Consensus       139 G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~~~~~~~~~~~~~ilvK~~K  218 (281)
                      .+.|.++|++++++|..++|.+.+..-+--|   +++.+|..+++=+-+=.-.-=.|.+- .+.+.  .-.|.++.    
T Consensus         5 ~vvt~~~p~~~~~~dl~Fa~~v~k~~kSNAI---~~~~~g~~~gig~Gq~srv~~~~~a~-~~a~~--~l~g~vla----   74 (129)
T 1zcz_A            5 ELVVGEPLSEKELEDLEFAYRVVEGAKSNAV---LIAKDGVTVGIGSGQPSRKRAAWIAT-VMAGE--KAKGAVAA----   74 (129)
T ss_dssp             EEEESCCCCHHHHHHHHHHHHHHHHSCSSCE---EEEETTEEEEEECSCSSHHHHHHHHH-HHHGG--GGTTCEEE----
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCE---EEECCCCEEEECCCCCCHHHHHHHHH-HHHHH--HCCCEEEE----
T ss_conf             0134789866666769999999976786757---99639938976889667799999999-98510--21787999----


Q ss_pred             CCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEE
Q ss_conf             88753121066279999999984990999973977998589999999987968999
Q gi|254780768|r  219 SQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       219 ~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g  274 (281)
                            -|=.-=-+++|+.++++|.+.|+ +.|+++  --+++|+.||++||.++=
T Consensus        75 ------SDAFFPF~D~v~~A~~~GV~~Ii-qPgGSi--rD~evI~aane~gi~mvf  121 (129)
T 1zcz_A           75 ------SDAFFPFPDSLEILAQAGVKAVV-APLGSI--RDEEVIEKARELGITFYK  121 (129)
T ss_dssp             ------ESSCCSSHHHHHHHHHTTCCEEE-ECCCCT--THHHHHHHHHHHTCEEEE
T ss_pred             ------ECCCCCCCHHHHHHHHCCCEEEE-CCCCCC--CHHHHHHHHHHHCCEEEE
T ss_conf             ------45687875589999983994999-798743--619999999975988998


No 2  
>>1g8m_A Aicar transformylase-IMP cyclohydrolase; homodimer, 2 functional domains, IMPCH domain = alpha/beta/alpha; HET: G; 1.75A {Gallus gallus} (A:398-593)
Probab=95.95  E-value=0.016  Score=36.95  Aligned_cols=129  Identities=12%  Similarity=0.047  Sum_probs=84.3

Q ss_pred             CCC-CCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHH-----HHHHHHHHHHHHCCC----C--
Q ss_conf             334-5546532347889989999997332672259998197488962534217-----999999975431234----5--
Q gi|254780768|r  139 GSL-GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTD-----SMLQRIVDCRNNGRI----L--  206 (281)
Q Consensus       139 G~l-~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD-----~mi~R~~~~~~~~~~----~--  206 (281)
                      +++ +.+.|++++++|+.+++++++..-+.-|   +.++++.++++-+.+=-+     ....++.........    +  
T Consensus         6 ~vVv~~r~~teee~~dL~fA~~vlk~~Ksn~I---~~~k~~~~vg~G~gQ~sRvd~~~~a~~Ka~t~~~~t~~~~a~l~F   82 (196)
T 1g8m_A            6 NIVTKNKTLPESAVRDLIVASIAVKYTQSNSV---CYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSXKF   82 (196)
T ss_dssp             CBCSSSCCCCHHHHHHHHHHHHHHHTSCSSCE---EEEETTEEEEEECSCSCHHHHHHHHHHHHHHHHHTTCHHHHTCEE
T ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHCCCCCCEE---EEEECCEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCHHHCCCC
T ss_conf             21134668978889899999997255777579---998499799767887656789999999998876521602210000


Q ss_pred             C-------CCCEEEE-----------EECCCCCCCEEEECCCC-----------------------HHHHHHHHHCCCEE
Q ss_conf             6-------6771899-----------93488875312106627-----------------------99999999849909
Q gi|254780768|r  207 A-------GKSGVLV-----------KMCKSQQDMRADLPSIG-----------------------AKTVQNVIKAGLAG  245 (281)
Q Consensus       207 ~-------~~~~ilv-----------K~~K~~QD~r~DlP~IG-----------------------~~Ti~~~~~ag~~g  245 (281)
                      +       ..+.+.+           ...-.+|..|+|-|-+.                       +++|+.++++|.+.
T Consensus        83 a~~V~k~~kSNAivi~~~gs~~D~~~ig~g~g~~~r~~~~~~~~~~~~~~~~~~g~v~aSDaFFPF~D~i~~a~~~Gv~a  162 (196)
T 1g8m_A           83 KAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAXFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQF  162 (196)
T ss_dssp             CTTCCHHHHHHHHHHHHHTCSCSTHHHHHHHTTEEECCCCCCHHHHHHHHTTCCCEEEEESSCCSSTHHHHHHHTTTEEE
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHCCCCE
T ss_conf             12200344332355530344221013344332012354210156666554124785798014778754899999839909


Q ss_pred             EEEECCCEEEECHHHHHHHHHHCCCEEE
Q ss_conf             9997397799858999999998796899
Q gi|254780768|r  246 IALEAGKSLVLEKELVKKHADEAGIFVC  273 (281)
Q Consensus       246 iaiea~~~lild~~~~i~~a~~~~i~i~  273 (281)
                      |+ +.|+++  --+++|+.||++||..+
T Consensus       163 ii-qPGGS~--rD~~vi~a~~~~gi~m~  187 (196)
T 1g8m_A          163 IV-APSGSA--ADEVVIEACNELGITLI  187 (196)
T ss_dssp             EE-EECCCT--THHHHHHHHHHHTCEEE
T ss_pred             EE-CCCCCC--CHHHHHHHHHHHCCEEE
T ss_conf             98-798743--66999999997298899


No 3  
>>3pfk_A Phosphofructokinase; transferase(phosphotransferase); 2.40A {Bacillus stearothermophilus} (A:1-131,A:251-305)
Probab=94.61  E-value=0.37  Score=27.76  Aligned_cols=143  Identities=19%  Similarity=0.118  Sum_probs=96.6

Q ss_pred             CCEEEEEECCCCHHH------HHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEE------------------------
Q ss_conf             973999977980389------99999997899789999548667310388567873------------------------
Q gi|254780768|r    1 MKRLLIIAGSGMLPY------YVAKAARLKNDEPVIASVLNECSFDWQDFECRELP------------------------   50 (281)
Q Consensus         1 M~kigIIAG~G~LP~------~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~------------------------   50 (281)
                      |+||||+-+.|.=|-      .+.+.+...|++++-+. .|..  -+-+-....++                        
T Consensus         1 mKrI~IltsGGdaPGlNa~Ir~vv~~a~~~g~ev~G~~-~G~~--GL~~~~~~~l~~~~v~~i~~~GGt~LgtsR~~~~~   77 (186)
T 3pfk_A            1 MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVY-HGYA--GLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFK   77 (186)
T ss_dssp             CCEEEEEEESSCCTTHHHHHHHHHHHHHHTTCEEEEES-SHHH--HHHTTCEEEECGGGGTTCTTCCSCTTCCCCCGGGS
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEC-CCHH--HHCCCCCCCCCHHHHHHHHHCCCCHHCCCCCCCCC
T ss_conf             98899987688768999999999999997799999984-1568--75679951599899987986485110458888654


Q ss_pred             -HHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHH
Q ss_conf             -8999999999986495406770242321000111026035789999998751048035899999999976974821122
Q gi|254780768|r   51 -LGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHE  129 (281)
Q Consensus        51 -ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~  129 (281)
                       -....++.+.|++++++.++.+|                               ||++.=.  +..|.+.|+.+++.-.
T Consensus        78 ~~~~~~~~~~~l~~~~Id~LivIG-------------------------------GdgS~~~--a~~L~e~gi~vigiPk  124 (186)
T 3pfk_A           78 TEEGQKKGIEQLKKHGIQGLVVIG-------------------------------GDGSYQG--AKKLTEHGFPCVGVPG  124 (186)
T ss_dssp             SHHHHHHHHHHHHHHTCCEEEEEE-------------------------------CHHHHHH--HHHHHHTTCCEEEEEB
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEEC-------------------------------CCHHHHH--HHHHHHCCCCEEEEEE
T ss_conf             310155799999983676599945-------------------------------8479999--9998733675553111


Q ss_pred             CCHHHCCCCCCCCCCCCCHHHHH-HHHHHHHHHHHHCCCCCEEEEEEECCEEEEE
Q ss_conf             25242035433455465323478-8998999999733267225999819748896
Q gi|254780768|r  130 IVPELLVQVGSLGTCVPNRDVKR-DILAAMKSAEALSELDVGQSAVSIGGRVVAL  183 (281)
Q Consensus       130 ~l~~ll~~~G~l~~~~p~~~~~~-dI~~g~~i~~~l~~~DiGQsvVv~~g~Viai  183 (281)
                      =..+-++..|    -.|+..|+- -..+|....+.+..=.-|+-|..+++.+..+
T Consensus       125 TIDNDi~QRG----G~Pta~DRilat~~G~~Av~~i~~g~~~~mv~~~~~~~~~~  175 (186)
T 3pfk_A          125 TIDNDIPQRG----GSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDH  175 (186)
T ss_dssp             CSSCCCTGGC----SCCCHHHHHHHHHHHHHHHHHHHTTCCSEEEEEETTEEEEE
T ss_pred             ECCCCCCHCC----CCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCEEEEE
T ss_conf             2268887607----99977899999999999999997699986999999998997


No 4  
>>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A* (A:1-108)
Probab=94.06  E-value=0.17  Score=30.14  Aligned_cols=73  Identities=16%  Similarity=0.062  Sum_probs=55.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             97399997798038999999997899789999548667310388567873899999999998649540677024
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      |+|| +|.|+|.+.+.+++++++.|++++++.-............+...++-+...+.++-++++++=|++-..
T Consensus        19 ~~ki-lIlG~Gqla~~l~~aa~~lG~~~~~~d~~~~~pa~~~ad~~~~~~~~D~~~i~~~a~~~~~D~I~~e~e   91 (108)
T 2dwc_A           19 AQKI-LLLGSGELGKEIAIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIE   91 (108)
T ss_dssp             CCEE-EEESCSHHHHHHHHHHHHTTCEEEEEESSTTCHHHHHSSEEEESCTTCHHHHHHHHHHHCCSEEEECSS
T ss_pred             CCEE-EEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCEEEECCCCCHHHHHHHHHHCCCCEEEECCC
T ss_conf             8899-999978999999999998799899997989885777456589789999999999998739999996888


No 5  
>>1zxx_A 6-phosphofructokinase; allosteric regulation, lactobacillus bulgaricus, transferase; 1.85A {Lactobacillus delbrueckii subsp} (A:1-131,A:253-303)
Probab=93.71  E-value=0.56  Score=26.58  Aligned_cols=143  Identities=17%  Similarity=0.091  Sum_probs=96.1

Q ss_pred             CCEEEEEECCCCHHH------HHHHHHHHCCCCEEEEEECCCC---C--------CCCCCC---------CE---EEEEH
Q ss_conf             973999977980389------9999999789978999954866---7--------310388---------56---78738
Q gi|254780768|r    1 MKRLLIIAGSGMLPY------YVAKAARLKNDEPVIASVLNEC---S--------FDWQDF---------EC---RELPL   51 (281)
Q Consensus         1 M~kigIIAG~G~LP~------~ia~~~~~~g~~~~ii~l~~~~---~--------~~~~~~---------~~---~~~~i   51 (281)
                      |+||||+-+.|.=|-      -+.+.+...|.+++-+. .|..   +        ....++         ..   .+..-
T Consensus         1 mkrI~IltsGGdaPGlNa~Ir~vv~~a~~~g~~v~G~~-~G~~GL~~~~~~~l~~~~v~~i~~~GGtiLgtsR~~~~~~~   79 (182)
T 1zxx_A            1 MKRIGILTSGGDAPGMNAAVRAVTRVAIANGLEVFGIR-YGFAGLVAGDIFPLESEDVAHLINVSGTFLYSARYPEFAEE   79 (182)
T ss_dssp             CCEEEEEECSSCCTTHHHHHHHHHHHHHTTTCEEEEEC-THHHHHHHTCEEECCGGGGTTCTTCCSCTTCCCCCGGGTSH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEC-CCHHHHCCCCEEECCHHHHHHHHHCCCCCCCCCCCCCCCCH
T ss_conf             98899988578737799999999999997899899987-30687468991779999987677337740135777755555


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCC
Q ss_conf             99999999998649540677024232100011102603578999999875104803589999999997697482112225
Q gi|254780768|r   52 GDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIV  131 (281)
Q Consensus        52 g~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l  131 (281)
                      ....++.+.|++++++.++++|.                               |++.-.  +..|.++|+.+++.-.=.
T Consensus        80 ~~~~~~~~~l~~~~Id~LivIGG-------------------------------dGS~~~--a~~L~~~gi~vIgIPkTI  126 (182)
T 1zxx_A           80 EGQLAGIEQLKKHGIDAVVVIGG-------------------------------DGSYHG--ALQLTRHGFNSIGLPGTI  126 (182)
T ss_dssp             HHHHHHHHHHHHTTCCEEEEEEC-------------------------------HHHHHH--HHHHHHTTCCEEEEEEET
T ss_pred             HHHHHHHHHHHHHCCCEEEEECC-------------------------------CCHHHH--HHHHHHCCCCCCCEEEEE
T ss_conf             66777888998707888999679-------------------------------727999--998754246644302332


Q ss_pred             HHHCCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHCCCCCEEEEEEECCEEEEE
Q ss_conf             2420354334554653234788-998999999733267225999819748896
Q gi|254780768|r  132 PELLVQVGSLGTCVPNRDVKRD-ILAAMKSAEALSELDVGQSAVSIGGRVVAL  183 (281)
Q Consensus       132 ~~ll~~~G~l~~~~p~~~~~~d-I~~g~~i~~~l~~~DiGQsvVv~~g~Viai  183 (281)
                      .      ..+.+-.|+..|+-- -.+|....+.+..=..|.-|..+++.+..+
T Consensus       127 D------NDi~GG~Pta~DRilat~~G~~Av~~i~~g~~~~mv~~~~~~i~~~  173 (182)
T 1zxx_A          127 D------NDIPGGTPTVSDRVLASKLGSEAVHLLLEGKGGLAVGIENGKVTSH  173 (182)
T ss_dssp             T------CCCTCSCCCHHHHHHHHHHHHHHHHHHHTTCCSEEEEEETTEEEEE
T ss_pred             C------CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCEEEEE
T ss_conf             4------8887799998999999999999999998699985999999999996


No 6  
>>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} (A:1-125)
Probab=93.60  E-value=0.32  Score=28.23  Aligned_cols=74  Identities=18%  Similarity=0.086  Sum_probs=58.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             973999977980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      |+|| +|.|+|.+-..+++++++.|++++++.-...+........+..+++-....+.++-++++|+=++.-+.-
T Consensus        11 ~kki-lIiG~G~~~~~l~~~a~~~g~~~~~~~~~~~~~~~~~ad~~~~~~~~d~~~i~~~a~~~~vd~v~~~~~~   84 (125)
T 1kjq_A           11 ATRV-MLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIVPEIEA   84 (125)
T ss_dssp             CCEE-EEESCSHHHHHHHHHHHTTTCEEEEEESSTTCGGGGGSSEEEECCTTCHHHHHHHHHHHCCSEEEECSSC
T ss_pred             CCEE-EEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEECCCCC
T ss_conf             9899-9989789999999999987998999979999826762550687178899999999998399999827762


No 7  
>>1pfk_A Phosphofructokinase; transferase(phosphotransferase); HET: FBP ADP; 2.40A {Escherichia coli} (A:1-132,A:254-306)
Probab=90.71  E-value=1.3  Score=24.15  Aligned_cols=143  Identities=14%  Similarity=0.039  Sum_probs=96.7

Q ss_pred             CCEEEEEECCCCHHH------HHHHHHHHCCCCEEEEEECCCC---CC--------CCCCC--------CEE----EEEH
Q ss_conf             973999977980389------9999999789978999954866---73--------10388--------567----8738
Q gi|254780768|r    1 MKRLLIIAGSGMLPY------YVAKAARLKNDEPVIASVLNEC---SF--------DWQDF--------ECR----ELPL   51 (281)
Q Consensus         1 M~kigIIAG~G~LP~------~ia~~~~~~g~~~~ii~l~~~~---~~--------~~~~~--------~~~----~~~i   51 (281)
                      |+|+||+-+.|+=|-      .+++.+..+|.+++-+. .|..   +.        ....+        -..    ...-
T Consensus         2 ~krI~IltsGGdaPGlNa~Ir~vv~~a~~~g~~v~G~~-~G~~GL~~~~~~~l~~~~v~~i~~~GGt~LgtsR~~~~~~~   80 (185)
T 1pfk_A            2 IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIY-DGYLGLYEDRMVQLDRYSVSDMINRGGTFLGSARFPEFRDE   80 (185)
T ss_dssp             CCEEEEEECSSCCTTHHHHHHHHHHHHHHTTCEEEEES-THHHHHHTTCEEEECSGGGTTCTTCCSCTTCCCCCGGGGSH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCEEEEEC-CCHHHHCCCCEEECCHHHHHHHHHCCCCEECCCCCCCCCCH
T ss_conf             86499986588867789999999999987799999991-66788727986868999997798579972247788866657


Q ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCC
Q ss_conf             99999999998649540677024232100011102603578999999875104803589999999997697482112225
Q gi|254780768|r   52 GDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIV  131 (281)
Q Consensus        52 g~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l  131 (281)
                      ....++.+.|++++++.++.+|.                               |++.=.  +..|.++|+.+++.-.=.
T Consensus        81 ~~~~~~~~~l~~~~Id~LivIGG-------------------------------dgS~~~--a~~L~e~gi~vvgiPkTI  127 (185)
T 1pfk_A           81 NIRAVAIENLKKRGIDALVVIGG-------------------------------DGSYMG--AMRLTEMGFPCIGLPGTI  127 (185)
T ss_dssp             HHHHHHHHHHHHTTCCEEEEEEC-------------------------------HHHHHH--HHHHHHTTCCEEEEEBCT
T ss_pred             HHHHHHHHHHHHCCCCEEEEECC-------------------------------CHHHHH--HHHHHHCCCCEEEEEEEE
T ss_conf             78889999999769988999369-------------------------------368999--999764367433121122


Q ss_pred             HHHCCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHCCCCCEEEEEEECCEEEEE
Q ss_conf             2420354334554653234788-998999999733267225999819748896
Q gi|254780768|r  132 PELLVQVGSLGTCVPNRDVKRD-ILAAMKSAEALSELDVGQSAVSIGGRVVAL  183 (281)
Q Consensus       132 ~~ll~~~G~l~~~~p~~~~~~d-I~~g~~i~~~l~~~DiGQsvVv~~g~Viai  183 (281)
                      .      ..+.+-.||..|+-- -.+|....+.+..=.-|.-|..+++.+..+
T Consensus       128 D------NDi~GG~Pta~DRilat~~G~~Av~~i~~g~~~~mv~~~~~~i~~~  174 (185)
T 1pfk_A          128 D------NDIKGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHH  174 (185)
T ss_dssp             T------CCCTCSCCCHHHHHHHHHHHHHHHHHHHHTCCSEEEEEETTEEEEE
T ss_pred             C------CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCEEEEE
T ss_conf             2------7998899998999999999999999997799986999999999983


No 8  
>>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} (A:1-184)
Probab=90.62  E-value=0.5  Score=26.90  Aligned_cols=152  Identities=8%  Similarity=-0.042  Sum_probs=93.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-CCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             973999977980389999999978997899995486673103-8856787389999999999864954067702423210
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRP   79 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP   79 (281)
                      |+||||| |.|.+=..+|+.+..+|+++++..........+. ..........+.      ...  ...++++-....  
T Consensus        21 ~~~I~iI-G~G~iG~~iA~~l~~~G~~V~v~~r~~~~~~~~~~~~~~~~~~~~~~------~~~--~~~i~~~~~~~~--   89 (184)
T 3doj_A           21 MMEVGFL-GLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEV------IKK--CKYTIAMLSDPC--   89 (184)
T ss_dssp             SCEEEEE-CCSHHHHHHHHHHHHTTCEEEEECSSGGGGHHHHHTTCEECSSHHHH------HHH--CSEEEECCSSHH--
T ss_pred             CCEEEEE-CHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEEECCHHHH------HHC--CCCEEEECCCCH--
T ss_conf             6879887-07889999999999789938997599999999998699680899999------856--995388326614--


Q ss_pred             CHHHHCCC---HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             00111026---035789999998751048035899999999976974821122252420354334554653234788998
Q gi|254780768|r   80 NVQDLCFS---IKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILA  156 (281)
Q Consensus        80 ~~~~l~~D---~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~  156 (281)
                      ........   ...... ...+......................++..++.+.+-|...++.+.++...-  .+....+.
T Consensus        90 ~~~~~~~~~~~~~~~~~-~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~--~~~e~~~~  166 (184)
T 3doj_A           90 AALSVVFDKGGVLEQIC-EGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAEDGQLIILAA--GDKALFEE  166 (184)
T ss_dssp             HHHHHHHSTTCGGGGCC-TTCEEEECSCCCHHHHHHHHHHHHHTTCEEEECCEECCHHHHHHTCEEEEEE--ECHHHHHH
T ss_pred             HHHCCCCCCHHHHHCCC-CCCEEEECCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCHHHHCCCCEECCC--CCHHHHHH
T ss_conf             54101134125665058-9998995477748889999999996598697255778846886597321048--99999999


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999997332
Q gi|254780768|r  157 AMKSAEALSE  166 (281)
Q Consensus       157 g~~i~~~l~~  166 (281)
                      ...+++.+|.
T Consensus       167 ~~~l~~~~G~  176 (184)
T 3doj_A          167 SIPAFDVLGK  176 (184)
T ss_dssp             HHHHHHHHEE
T ss_pred             HHHHHHHHCC
T ss_conf             8678987538


No 9  
>>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} (A:1-53)
Probab=90.18  E-value=0.63  Score=26.22  Aligned_cols=34  Identities=18%  Similarity=0.177  Sum_probs=29.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             97399997798038999999997899789999548
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLN   35 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~   35 (281)
                      |.++||| |+|.|-+..+.+++.-|+++.++.-..
T Consensus         1 m~~vgii-GgGQLgrMl~~AA~~lg~~v~vld~~~   34 (53)
T 3eth_A            1 MKQVCVL-GNGQLGRMLRQAGEPLGIAVWPVGLDA   34 (53)
T ss_dssp             CCEEEEE-SCSHHHHHHHHHHGGGTCEEEEECTTC
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             9999998-898999999999997899899982899


No 10 
>>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomerase; HET: NAD CDP; 1.50A {Salmonella typhi} (A:)
Probab=85.93  E-value=2.6  Score=22.09  Aligned_cols=76  Identities=17%  Similarity=0.162  Sum_probs=61.3

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC--------CCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9739999779803899999999789978999954866731--------03885678738999999999986495406770
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD--------WQDFECRELPLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~--------~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      |+|+-|..|.|-+=..+++++..+|++++++.........        ...+......+.....+-..+...+++.|+-+
T Consensus         1 MK~VlITGatGfiG~~l~~~Ll~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~d~Vih~   80 (347)
T 1orr_A            1 MAKLLITGGCGFLGSNLASFALSQGIDLIVFDNLSRKGATDNLHWLSSLGNFEFVHGDIRNKNDVTRLITKYMPDSCFHL   80 (347)
T ss_dssp             -CEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCCSTTHHHHHHHHHTTCCCEEEECCTTCHHHHHHHHHHHCCSEEEEC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCEEEEC
T ss_conf             98899918874899999999997839899997988665166788750279818997726898999998632498679970


Q ss_pred             CCCC
Q ss_conf             2423
Q gi|254780768|r   73 GAID   76 (281)
Q Consensus        73 G~V~   76 (281)
                      ....
T Consensus        81 Aa~~   84 (347)
T 1orr_A           81 AGQV   84 (347)
T ss_dssp             CCCC
T ss_pred             CCCC
T ss_conf             4323


No 11 
>>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} (A:)
Probab=85.38  E-value=2.8  Score=21.92  Aligned_cols=170  Identities=16%  Similarity=0.073  Sum_probs=97.4

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC--CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             97399997798038999999997899789999548667310--3885678738999999999986495406770242321
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRR   78 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~--~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~kr   78 (281)
                      |+|+-|..|+|-+=..+++.+.++|++++++..........  .........+.+.......+...++..++...... .
T Consensus         1 MK~VlVTGatGfiG~~lv~~Ll~~g~~V~~~~r~~~~~~~~~~~~~~~~~~d~~d~~~~~~~~~~~~~~~v~~~~a~~-~   79 (330)
T 2c20_A            1 MNSILICGGAGYIGSHAVKKLVDEGLSVVVVDNLQTGHEDAITEGAKFYNGDLRDKAFLRDVFTQENIEAVMHFAADS-L   79 (330)
T ss_dssp             -CEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCSSCCGGGSCTTSEEEECCTTCHHHHHHHHHHSCEEEEEECCCCC-C
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHCCCEEEECCCCCHHHHHHHHHHHCCCCHHHHHCCC-C
T ss_conf             998998888888999999999978398999978886785352236808973257889999999851011012210033-3


Q ss_pred             CCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCE-E--ECHHHCCHHHC-CCCCCCCCCCCCHHHHHHH
Q ss_conf             000111026035789999998751048035899999999976974-8--21122252420-3543345546532347889
Q gi|254780768|r   79 PNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS-V--VGAHEIVPELL-VQVGSLGTCVPNRDVKRDI  154 (281)
Q Consensus        79 P~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~-v--i~~~~~l~~ll-~~~G~l~~~~p~~~~~~dI  154 (281)
                      +......         ..........+-..+|    +...+.+.+ +  .+.......-- .+...-....|...--..-
T Consensus        80 ~~~~~~~---------~~~~~~~n~~~t~~ll----~~~~~~~~~~~v~~ss~~~~~~~~~~~~~~~~~~~~~~~y~~~k  146 (330)
T 2c20_A           80 VGVSMEK---------PLQYYNNNVYGALCLL----EVMDEFKVDKFIFSSTAATYGEVDVDLITEETMTNPTNTYGETK  146 (330)
T ss_dssp             HHHHHHS---------HHHHHHHHHHHHHHHH----HHHHHTTCCEEEEECCGGGGCSCSSSSBCTTSCCCCSSHHHHHH
T ss_pred             CCHHHHC---------CCCCCCCCHHHHHHHH----HHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             4215448---------6410002356679999----99886187789983454222345677765556668875144545


Q ss_pred             HHHHHHHHHHCCCCCEEEEEEECCEEEEEE
Q ss_conf             989999997332672259998197488962
Q gi|254780768|r  155 LAAMKSAEALSELDVGQSAVSIGGRVVALE  184 (281)
Q Consensus       155 ~~g~~i~~~l~~~DiGQsvVv~~g~ViaiE  184 (281)
                      ..+-..+.......--..++++...+.+.-
T Consensus       147 ~~~e~~~~~~~~~~~~~~~~~r~~~~~g~~  176 (330)
T 2c20_A          147 LAIEKMLHWYSQASNLRYKIFRYFNVAGAT  176 (330)
T ss_dssp             HHHHHHHHHHHHTSSCEEEEEECSEEECCC
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEEEEEEEEC
T ss_conf             435778877764059978999830188536


No 12 
>>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomerase; 1.90A {Pyrococcus horikoshii OT3} (A:1-102,A:213-228)
Probab=84.60  E-value=3  Score=21.69  Aligned_cols=77  Identities=17%  Similarity=0.069  Sum_probs=45.8

Q ss_pred             CCEEEEEECCCCHH-HHHHHHHHHCC-------CCEEE-EEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             97399997798038-99999999789-------97899-99548667310388567873899999999998649540677
Q gi|254780768|r    1 MKRLLIIAGSGMLP-YYVAKAARLKN-------DEPVI-ASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVV   71 (281)
Q Consensus         1 M~kigIIAG~G~LP-~~ia~~~~~~g-------~~~~i-i~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivm   71 (281)
                      |++||||.|-|-.. ..+.+......       +..++ .......+..........-....+.+.++.|.+.|++-++|
T Consensus         1 MK~IGIIGGmGp~AT~~yy~~I~~~~~a~~d~~~~~~ii~s~~~~~~r~~~~~~~~~~~~~~L~~~~~~L~~aGad~ivi   80 (118)
T 1jfl_A            1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYILGKGEDPRPQLIWTAKRLEECGADFIIM   80 (118)
T ss_dssp             CCCEEEEECSSHHHHHHHHHHHHHTCCCSSGGGSCCEEEEECTTSCCHHHHHTTSSCCCHHHHHHHHHHHHHHTCSEEEC
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             98899962779799999999999999875488788288885797778888861245779999999999999769999999


Q ss_pred             ECCCCC
Q ss_conf             024232
Q gi|254780768|r   72 AGAIDR   77 (281)
Q Consensus        72 aG~V~k   77 (281)
                      +-.-.+
T Consensus        81 ~cNTaH   86 (118)
T 1jfl_A           81 PCNTAH   86 (118)
T ss_dssp             SCTGGG
T ss_pred             ECHHHH
T ss_conf             552799


No 13 
>>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} (A:1-101,A:213-226)
Probab=81.09  E-value=2.3  Score=22.50  Aligned_cols=76  Identities=13%  Similarity=-0.014  Sum_probs=46.2

Q ss_pred             CCEEEEEECCCCHH-----HHHHHHHHH-CCC--CEEEEEECCCCCCCCCCCCEEE-EEHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             97399997798038-----999999997-899--7899995486673103885678-73899999999998649540677
Q gi|254780768|r    1 MKRLLIIAGSGMLP-----YYVAKAARL-KND--EPVIASVLNECSFDWQDFECRE-LPLGDFCVLRSILHQYNIGRIVV   71 (281)
Q Consensus         1 M~kigIIAG~G~LP-----~~ia~~~~~-~g~--~~~ii~l~~~~~~~~~~~~~~~-~~ig~ig~li~~Lk~~~i~~ivm   71 (281)
                      |++||||.|-|-..     ..+.+.... .+.  .+.++ +..-.-++.....-.| -....+..-++.|.+.|++-++|
T Consensus         1 MK~IGIIGGmGp~aT~~yy~~I~~~~~a~~~~~~~p~ii-i~s~~~~dr~~~~~~~~~~~~~L~~~~~~Le~aGad~ivi   79 (115)
T 2zsk_A            1 MKKIGIIGGTTPESTLYYYKKYIEISREKFEKYFYPELI-IYSINFKEFFQNPEGWEGRKKILINAAKALERAGAELIAF   79 (115)
T ss_dssp             CCCEEEEECSSHHHHHHHHHHHHHHHHHHSSTTCCCCEE-EEECCTHHHHTCTTHHHHHHHHHHHHHHHHHHHTCSEEEE
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEE-EEECCHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             976999734688999999999999978761887788589-9817803402124552238899999999984469888999


Q ss_pred             ECCCCC
Q ss_conf             024232
Q gi|254780768|r   72 AGAIDR   77 (281)
Q Consensus        72 aG~V~k   77 (281)
                      +-.-.+
T Consensus        80 ~cNTaH   85 (115)
T 2zsk_A           80 AANTPH   85 (115)
T ss_dssp             SSSGGG
T ss_pred             ECCHHH
T ss_conf             451778


No 14 
>>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} (A:)
Probab=80.61  E-value=4.2  Score=20.69  Aligned_cols=37  Identities=14%  Similarity=0.067  Sum_probs=32.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+|+-|..|+|.+=..+++.+.++|++++++......
T Consensus         3 ~~~vlItGatG~iG~~l~~~L~~~g~~v~~~~r~~~~   39 (206)
T 1hdo_A            3 VKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSR   39 (206)
T ss_dssp             CCEEEEESTTSHHHHHHHHHHHHTTCEEEEEESCGGG
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             8889999999889999999999786989999848254


No 15 
>>3ff4_A Uncharacterized protein; structural genomics, PSI- 2, protein structure initiative, midwest center for structural genomics; 2.10A {Cytophaga hutchinsonii atcc 33406} (A:)
Probab=79.56  E-value=4.1  Score=20.79  Aligned_cols=74  Identities=11%  Similarity=0.046  Sum_probs=55.2

Q ss_pred             CEEEEEECC---CCHHHHHHHHHHHCCCCEEEEEECCCCCCC-----------CCCCCEEEEEHHHHHHHHHHHHHCCCC
Q ss_conf             739999779---803899999999789978999954866731-----------038856787389999999999864954
Q gi|254780768|r    2 KRLLIIAGS---GMLPYYVAKAARLKNDEPVIASVLNECSFD-----------WQDFECRELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         2 ~kigIIAG~---G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~-----------~~~~~~~~~~ig~ig~li~~Lk~~~i~   67 (281)
                      +++|+|..+   |.+-..+++.++..|++++.+.-.......           ..|......+=...-.+++.+.+.+++
T Consensus         5 k~iAViGaS~~~~~~g~~v~~~l~~~g~~V~pVnp~~~~v~G~~~y~~l~~~~~~D~v~i~~~~~~~~~~~~e~~~~gik   84 (122)
T 3ff4_A            5 KKTLILGATPETNRYAYLAAERLKSHGHEFIPVGRKKGEVLGKTIINERPVIEGVDTVTLYINPQNQLSEYNYILSLKPK   84 (122)
T ss_dssp             CCEEEETCCSCTTSHHHHHHHHHHHHTCCEEEESSSCSEETTEECBCSCCCCTTCCEEEECSCHHHHGGGHHHHHHHCCS
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCEEEEEEEEECCCCCCCCCEEEEEECHHHHHHHHHHHHHCCCC
T ss_conf             63999987699998099999999978998999856576000058997343468987999996889989999999853999


Q ss_pred             EEEEEC-CC
Q ss_conf             067702-42
Q gi|254780768|r   68 RIVVAG-AI   75 (281)
Q Consensus        68 ~ivmaG-~V   75 (281)
                      .+++.- .+
T Consensus        85 ~v~~~~~~~   93 (122)
T 3ff4_A           85 RVIFNPGTE   93 (122)
T ss_dssp             EEEECTTCC
T ss_pred             EEEEECCCC
T ss_conf             999935987


No 16 
>>1gso_A Protein (glycinamide ribonucleotide synthetase); GAR-SYN, ATP-grAsp, purine de novo biosynthetic pathway, substrate channeling, ligase; 1.60A {Escherichia coli} (A:1-120,A:193-431)
Probab=77.92  E-value=2.9  Score=21.82  Aligned_cols=178  Identities=15%  Similarity=0.123  Sum_probs=94.9

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-CCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             973999977980389999999978997899995486673103-8856787389999999999864954067702423210
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRP   79 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP   79 (281)
                      |+||. |.|+|.+-..++.+++..|+.++++.-.+...+-.. ...+...++-....+.++.++.+|+-++.--...--.
T Consensus         2 ~~kvl-i~g~G~~~~~~~~aa~~~g~~~~v~~~~~~~~~~~~~a~~~~~~~~~d~~~i~~~~~~~~~d~v~~~~~~~~~~   80 (359)
T 1gso_A            2 FMKVL-VIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFAQNEKIDLTIVGPEAPLVK   80 (359)
T ss_dssp             CEEEE-EEECSHHHHHHHHHHTTCTTEEEEEEEECCHHHHHSTTEEECCCCTTCHHHHHHHHHHTTCSEEEECSHHHHHT
T ss_pred             CCEEE-EECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCCCCEEEEECCCCHHHHHHHHHHHCCCEEEECCCHHHHH
T ss_conf             87899-98929999999999986899888999789814366463417886899999999999996979999897188888


Q ss_pred             CHHHHC--CC---HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCE---------EECHHHCCHHHCCCCC------
Q ss_conf             001110--26---035789999998751048035899999999976974---------8211222524203543------
Q gi|254780768|r   80 NVQDLC--FS---IKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS---------VVGAHEIVPELLVQVG------  139 (281)
Q Consensus        80 ~~~~l~--~D---~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~---------vi~~~~~l~~ll~~~G------  139 (281)
                      .+..+.  ..   ..+...+..+.      +|-...|   ++|++.|+-         .++-.++..+.+...|      
T Consensus        81 ~~~~~~~~~g~~~vgp~~~a~~~~------~dK~~~k---~~~~~~giP~g~e~~vEefv~G~e~~v~~~~~dg~~~~~~  151 (359)
T 1gso_A           81 GVVDTFRAAGLKIFGPTAGAAQLE------GSKAFTK---DFLARHKIPDGEEASFIVMVDGEHVLPMATSQDHKRVGDK  151 (359)
T ss_dssp             THHHHHHHTTCCEESCCTTTTHHH------HCHHHHH---HHHHHTTCCCEEEEEEEEEEESSCEEEEEEEEEEEEEETT
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHH------CCHHHHH---HHHHHHCCCCCEEEEEEEECCCCCEEECCCHHEEEECCCC
T ss_conf             999999866997559569999987------0958799---9988633367718999974158708964311111203578


Q ss_pred             ----------CC-CC-CCCCH---HHHHH-HHHHHHHHHHHCCCC----CEEEEEEECCEEEEEE--CCCC
Q ss_conf             ----------34-55-46532---34788-998999999733267----2259998197488962--5342
Q gi|254780768|r  140 ----------SL-GT-CVPNR---DVKRD-ILAAMKSAEALSELD----VGQSAVSIGGRVVALE--GIEG  188 (281)
Q Consensus       140 ----------~l-~~-~~p~~---~~~~d-I~~g~~i~~~l~~~D----iGQsvVv~~g~ViaiE--a~eG  188 (281)
                                .+ .. ..|..   ...+. .+...+.+.+++--+    ..|-.+-.+|.+.-+|  +.-|
T Consensus       152 ~~~~~t~~~~~~~~~~~~p~~~~~~~~~~i~~~~~~~l~alg~~~~G~~h~E~~~t~dG~p~iiEin~R~G  222 (359)
T 1gso_A          152 DTGPNTGGMGAYSPAPVVTDDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFG  222 (359)
T ss_dssp             TEEEEEEEEEEEESCTTCCHHHHHHHHHHTHHHHHHHHHHTTCCCEEEEEEEEEEETTCCEEEEEEESSCC
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCEEECCCCCCCCEEEEEEC
T ss_conf             88887788765477536678999999998887786488628975141341450451179740214788954


No 17 
>>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} (A:1-166)
Probab=77.07  E-value=2.7  Score=22.02  Aligned_cols=152  Identities=10%  Similarity=-0.042  Sum_probs=86.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC-CCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCH
Q ss_conf             39999779803899999999789978999954866731038-85678738999999999986495406770242321000
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-FECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNV   81 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~-~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~   81 (281)
                      ||||| |.|..=..+|..+..+|+++++............. .........+      .+....   ++..--+. .+..
T Consensus         6 ~I~Ii-G~G~mG~~lA~~l~~~G~~V~~~dr~~~~~~~~~~~~~~~~~~~~~------~~~~~~---~~~~~v~~-~~~~   74 (166)
T 3cky_A            6 KIGFI-GLGAMGKPMAINLLKEGVTVYAFDLMEANVAAVVAQGAQACENNQK------VAAASD---IIFTSLPN-AGIV   74 (166)
T ss_dssp             EEEEE-CCCTTHHHHHHHHHHTTCEEEEECSSHHHHHHHHTTTCEECSSHHH------HHHHCS---EEEECCSS-HHHH
T ss_pred             EEEEE-EHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEECCCHHH------HHHCCC---CCEEECCC-HHHH
T ss_conf             79998-1488899999999978993899789999999999849978799999------985356---40101377-8899


Q ss_pred             HHHCCCHHHHHHHHH--HHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             111026035789999--998751048035899999999976974821122252420354334554653234788998999
Q gi|254780768|r   82 QDLCFSIKDSLRISK--MIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMK  159 (281)
Q Consensus        82 ~~l~~D~~~~~~l~k--~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~~  159 (281)
                      ...............  ............+.........+.++++++.+-+-|......+.+.-..  ..+...++...+
T Consensus        75 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~d~~~~~~v~~  152 (166)
T 3cky_A           75 ETVMNGPGGVLSACKAGTVIVDMSSVSPSSTLKMAKVAAEKGIDYVDAPVSGGTKGAEAGTLTIMV--GASEAVFEKIQP  152 (166)
T ss_dssp             HHHHHSTTCHHHHSCTTCEEEECCCCCHHHHHHHHHHHHHTTCEEEECCEESHHHHHHHTCEEEEE--ESCHHHHHHHHH
T ss_pred             HHHHHCCCCHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHCCCCCEEEEE--CCCHHHHHHCCH
T ss_conf             999837435454078997799617889999999999999769978922775782123578548971--799999986419


Q ss_pred             HHHHHCCC
Q ss_conf             99973326
Q gi|254780768|r  160 SAEALSEL  167 (281)
Q Consensus       160 i~~~l~~~  167 (281)
                      +++.+|.-
T Consensus       153 l~~~~g~~  160 (166)
T 3cky_A          153 VLSVIGKD  160 (166)
T ss_dssp             HHHHHEEE
T ss_pred             HHHHHCCC
T ss_conf             99984897


No 18 
>>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, structural genomics, protein structure initiative; HET: NAD; 1.87A {Archaeoglobus fulgidus} (A:1-166)
Probab=74.72  E-value=3.2  Score=21.46  Aligned_cols=73  Identities=14%  Similarity=0.038  Sum_probs=49.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             973999977980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      |+|+-|+.|+|-+=..+++.+.++|+++.++............+.  .....+...........++..++..-..
T Consensus         1 MK~IlItGatG~iG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~i~~~~~~   73 (166)
T 3ehe_A            1 MSLIVVTGGAGFIGSHVVDKLSESNEIVVIDNLSSGNEEFVNEAA--RLVKADLAADDIKDYLKGAEEVWHIAAN   73 (166)
T ss_dssp             --CEEEETTTSHHHHHHHHHHTTTSCEEEECCCSSCCGGGSCTTE--EEECCCTTTSCCHHHHTTCSEEEECCCC
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCC--CEEEEECCHHHHHHHHHCCCEEEEECCC
T ss_conf             987998778869999999999839988999868988876752204--2885032305899876335457300001


No 19 
>>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} (A:1-173)
Probab=74.66  E-value=5.7  Score=19.79  Aligned_cols=145  Identities=9%  Similarity=-0.076  Sum_probs=80.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC-CCC----CCEEEEE-HHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9739999779803899999999789978999954866731-038----8567873-899999999998649540677024
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQD----FECRELP-LGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~-~~~----~~~~~~~-ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      |.|||+| |.|..=.-+|..+.++|+++.++......... ...    ....... ...      ..... ..-+.+.--
T Consensus         2 m~kI~vI-G~G~mG~~lA~~l~~~G~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~-~~~~~~~~~   73 (173)
T 2pgd_A            2 QADIALI-GLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVLGAHSLEE------MVSKL-KKPRRIILL   73 (173)
T ss_dssp             CBSEEEE-CCSHHHHHHHHHHHHTTCCEEEECSSTHHHHHHHHTTTTTSSCEECSSHHH------HHHHB-CSSCEEEEC
T ss_pred             CCCEEEE-EEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCHHH------HHHHC-CCCCEEEEE
T ss_conf             8858999-354889999999997799589994999999999982364357745488999------99762-699989997


Q ss_pred             CCCCCCHHHHCCCHHHHHHHHHHHHHHHCC---------CCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCC
Q ss_conf             232100011102603578999999875104---------80358999999999769748211222524203543345546
Q gi|254780768|r   75 IDRRPNVQDLCFSIKDSLRISKMIWQLVSG---------GNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCV  145 (281)
Q Consensus        75 V~krP~~~~l~~D~~~~~~l~k~l~~~~~~---------gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~  145 (281)
                      .  .+ ... ..+      ....+......         ..............+.++..++.+.+-+.-..+.+......
T Consensus        74 ~--~~-~~~-~~~------~~~~~~~~~~~~~ii~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  143 (173)
T 2pgd_A           74 V--KA-GQA-VDN------FIEKLVPLLDIGDIIIDGGNSEYRDTMRRCRDLKDKGILFVGSGVSGGEDGARYGPSLMPG  143 (173)
T ss_dssp             S--CT-THH-HHH------HHHHHHHHCCTTCEEEECSCCCHHHHHHHHHHHHHTTCEEEEEEEESHHHHHHHCCEEEEE
T ss_pred             C--CC-HHH-HHH------HHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             8--98-289-999------9999996289998899768851589999999988630554555567881002576421136


Q ss_pred             CCHHHHHHHHHHHHHHHHHCC
Q ss_conf             532347889989999997332
Q gi|254780768|r  146 PNRDVKRDILAAMKSAEALSE  166 (281)
Q Consensus       146 p~~~~~~dI~~g~~i~~~l~~  166 (281)
                      -   +.+.++...++++.+|.
T Consensus       144 ~---~~e~~~~v~~l~~~~G~  161 (173)
T 2pgd_A          144 G---NKEAWPHIKAIFQGIAA  161 (173)
T ss_dssp             E---CTTTHHHHHHHHHHHSC
T ss_pred             C---HHHHHHHHHHHHHHHHH
T ss_conf             5---49999874234354543


No 20 
>>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, PSI-2; 2.30A {Staphylococcus aureus subsp} (A:1-161)
Probab=71.72  E-value=4.8  Score=20.29  Aligned_cols=37  Identities=16%  Similarity=0.166  Sum_probs=31.4

Q ss_pred             CC-EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             97-399997798038999999997899789999548667
Q gi|254780768|r    1 MK-RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS   38 (281)
Q Consensus         1 M~-kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~   38 (281)
                      |+ ||++| |.|..=..+++.+..+|+++.++.......
T Consensus         1 M~mkI~iI-G~G~mG~~la~~l~~~G~~V~~~~~~~~~~   38 (161)
T 3g17_A            1 MSLSVAII-GPGAVGTTIAYELQQSLPHTTLIGRHAKTI   38 (161)
T ss_dssp             --CCEEEE-CCSHHHHHHHHHHHHHCTTCEEEESSCEEE
T ss_pred             CCCEEEEE-CCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             99999998-979999999999996699479996599999


No 21 
>>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* (A:1-204)
Probab=71.42  E-value=7.3  Score=19.07  Aligned_cols=36  Identities=25%  Similarity=0.207  Sum_probs=30.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+||||| |.|..=..+|+.+..+|+++.+.......
T Consensus        33 ~~~IgiI-G~G~mG~~lA~~l~~~G~~V~i~~~~~~~   68 (204)
T 3ggo_A           33 MQNVLIV-GVGFMGGSFAKSLRRSGFKGKIYGYDINP   68 (204)
T ss_dssp             CSEEEEE-SCSHHHHHHHHHHHHTTCCSEEEEECSCH
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCCCEEEEEECCH
T ss_conf             7769998-33888999999998559986799996999


No 22 
>>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium frigidimaris KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} (A:1-170)
Probab=71.14  E-value=7.4  Score=19.03  Aligned_cols=76  Identities=16%  Similarity=0.116  Sum_probs=58.4

Q ss_pred             CC-EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCC-CC-CCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             97-399997798038999999997899789999548667-31-038856787389999999999864954067702423
Q gi|254780768|r    1 MK-RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS-FD-WQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         1 M~-kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~-~~-~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |+ ++-|+.|+|-+=..+++.+.++|+.+++........ .. .......+..+......-..+....+..++......
T Consensus         1 M~~~vlVtGatGfiG~~l~~~L~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~~aa~~   79 (170)
T 2yy7_A            1 MNPKILIIGACGQIGTELTQKLRKLYGTENVIASDIRKLNTDVVNSGPFEVVNALDFNQIEHLVEVHKITDIYLMAALL   79 (170)
T ss_dssp             CCCCEEEETTTSHHHHHHHHHHHHHHCGGGEEEEESCCCSCHHHHSSCEEECCTTCHHHHHHHHHHTTCCEEEECCCCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHCCCCEEEEECCCHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             9971999779978999999999986696699983665343545245876999655679876422235653222222211


No 23 
>>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, MFE-1, fatty acid beta oxidation, oxidoreductase; 1.90A {Rattus norvegicus} (A:18-219)
Probab=70.72  E-value=7.3  Score=19.05  Aligned_cols=35  Identities=11%  Similarity=0.018  Sum_probs=30.4

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |+|+|+| |.|..=..+|..+.++|+++++.....+
T Consensus        20 ~~~I~vI-G~G~mG~~lA~~la~~G~~V~~~d~~~~   54 (202)
T 1zcj_A           20 VSSVGVL-GLGTMGRGIAISFARVGISVVAVESDPK   54 (202)
T ss_dssp             CCEEEEE-CCSHHHHHHHHHHHTTTCEEEEECSSHH
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCCEEEEECCHH
T ss_conf             7989897-9789999999999828995799969989


No 24 
>>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductase; oxidoreductase; 1.99A {Streptomyces coelicolor A3} (A:)
Probab=70.48  E-value=7.6  Score=18.94  Aligned_cols=76  Identities=12%  Similarity=0.139  Sum_probs=45.7

Q ss_pred             CCEEEEEECC-CCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHC--CCCEEEEECCCC
Q ss_conf             9739999779-803899999999789978999954866731038856787389999999999864--954067702423
Q gi|254780768|r    1 MKRLLIIAGS-GMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQY--NIGRIVVAGAID   76 (281)
Q Consensus         1 M~kigIIAG~-G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~--~i~~ivmaG~V~   76 (281)
                      ++|+++|.|. +-+-..+++.+.+.|.+++++....+.........+-.-+-.++..+++...++  .++-+|-...+.
T Consensus        20 ~gKv~lITGas~GIG~a~a~~la~~Ga~Vv~~~r~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~g~id~lvnnAg~~   98 (253)
T 2nm0_A           20 MSRSVLVTGGNRGIGLAIARAFADAGDKVAITYRSGEPPEGFLAVKCDITDTEQVEQAYKEIEETHGPVEVLIANAGVT   98 (253)
T ss_dssp             CCCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSSCCCTTSEEEECCTTSHHHHHHHHHHHHHHTCSCSEEEEECSCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9898999589868999999999987998999989821116857998048999999999999999829962999525443


No 25 
>>1nns_A L-asparaginase II; amidrohydrolase, crystallographic comparison,; 1.95A {Escherichia coli} (A:202-326)
Probab=70.24  E-value=7.7  Score=18.90  Aligned_cols=54  Identities=7%  Similarity=-0.053  Sum_probs=25.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCC
Q ss_conf             39999779803899999999789978999954866731038856787389999999999864954
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~   67 (281)
                      |++|+-..-.++....+++...|.+-+|+.--|.-+.     +.      ++...++.+.+++|-
T Consensus        12 ~V~il~~~pg~~~~~l~~~~~~g~~GiVi~~~G~G~~-----p~------~~~~~l~~a~~~gi~   65 (125)
T 1nns_A           12 KVGIVYNYANASDLPAKALVDAGYDGIVSAGVGNGNL-----YK------SVFDTLATAAKTGTA   65 (125)
T ss_dssp             CEEEEECCTTCCSHHHHHHHHTTCSEEEEEEBTTTBC-----CH------HHHHHHHHHHHTTCE
T ss_pred             CEEEEEECCCCCHHHHHHHHHCCCCEEEEEEECCCCC-----CH------HHHHHHHHHHHCCCE
T ss_conf             5699992699998999999867897899985789989-----98------999999999857998


No 26 
>>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} (A:312-498)
Probab=69.59  E-value=6.9  Score=19.25  Aligned_cols=35  Identities=14%  Similarity=0.265  Sum_probs=30.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |+|||+| |.|..=..+|..+..+|+++.+.....+
T Consensus         3 m~kI~Vi-G~G~mG~~lA~~La~~G~~V~~~d~~~~   37 (187)
T 1wdk_A            3 VKQAAVL-GAGIMGGGIAYQSASKGTPILMKDINEH   37 (187)
T ss_dssp             CSSEEEE-CCHHHHHHHHHHHHHTTCCEEEECSSHH
T ss_pred             CCEEEEE-CCCCCCCCCEEEEEECCCCCEEEECCHH
T ss_conf             4234431-4775455302566405862036515888


No 27 
>>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating 1; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} (A:1-180)
Probab=68.23  E-value=1.3  Score=24.03  Aligned_cols=148  Identities=10%  Similarity=-0.055  Sum_probs=83.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCC--CE-EEEEHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             97399997798038999999997899789999548667310388--56-7873899999999998649540677024232
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--EC-RELPLGDFCVLRSILHQYNIGRIVVAGAIDR   77 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~--~~-~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~k   77 (281)
                      |.|||+| |.|..=.-+|+.+.++|+++++.....+.-..+...  .. ......   ..........+......--...
T Consensus        10 ~~~Iavi-G~G~mG~~lA~~L~~~G~~V~~~d~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~v~~~~~~   85 (180)
T 2p4q_A           10 SADFGLI-GLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLANEAKGKSIIGAT---SIEDFISKLKRPRKVMLLVKAG   85 (180)
T ss_dssp             CCSEEEE-CCSHHHHHHHHHHHHTTCCEEEECSSSHHHHHHHHTTTTTSSEECCS---SHHHHHHTSCSSCEEEECCCSS
T ss_pred             CCCEEEE-EEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCC---CHHHHHHHHCCCCEEEEECCCC
T ss_conf             1787898-17488899999999779948999399999999997035435664657---6899999846899899978995


Q ss_pred             CCCHHHHCCCHHHHHHHHHHHHHH---------HCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCH
Q ss_conf             100011102603578999999875---------10480358999999999769748211222524203543345546532
Q gi|254780768|r   78 RPNVQDLCFSIKDSLRISKMIWQL---------VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNR  148 (281)
Q Consensus        78 rP~~~~l~~D~~~~~~l~k~l~~~---------~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~  148 (281)
                      +.....           .......         .....-+............+..+++.+-+-+.-.++.+......-+ 
T Consensus        86 ~~~~~~-----------~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~a~~~~~v~~~~~-  153 (180)
T 2p4q_A           86 APVDAL-----------INQIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGILFVGSGVSGGEEGARYGPSLMPGGS-  153 (180)
T ss_dssp             HHHHHH-----------HHHHGGGCCTTCEEEECSCCCHHHHHHHHHHHHHTTCEEEEEEEESHHHHHHHCCEEEEEEC-
T ss_pred             HHHHHH-----------HHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCEEECCH-
T ss_conf             899999-----------99999528899889958987526999999998652055225535788765445430000453-


Q ss_pred             HHHHHHHHHHHHHHHHCC
Q ss_conf             347889989999997332
Q gi|254780768|r  149 DVKRDILAAMKSAEALSE  166 (281)
Q Consensus       149 ~~~~dI~~g~~i~~~l~~  166 (281)
                        .+..+....+++.+|+
T Consensus       154 --~~~~~~v~~ll~~lg~  169 (180)
T 2p4q_A          154 --EEAWPHIKNIFQSISA  169 (180)
T ss_dssp             --GGGHHHHHHHHHHHSC
T ss_pred             --HHHHHHHHHHHHHHHH
T ss_conf             --9999987779998741


No 28 
>>3dii_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3dij_A* 3ged_A 3geg_A* (A:)
Probab=68.01  E-value=8.6  Score=18.60  Aligned_cols=83  Identities=11%  Similarity=-0.032  Sum_probs=51.4

Q ss_pred             CCEEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CCCC--EEE---EEHHHHHHHHHHHHHC--CCCEEEE
Q ss_conf             973999977-98038999999997899789999548667310-3885--678---7389999999999864--9540677
Q gi|254780768|r    1 MKRLLIIAG-SGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFE--CRE---LPLGDFCVLRSILHQY--NIGRIVV   71 (281)
Q Consensus         1 M~kigIIAG-~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-~~~~--~~~---~~ig~ig~li~~Lk~~--~i~~ivm   71 (281)
                      |+|.+||.| ++.+=..+|+.+.++|.++++.....+..... ....  ...   .+..++..+++...++  +++-+|-
T Consensus         1 mgK~vlITGgs~GIG~aia~~l~~~G~~Vv~~~r~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~g~id~lin   80 (247)
T 3dii_A            1 MNRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFYFHGDVADPLTLKKFVEYAMEKLQRIDVLV   80 (247)
T ss_dssp             -CCEEEEESTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHTTCTTEEEEECCTTSHHHHHHHHHHHHHHHSCCCEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99889996689889999999999879989999798889999998358879998115998999999999999639973898


Q ss_pred             ECCCCCCCCHHH
Q ss_conf             024232100011
Q gi|254780768|r   72 AGAIDRRPNVQD   83 (281)
Q Consensus        72 aG~V~krP~~~~   83 (281)
                      ...+.....+.+
T Consensus        81 nag~~~~~~~~~   92 (247)
T 3dii_A           81 NNACRGSKGILS   92 (247)
T ss_dssp             ECCC-CCCCGGG
T ss_pred             EECCCCCCCCHH
T ss_conf             641356652043


No 29 
>>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* (A:)
Probab=66.33  E-value=9.2  Score=18.38  Aligned_cols=51  Identities=14%  Similarity=-0.029  Sum_probs=35.9

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHH
Q ss_conf             9739999779803899999999789978999954866731038856787389
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG   52 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig   52 (281)
                      |.|+|+| |.|..=..+|+.+..+|+++++..................-+..
T Consensus        28 ~~kIgii-G~G~mG~alA~~l~~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~   78 (215)
T 2vns_A           28 APKVGIL-GSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQE   78 (215)
T ss_dssp             -CCEEEE-CCSHHHHHHHHHHHHTTCCEEEEESSHHHHHHHSBTTSEEEEHH
T ss_pred             CCCEEEE-EECHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCCCC
T ss_conf             9918999-21299999999999638657797688799999997014002320


No 30 
>>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, protein structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} (A:)
Probab=66.13  E-value=5.8  Score=19.77  Aligned_cols=119  Identities=6%  Similarity=0.039  Sum_probs=61.4

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC--CCEEEEEHHHHHHHHHHHHHCCCC---EEEEECCCC
Q ss_conf             739999779803899999999789978999954866731038--856787389999999999864954---067702423
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSILHQYNIG---RIVVAGAID   76 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~--~~~~~~~ig~ig~li~~Lk~~~i~---~ivmaG~V~   76 (281)
                      ++=-+|.|.|.+-..+++.++..|++++++....+....+..  +.....+..+    ...|++.++.   -++.+=.  
T Consensus         7 ~~~iiIiG~g~~g~~ia~~L~~~g~~v~vid~~~~~~~~~~~~g~~~i~gd~~~----~~~l~~a~i~~a~~vi~~~~--   80 (140)
T 3fwz_A            7 CNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRERGVRAVLGNAAN----EEIXQLAHLECAKWLILTIP--   80 (140)
T ss_dssp             CSCEEEECCSHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHTTCEEEESCTTS----HHHHHHTTGGGCSEEEECCS--
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEECCCCC----HHHHHHCCCCCCCEEEECCC--
T ss_conf             799999896889999999999779988999898899999996298389727889----99995038241889998789--


Q ss_pred             CCCCHHHHCCCHHHHHHHHHHHHHH---HCCCCHHHHHHHHHHHHHCCC-EEECHHHCCHHHCC
Q ss_conf             2100011102603578999999875---104803589999999997697-48211222524203
Q gi|254780768|r   77 RRPNVQDLCFSIKDSLRISKMIWQL---VSGGNAAILKASIDLLESYGV-SVVGAHEIVPELLV  136 (281)
Q Consensus        77 krP~~~~l~~D~~~~~~l~k~l~~~---~~~gDd~iL~~i~~~fe~~G~-~vi~~~~~l~~ll~  136 (281)
                       .+..+.     .. ....+.++..   .-+-.+.   .-...|++.|. .++.+.....+.++
T Consensus        81 -~d~~n~-----~~-~~~~~~~~~~~~ii~~~~~~---~~~~~l~~~G~~~vv~~~~~~a~~l~  134 (140)
T 3fwz_A           81 -NGYEAG-----EI-VASARAKNPDIEIIARAHYD---DEVAYITERGANQVVXGEREIARTXL  134 (140)
T ss_dssp             -CHHHHH-----HH-HHHHHHHCSSSEEEEEESSH---HHHHHHHHTTCSEEEEHHHHHHHHHH
T ss_pred             -CHHHHH-----HH-HHHHHHHCCCCEEEEEECCH---HHHHHHHHCCCCEEECHHHHHHHHHH
T ss_conf             -858999-----99-99999978998499998999---99999997799999987999999999


No 31 
>>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix K1} (A:1-129)
Probab=66.11  E-value=5.5  Score=19.92  Aligned_cols=22  Identities=9%  Similarity=0.190  Sum_probs=10.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEECH
Q ss_conf             0358999999999769748211
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGA  127 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~  127 (281)
                      |..-++.+.+.-+++|..++++
T Consensus       107 ~~~~~~~l~~~a~~~g~~vvg~  128 (129)
T 2yv2_A          107 PVHDTMRFVNYARQKGATIIGP  128 (129)
T ss_dssp             CHHHHHHHHHHHHHHTCEEECS
T ss_pred             CCHHHHHHHHHHCCCCEEEECC
T ss_conf             6035799997533464289768


No 32 
>>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} (A:)
Probab=65.62  E-value=9.5  Score=18.29  Aligned_cols=38  Identities=11%  Similarity=0.083  Sum_probs=33.0

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             97399997798038999999997899789999548667
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS   38 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~   38 (281)
                      |+|+-|..|.|.+-..+++.+.++|+.+.++.......
T Consensus         5 ~~kIlVtGatG~iG~~i~~~L~~~g~~v~~~~~~~~~~   42 (215)
T 2a35_A            5 PKRVLLAGATGLTGEHLLDRILSEPTLAKVIAPARKAL   42 (215)
T ss_dssp             CCEEEEECTTSHHHHHHHHHHHHCTTCCEEECCBSSCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCCC
T ss_conf             98899987995899999999997869689999727720


No 33 
>>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, JCSG, protein structure initiative, PSI; HET: NAD PG4; 2.27A {Thermotoga maritima} (A:1-109,A:196-228)
Probab=65.54  E-value=9.6  Score=18.28  Aligned_cols=76  Identities=14%  Similarity=0.012  Sum_probs=48.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCC-EEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             973999977980389999999978997899995486673103885-6787389999999999864954067702423
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~-~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |.|+.|+.++|.+=..+++.+..+|++++.+.-+........... ..+...............++|+-|+=+=..+
T Consensus        12 ~mkVlI~GAtG~iGr~iv~~Ll~~G~~Vvaivr~~~~~~~~~~~~~~d~t~~~~~~~~~~~~~~~g~dvVI~ttG~~   88 (142)
T 1vm6_A           12 HMKYGIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPKTVDLCKKYRAGLVLGTTALK   88 (142)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEEETTEEEECSCCSEEEECSCGGGHHHHHHHHHHHTCEEEECCCSCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCHHHHCCCCEEEEECCHHHHHHHHHHHHHCCCCCEEECCCCC
T ss_conf             87899999989799999999966999599997888377745899999904679898789999853655369626533


No 34 
>>4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} (A:212-337)
Probab=65.27  E-value=9.7  Score=18.25  Aligned_cols=103  Identities=11%  Similarity=-0.004  Sum_probs=45.8

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEE----CCCCCC
Q ss_conf             3999977980389999999978997899995486673103885678738999999999986495406770----242321
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVA----GAIDRR   78 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivma----G~V~kr   78 (281)
                      |+.|+-..-.++-.+.+++...|.+-+|+.-.|.-+..     .      .+-..++.+.+++|-=|+-.    |.+...
T Consensus        12 ~V~il~~~pG~~~~~l~~~~~~g~~GiVi~~~G~Gn~p-----~------~~~~~l~~a~~~gi~vV~~Sqc~~G~v~~~   80 (126)
T 4pga_A           12 QVDIAYSYGNVTDTAYKALAQNGAKALIHAGTGNGSVS-----S------RVVPALQQLRKNGTQIIRSSHVNQGGFVLR   80 (126)
T ss_dssp             CEEEEECCTTCCSHHHHHHHHTTCSEEEEEEBTTTBCC-----T------TTHHHHHHHHHTTCEEEEEESCCSBCCCCT
T ss_pred             CEEEEEECCCCCHHHHHHHHHCCCCEEEEECCCCCCCC-----H------HHHHHHHHHHHCCCEEEEEECCCCCCCCCC
T ss_conf             26999937999999999997579979999551798999-----8------999999999977987999850588862655


Q ss_pred             C---CHHHH----CCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             0---00111----02603578999999875104803589999999997
Q gi|254780768|r   79 P---NVQDL----CFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES  119 (281)
Q Consensus        79 P---~~~~l----~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~  119 (281)
                      -   .+.+.    --|+.+-....++.+.+ .+|.|  ...+.+.|+.
T Consensus        81 ~~~~~~~~~G~i~~g~lt~e~Ar~kL~~~L-~~~~~--~~~i~~~f~~  125 (126)
T 4pga_A           81 NAEQPDDKNDWVVAHDLNPEKARILAMVAM-TKTQD--SKELQRIFWE  125 (126)
T ss_dssp             TTSSCHHHHTCEECTTCCHHHHHHHHHHHT-TTCCC--HHHHHHHHHH
T ss_pred             CCCCCHHHCCEEECCCCCHHHHHHHHHHHH-CCCCC--HHHHHHHHHH
T ss_conf             455442228988899979999999999998-38999--9999999974


No 35 
>>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} (A:)
Probab=64.87  E-value=6.4  Score=19.44  Aligned_cols=72  Identities=13%  Similarity=0.013  Sum_probs=48.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC--CCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             39999779803899999999789978999954866731038--85678738999999999986495406770242
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~--~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      +=-+|.|.|.+-..+++.+++.|++++++....+.......  +++.+.+..+. ..++.....+++-++.+-.-
T Consensus         7 ~~vlIiG~G~iG~~ia~~L~~~g~~vvvvd~~~~~~~~~~~~~~~~~~gd~~~~-~~l~~~~~~~ad~vi~~~~~   80 (144)
T 2hmt_A            7 KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEE-NELLSLGIRNFEYVIVAIGA   80 (144)
T ss_dssp             CSEEEECCSHHHHHHHHHHHHTTCCCEEEESCHHHHHTTTTTCSEEEECCTTCH-HHHHTTTGGGCSEEEECCCS
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEECCCCH-HHHHHCCCCCCCEEEEEECC
T ss_conf             828998878999999999997899089983898999999860662035114678-88863022128999999688


No 36 
>>2g1u_A Hypothetical protein TM1088A; , structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: AMP; 1.50A {Thermotoga maritima} (A:)
Probab=64.69  E-value=9.9  Score=18.18  Aligned_cols=118  Identities=12%  Similarity=0.155  Sum_probs=64.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC-C-C-EEEEEHHHHHHHHHHHHHCC---CCEEEEECCCC
Q ss_conf             39999779803899999999789978999954866731038-8-5-67873899999999998649---54067702423
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-F-E-CRELPLGDFCVLRSILHQYN---IGRIVVAGAID   76 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~-~-~-~~~~~ig~ig~li~~Lk~~~---i~~ivmaG~V~   76 (281)
                      +=-+|.|.|.+-..+++.+...|++++++....+.-..... . . ...-+...    ...|++.+   ++-++.+-.  
T Consensus        20 ~~vvIiG~G~~g~~ia~~L~~~g~~v~vid~~~~~~~~~~~~~~~~~i~gd~~~----~~~L~~a~i~~a~~vi~~~~--   93 (155)
T 2g1u_A           20 KYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSEFSGFTVVGDAAE----FETLKECGMEKADMVFAFTN--   93 (155)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHTTCEEEEEESCGGGGGGSCTTCCSEEEESCTTS----HHHHHTTTGGGCSEEEECSS--
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCH----HHHHHHHHHHCCCEEEECCC--
T ss_conf             808998988899999999997899699995688986667765324565410210----15666654420323420269--


Q ss_pred             CCCCHHHHCCCHHHHHHHHHHHHH---HHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCC
Q ss_conf             210001110260357899999987---510480358999999999769748211222524203
Q gi|254780768|r   77 RRPNVQDLCFSIKDSLRISKMIWQ---LVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLV  136 (281)
Q Consensus        77 krP~~~~l~~D~~~~~~l~k~l~~---~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~  136 (281)
                       .+... +    ..... .+.++.   ..-+.++..-   ...|.+.|..++.+.....+.++
T Consensus        94 -~d~~n-~----~~~~~-~~~~~~~~~ii~~~~~~~~---~~~l~~~g~~vi~~~~~~a~~l~  146 (155)
T 2g1u_A           94 -DDSTN-F----FISMN-ARYMFNVENVIARVYDPEK---IKIFEENGIKTICPAVLMIEKVK  146 (155)
T ss_dssp             -CHHHH-H----HHHHH-HHHTSCCSEEEEECSSGGG---HHHHHTTTCEEECHHHHHHHHHH
T ss_pred             -CHHHH-H----HHHHH-HHHHCCCCEEEEEECCHHH---HHHHHHCCCCEECCHHHHHHHHH
T ss_conf             -87899-9----99997-9988799849999879889---99999779989882099999999


No 37 
>>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} (A:)
Probab=62.91  E-value=11  Score=17.96  Aligned_cols=74  Identities=9%  Similarity=0.023  Sum_probs=59.1

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-------CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             7399997798038999999997899789999548667310-------388567873899999999998649540677024
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-------QDFECRELPLGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-------~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      +++-|..|+|-+=..+++.+.++|+++.++..........       ....+...++.+...+-..+...+++.|+-+..
T Consensus        10 k~VLVTGatGfiG~~lv~~Ll~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~~~~~~~~~~~d~Vih~Aa   89 (357)
T 1rkx_A           10 KRVFVTGHTGFKGGWLSLWLQTMGATVKGYSLTAPTVPSLFETARVADGMQSEIGDIRDQNKLLESIREFQPEIVFHMAA   89 (357)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSCSSSSCHHHHTTTTTTSEEEECCTTCHHHHHHHHHHHCCSEEEECCS
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             98999689978999999999977998999978998627787664004687699811568576023565211244444421


Q ss_pred             C
Q ss_conf             2
Q gi|254780768|r   75 I   75 (281)
Q Consensus        75 V   75 (281)
                      .
T Consensus        90 ~   90 (357)
T 1rkx_A           90 Q   90 (357)
T ss_dssp             C
T ss_pred             C
T ss_conf             5


No 38 
>>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* (A:1-105,A:237-273)
Probab=62.62  E-value=11  Score=17.93  Aligned_cols=71  Identities=14%  Similarity=0.021  Sum_probs=44.7

Q ss_pred             CEEEEE-ECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             739999-77980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    2 KRLLII-AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         2 ~kigII-AG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      .+||++ +|-|-|..  ++.+++.-...-++.+.+.+...+.+.+.. .-...+-.++++|.+.+++-+|++=.=
T Consensus        13 ~~IGIfDSGiGgLav--l~~i~~~~p~~~~iyv~D~~~~PYG~ks~e-~i~~~~~~~~~~L~~~g~~~IVIACNT   84 (142)
T 2oho_A           13 RPIGFLDSGVGGLTV--VCELIRQLPHEKIVYIGDSARAPYGPRPKK-QIKEYTWELVNFLLTQNVKMIVFACNT   84 (142)
T ss_dssp             CCEEEEESSSTTHHH--HHHHHHHCTTCCEEEEECGGGCCCTTSCHH-HHHHHHHHHHHHHHTTTCSEEEECCHH
T ss_pred             CCEEEEECCCCHHHH--HHHHHHHCCCCCEEEEECCCCCCCCCCCHH-HHHHHHHHHHHHHHHCCCCEEEEECCH
T ss_conf             978999789777999--999999789999999946889998999999-999999999999985578759996157


No 39 
>>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} (A:)
Probab=62.47  E-value=11  Score=17.91  Aligned_cols=74  Identities=7%  Similarity=-0.142  Sum_probs=48.0

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC----CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             97399997798038999999997899789999548667310----38856787389999999999864954067702423
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |.|+.|+.|+|.+=..+++.+.++|++++++..........    ........++.+...+.  -.-.++..++.+....
T Consensus        18 ~~kIlItGatG~iG~~l~~~l~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~d~~~~~~~~--~~~~~~~~~~~~~~~~   95 (242)
T 2bka_A           18 NKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA--SAFQGHDVGFCCLGTT   95 (242)
T ss_dssp             CCEEEEECTTSHHHHHHHHHHHHHTCCSEEEEEESSCCCCCSGGGGGCEEEECCGGGGGGGG--GGGSSCSEEEECCCCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHCCCCCEEECCCCCCCCCC--CCCCCCCCCCCCCCCC
T ss_conf             99799989986899999999997799726998536735530010245402310233321100--0101122222232212


No 40 
>>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.70A {Archaeoglobus fulgidus} (A:)
Probab=62.41  E-value=11  Score=17.90  Aligned_cols=71  Identities=10%  Similarity=0.018  Sum_probs=43.6

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CCCEEEEEHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             973999977980389999999978997899995486673103--885678738999999999986495406770
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--~~~~~~~~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      |++=-+|.|.|..-..+++.+..+|++++++....+......  .+.+...+..+- ..++.+...+++-++-+
T Consensus         5 ~~~~v~IiG~G~iG~~ia~~L~~~G~~V~vid~~~~~~~~~~~~~~~~~~~d~~~~-~~l~~~~~~~~d~vi~~   77 (141)
T 3llv_A            5 GRYEYIVIGSEAAGVGLVRELTAAGKKVLAVDKSKEKIELLEDEGFDAVIADPTDE-SFYRSLDLEGVSAVLIT   77 (141)
T ss_dssp             -CCSEEEECCSHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHTTCEEEECCTTCH-HHHHHSCCTTCSEEEEC
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHCCCCEEEEECCCCH-HHHHHHHHHHCCEEEEE
T ss_conf             87969998998899999999998799389974338899998707837999445435-67765557526899998


No 41 
>>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} (A:1-124)
Probab=62.11  E-value=11  Score=17.87  Aligned_cols=66  Identities=11%  Similarity=-0.076  Sum_probs=45.3

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC--CCEEE--------------EEHHHHHHHHHHHHHCCCC
Q ss_conf             9999779803899999999789978999954866731038--85678--------------7389999999999864954
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRE--------------LPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~--~~~~~--------------~~ig~ig~li~~Lk~~~i~   67 (281)
                      -=|||-.|.-...+.+.++..|.+++.+.-........-.  .+...              -+.-.+.++++..++.+|+
T Consensus        16 kvLIANRGeiA~Ri~rt~~elgi~~vai~s~~D~~a~~v~~Ade~~~ig~~~~~~~~~~~~~sYl~~~~Ii~~A~~~g~~   95 (124)
T 2qf7_A           16 KILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLALHRFKADESYQVGRGPHLARDLGPIESYLSIDEVIRVAKLSGAD   95 (124)
T ss_dssp             EEEECCCHHHHHHHHHHHHHTTCEEEEEECGGGTTCHHHHSSSSEEECSCSTTSSSCCCTTHHHHCHHHHHHHHHHHTCS
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECHHHHCCCCHHHCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             79998883999999999998499299991768847877876888899478742013566300004999999999997909


Q ss_pred             EE
Q ss_conf             06
Q gi|254780768|r   68 RI   69 (281)
Q Consensus        68 ~i   69 (281)
                      -+
T Consensus        96 Ai   97 (124)
T 2qf7_A           96 AI   97 (124)
T ss_dssp             EE
T ss_pred             EE
T ss_conf             99


No 42 
>>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} (A:)
Probab=61.66  E-value=11  Score=17.91  Aligned_cols=244  Identities=10%  Similarity=-0.071  Sum_probs=114.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCH
Q ss_conf             399997798038999999997899789999548667310-3885678738999999999986495406770242321000
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNV   81 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~   81 (281)
                      |+-|..|.|-+=..+++.+.++|++++++.......... +........+.........+...+++.|+..-... .+..
T Consensus        14 ~VLItGatGfiG~~lv~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~d~Vih~a~~~-~~~~   92 (321)
T 2pk3_A           14 RALITGVAGFVGKYLANHLTEQNVEVFGTSRNNEAKLPNVEMISLDIMDSQRVKKVISDIKPDYIFHLAAKSSVK-DSWL   92 (321)
T ss_dssp             EEEEETTTSHHHHHHHHHHHHTTCEEEEEESCTTCCCTTEEEEECCTTCHHHHHHHHHHHCCSEEEECCSCCCHH-HHTT
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCEEEEEECCCHHHHHHHHHHCCCCEEECCCCCCCCC-CCCC
T ss_conf             799967888899999999997849899981887124689769994368999999999865975110233233222-2222


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCE---EECHHHCCHHHCC-CCCCCCCCCCCHHHHHHHHHH
Q ss_conf             111026035789999998751048035899999999976974---8211222524203-543345546532347889989
Q gi|254780768|r   82 QDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS---VVGAHEIVPELLV-QVGSLGTCVPNRDVKRDILAA  157 (281)
Q Consensus        82 ~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~---vi~~~~~l~~ll~-~~G~l~~~~p~~~~~~dI~~g  157 (281)
                      ..     ..    +......    .-.....+.....+.+.+   ..+...+...--- +...-....|...-...-..+
T Consensus        93 ~~-----~~----~~~~~~~----n~~~t~~l~~~~~~~~~~~~~~~Ss~~~~~~~~~~~~~~~~~~~p~~~y~~~K~~~  159 (321)
T 2pk3_A           93 NK-----KG----TFSTNVF----GTLHVLDAVRDSNLDCRILTIGSSEEYGMILPEESPVSEENQLRPMSPYGVSKASV  159 (321)
T ss_dssp             CH-----HH----HHHHHHH----HHHHHHHHHHHHTCCCEEEEEEEGGGTBSCCGGGCSBCTTSCCBCCSHHHHHHHHH
T ss_pred             CC-----CC----CCCCEEE----ECCHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             10-----01----2443143----01013566653187654443233146446677778988888899988131000332


Q ss_pred             HHHHHHHCCCCCEEEEEEECCEEEEEECCCCH--HHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCEEEECCCCHHHH
Q ss_conf             99999733267225999819748896253421--7999999975431234566771899934888753121066279999
Q gi|254780768|r  158 MKSAEALSELDVGQSAVSIGGRVVALEGIEGT--DSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV  235 (281)
Q Consensus       158 ~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGT--D~mi~R~~~~~~~~~~~~~~~~ilvK~~K~~QD~r~DlP~IG~~Ti  235 (281)
                      -..+....+-.--+.++++-+.|.+-....+.  ..++.+.......       ...........+.+..|....-..-+
T Consensus       160 e~~~~~~~~~~~~~~~~~r~~~v~G~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~  232 (321)
T 2pk3_A          160 GMLARQYVKAYGMDIIHTRTFNHIGPGQSLGFVTQDFAKQIVDIEME-------KQEPIIKVGNLEAVRDFTDVRDIVQA  232 (321)
T ss_dssp             HHHHHHHHHHHCCEEEEEEECEEECTTCCTTSHHHHHHHHHHHHHTT-------SSCSEEEESCSSCEEEEEEHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-------CCCCEEEECCCCEEEEEEHHHHHHHH
T ss_conf             12334667632764210101112222222222322101367899983-------89976760786605630006568889


Q ss_pred             HHHH---HCCCEEEEEECCCEEEECHHHHHHHHHHC
Q ss_conf             9999---84990999973977998589999999987
Q gi|254780768|r  236 QNVI---KAGLAGIALEAGKSLVLEKELVKKHADEA  268 (281)
Q Consensus       236 ~~~~---~ag~~giaiea~~~lild~~~~i~~a~~~  268 (281)
                      ..+.   ........+......-+ .+-.-..++..
T Consensus       233 ~~~~~~~~~~~~~~ni~~~~~~~~-~~~~~~~~~~~  267 (321)
T 2pk3_A          233 YWLLSQYGKTGDVYNVCSGIGTRI-QDVLDLLLAMA  267 (321)
T ss_dssp             HHHHHHHCCTTCEEEESCSCEEEH-HHHHHHHHHHS
T ss_pred             HHHHHHCCCCCCCCEEECCCCHHH-HHHHHHHHHHH
T ss_conf             999872355545310102221059-99999999986


No 43 
>>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate biosynthesis, PSI-2; 1.90A {Methylococcus capsulatus} (A:1-179)
Probab=61.47  E-value=11  Score=17.79  Aligned_cols=36  Identities=17%  Similarity=0.222  Sum_probs=30.2

Q ss_pred             CC-EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             97-39999779803899999999789978999954866
Q gi|254780768|r    1 MK-RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~-kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+ ||++| |.|..=..+|..+.++|+++.++......
T Consensus         1 M~mkI~ii-GaG~mG~~~A~~l~~~G~~V~~~~r~~~~   37 (179)
T 3i83_A            1 MSLNILVI-GTGAIGSFYGALLAKTGHCVSVVSRSDYE   37 (179)
T ss_dssp             --CEEEEE-SCCHHHHHHHHHHHHTTCEEEEECSTTHH
T ss_pred             CCCEEEEE-CCCHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             99889998-97999999999999689908999785699


No 44 
>>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} (A:)
Probab=61.22  E-value=11  Score=17.76  Aligned_cols=37  Identities=19%  Similarity=0.179  Sum_probs=32.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+|+-|..|+|.+=..+++.+..+|++++.+.-....
T Consensus         4 m~kIlItGatG~iG~~l~~~L~~~g~~V~~~~R~~~~   40 (227)
T 3dhn_A            4 VKKIVLIGASGFVGSALLNEALNRGFEVTAVVRHPEK   40 (227)
T ss_dssp             CCEEEEETCCHHHHHHHHHHHHTTTCEEEEECSCGGG
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             9999998899889999999999784989999888365


No 45 
>>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii DSM2661} (A:1-128)
Probab=60.96  E-value=4.7  Score=20.35  Aligned_cols=23  Identities=9%  Similarity=0.020  Sum_probs=12.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCC
Q ss_conf             39999779803899999999789
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKN   25 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g   25 (281)
                      |+|+|.-+|.--...++.++..+
T Consensus        15 rv~iiG~gg~~g~~~~~~l~~~~   37 (128)
T 2yv1_A           15 KAIVQGITGRQGSFHTKKMLECG   37 (128)
T ss_dssp             CEEEETTTSHHHHHHHHHHHHTT
T ss_pred             EEEEECCCCCHHHHHHHHHHHHC
T ss_conf             59998998847689999999819


No 46 
>>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} (A:1-191,A:370-394)
Probab=59.38  E-value=12  Score=17.56  Aligned_cols=71  Identities=15%  Similarity=0.161  Sum_probs=45.9

Q ss_pred             CC-EEEEEE-----CCCCHHHHHHHHHHHCCCCEEEEEECCCCCC--CCCC-----C--------CEEEEEHHHHHHHHH
Q ss_conf             97-399997-----7980389999999978997899995486673--1038-----8--------567873899999999
Q gi|254780768|r    1 MK-RLLIIA-----GSGMLPYYVAKAARLKNDEPVIASVLNECSF--DWQD-----F--------ECRELPLGDFCVLRS   59 (281)
Q Consensus         1 M~-kigIIA-----G~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~--~~~~-----~--------~~~~~~ig~ig~li~   59 (281)
                      |+ ||+++.     |.+..-..+++++.+.|+++.++........  ...+     .        ...+..+.....+.+
T Consensus        14 MKmkI~~v~~p~~GG~~~~~~~la~~L~~~G~eV~vit~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~l~~   93 (216)
T 2jjm_A           14 MKLKIGITCYPSVGGSGVVGTELGKQLAERGHEIHFITSGLPFRLNKVYPNIYFHEVTVNQYSVFQYPPYDLALASKMAE   93 (216)
T ss_dssp             -CCEEEEECCC--CHHHHHHHHHHHHHHHTTCEEEEECSSCC----CCCTTEEEECCCCC----CCSCCHHHHHHHHHHH
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             65779998999999699999999999997799899994799864211379706997045666610156035899999999


Q ss_pred             HHHHCCCCEEEE
Q ss_conf             998649540677
Q gi|254780768|r   60 ILHQYNIGRIVV   71 (281)
Q Consensus        60 ~Lk~~~i~~ivm   71 (281)
                      .+++++.+=|..
T Consensus        94 ~i~~~~~DiIh~  105 (216)
T 2jjm_A           94 VAQRENLDILHV  105 (216)
T ss_dssp             HHHHHTCSEEEE
T ss_pred             HHHHHCCCEEEE
T ss_conf             988709848983


No 47 
>>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} (A:1-115,A:228-286)
Probab=59.09  E-value=12  Score=17.52  Aligned_cols=71  Identities=17%  Similarity=0.119  Sum_probs=44.7

Q ss_pred             CEEEEE-ECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             739999-77980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    2 KRLLII-AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         2 ~kigII-AG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      ++||++ +|-|-|..  ++.+++.--..-++.+.+.....+-..+..++ ....-.+.++|.+.+|+-+|++=.-
T Consensus        23 ~~IgifdsG~Ggltv--~~~i~~~lp~~~~iy~~D~~~~Pyg~~s~~~i-~~~~~~~~~~L~~~g~~~iviaCNT   94 (174)
T 2jfq_A           23 KPIGVIDSGVGGLTV--AKEIMRQLPNETIYYLGDIGRCPYGPRPGEQV-KQYTVEIARKLMEFDIKMLVIACNT   94 (174)
T ss_dssp             SCEEEEESSSTTHHH--HHHHHHHCTTCCEEEEECTTTCCCTTSCHHHH-HHHHHHHHHHHTTSCCSEEEECCHH
T ss_pred             CCEEEEECCCCHHHH--HHHHHHHCCCCCEEEEECCCCCCCCCCCHHHH-HHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             988999689777999--99999978999989994488898888999999-9999999999985488779981464


No 48 
>>3egl_A DEGV family protein; alpha-beta-alpha sandwich, methylated lysines, structural genomics, PSI-2; HET: MLY MSE PLM; 2.41A {Corynebacterium glutamicum atcc 13032} (A:1-136)
Probab=58.58  E-value=13  Score=17.47  Aligned_cols=66  Identities=11%  Similarity=0.037  Sum_probs=43.5

Q ss_pred             CCEEEEEE-CCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCC-CEEEEEC
Q ss_conf             97399997-7980389999999978997899995486673103885678738999999999986495-4067702
Q gi|254780768|r    1 MKRLLIIA-GSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNI-GRIVVAG   73 (281)
Q Consensus         1 M~kigIIA-G~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i-~~ivmaG   73 (281)
                      |+|++||. ..-.||...++.   .|  +.++++.=.  .+-..+.....+.+++-..++.+.++|+ ++|+...
T Consensus         3 M~ki~IitDS~~dl~~~~~~~---~~--i~viPl~i~--~~~~~ykTS~ps~~~~~~~~~~l~~~g~yd~Ii~i~   70 (136)
T 3egl_A            3 AXPVRVIVDSSACLPTHVAED---LD--ITVINLHVX--NNGEERSTSGLSSLELAASYARQLERGGDDGVLALH   70 (136)
T ss_dssp             CCCCEEEEEGGGCCCHHHHHH---TT--EEEECCEEE--ECSSCEEEECCCHHHHHHHHHHHHHHTTTSCEEEEC
T ss_pred             CCCEEEEEECCCCCCHHHHHH---CC--CEEEEEEEE--ECCEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             888799997888999999987---89--689979999--999985557999799999999999847997299997


No 49 
>>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, gluconate utilization, pentose shunt; HET: GLO; 1.50A {Escherichia coli k-12} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* (A:1-186)
Probab=58.54  E-value=13  Score=17.46  Aligned_cols=154  Identities=9%  Similarity=-0.123  Sum_probs=75.3

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC----CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             97399997798038999999997899789999548667310----38856787389999999999864954067702423
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |.|||+| |.|..=..+|..+.++|+++.++..........    .+.......-.  .     .....+..++++=...
T Consensus        15 ~~~IgiI-G~G~mG~~lA~~l~~~G~~V~~~~~~~~~~~~~~a~~~~~~~~~~~~~--~-----~~~~~~d~~~~~v~~~   86 (186)
T 2zyd_A           15 KQQIGVV-GMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTV--K-----EFVESLETPRRILLMV   86 (186)
T ss_dssp             CBSEEEE-CCSHHHHHHHHHHHTTTCCEEEECSSHHHHHHHHHHSTTSCEEECSSH--H-----HHHHTBCSSCEEEECS
T ss_pred             CCEEEEE-CHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCCCCCHHCCH--H-----HHHHHCCCCCEEEEEC
T ss_conf             8869997-407889999999996799069982999999999982898767522349--9-----9997379999899979


Q ss_pred             C-CCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             2-100011102603578999999875104803589999999997697482112225242035433455465323478899
Q gi|254780768|r   77 R-RPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDIL  155 (281)
Q Consensus        77 k-rP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~  155 (281)
                      . .........+...... ...+...........-..........+++.++.....+.--...|.....   ..+...++
T Consensus        87 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~a~~~l~~~~---~~~~~~~~  162 (186)
T 2zyd_A           87 KAGAGTDAAIDSLKPYLD-KGDIIIDGGNTFFQDTIRRNRELSAEGFNFIGTGVSGGEEGALKGPSIMP---GGQKEAYE  162 (186)
T ss_dssp             CSSSHHHHHHHHHGGGCC-TTCEEEECSCCCHHHHHHHHHHHHHTTCEEEEEEEESHHHHHHHCCEEEE---ESCHHHHH
T ss_pred             CCCHHHHHHHHHHHHCCC-CCCEEEECCCCCHHHHHHHHHHHHHCCCEEECCCCCCCHHHHHHHCCCCC---CCCHHHHH
T ss_conf             997689999999983188-99789857975249999999999865992433534555366654201113---33088999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             89999997332
Q gi|254780768|r  156 AAMKSAEALSE  166 (281)
Q Consensus       156 ~g~~i~~~l~~  166 (281)
                      ....+++.+|.
T Consensus       163 ~v~~l~~~lG~  173 (186)
T 2zyd_A          163 LVAPILTKIAA  173 (186)
T ss_dssp             HHHHHHHHHSC
T ss_pred             HHHHHHHHCCH
T ss_conf             99999985123


No 50 
>>2d59_A Hypothetical protein PH1109; COA binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.65A {Pyrococcus horikoshii OT3} (A:)
Probab=57.02  E-value=13  Score=17.30  Aligned_cols=74  Identities=7%  Similarity=-0.181  Sum_probs=52.5

Q ss_pred             CEEEEEECC---CCHHHHHHHHHHHCCCCEEEEEECCCCCCC------CC------CCCEEEEEHHHHHHHHHHHHHCCC
Q ss_conf             739999779---803899999999789978999954866731------03------885678738999999999986495
Q gi|254780768|r    2 KRLLIIAGS---GMLPYYVAKAARLKNDEPVIASVLNECSFD------WQ------DFECRELPLGDFCVLRSILHQYNI   66 (281)
Q Consensus         2 ~kigIIAG~---G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~------~~------~~~~~~~~ig~ig~li~~Lk~~~i   66 (281)
                      +++|+|..+   |..-..+++.++..|++++.+.-.+.....      +.      +......+=.....+++.+.+.++
T Consensus        23 ~~iAVvGas~~~~~~g~~v~~~l~~~G~~V~~V~p~~~~i~g~~~~~sl~elp~~~Dlv~i~~p~~~~~~i~~e~~~~g~  102 (144)
T 2d59_A           23 KKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPKYEEVLGRKCYPSVLDIPDKIEVVDLFVKPKLTMEYVEQAIKKGA  102 (144)
T ss_dssp             CEEEEETCCSCTTSHHHHHHHHHHHTTCEEEEECTTCSEETTEECBSSGGGCSSCCSEEEECSCHHHHHHHHHHHHHHTC
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEECCCCHHHCCCCCCCCCCCCCCCCCEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             94999911599998259999999978998999897333007974566420146765079998588999999999997299


Q ss_pred             CEEEEECCC
Q ss_conf             406770242
Q gi|254780768|r   67 GRIVVAGAI   75 (281)
Q Consensus        67 ~~ivmaG~V   75 (281)
                      +.+++.-.-
T Consensus       103 k~v~~~~~g  111 (144)
T 2d59_A          103 KVVWFQYNT  111 (144)
T ss_dssp             SEEEECTTC
T ss_pred             CEEEEECCC
T ss_conf             999994264


No 51 
>>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} (A:)
Probab=56.21  E-value=14  Score=17.21  Aligned_cols=76  Identities=16%  Similarity=0.064  Sum_probs=53.2

Q ss_pred             CC-EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC--------------CCC----C-CE--------------
Q ss_conf             97-39999779803899999999789978999954866731--------------038----8-56--------------
Q gi|254780768|r    1 MK-RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD--------------WQD----F-EC--------------   46 (281)
Q Consensus         1 M~-kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~--------------~~~----~-~~--------------   46 (281)
                      |+ |+-|+.|+|-+=..+++.+..+|++++.+.-.......              +.+    . ..              
T Consensus         1 M~mkiLItGatGfiG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (286)
T 3gpi_A            1 MSLSKILIAGCGDLGLELARRLTAQGHEVTGLRRSAQPMPAGVQTLIADVTRPDTLASIVHLRPEILVYCVAASEYSDEH   80 (286)
T ss_dssp             -CCCCEEEECCSHHHHHHHHHHHHTTCCEEEEECTTSCCCTTCCEEECCTTCGGGCTTGGGGCCSEEEECHHHHHHC---
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             99886999892199999999999785989999787122606784999047787887643200223222222222222222


Q ss_pred             -EEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             -787389999999999864954067702423
Q gi|254780768|r   47 -RELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus        47 -~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                       ....+.....++...+..++..++++....
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~v~~ss~~  111 (286)
T 3gpi_A           81 YRLSYVEGLRNTLSALEGAPLQHVFFVSSTG  111 (286)
T ss_dssp             --CCSHHHHHHHHHHTTTSCCCEEEEEEEGG
T ss_pred             CCCCCCCCCCCCCHHHHHCCCCCCCCCCCCC
T ss_conf             2222222222100133313532111234321


No 52 
>>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} (A:)
Probab=55.95  E-value=14  Score=17.18  Aligned_cols=35  Identities=17%  Similarity=0.318  Sum_probs=32.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             97399997798038999999997899789999548
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLN   35 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~   35 (281)
                      |.||-|..|+|.+=..+++.+.++|++++++.-..
T Consensus         4 m~~IlVtGatG~iG~~lv~~Ll~~g~~V~~~~r~~   38 (321)
T 3c1o_A            4 MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPL   38 (321)
T ss_dssp             CCCEEEETTTSTTHHHHHHHHHHTTCCEEEEECCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             76899989997899999999996899489998888


No 53 
>>1wsa_A Asparaginase, asparagine amidohydrolase; signal, periplasmic; 2.20A {Wolinella succinogenes} (A:206-330)
Probab=54.16  E-value=15  Score=16.99  Aligned_cols=33  Identities=15%  Similarity=0.056  Sum_probs=16.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             399997798038999999997899789999548
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLN   35 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~   35 (281)
                      |++++-..-.++-...+++...|.+-+|+.--|
T Consensus        12 ~V~il~~~pG~~~~~i~~~~~~~~~GiVi~~~G   44 (125)
T 1wsa_A           12 RVDILYAHPDDTDVLVNAALQAGAKGIIHAGMG   44 (125)
T ss_dssp             CEEEEECCSSCCSHHHHHHHHTTCSEEEEEEBT
T ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCEEEEECCC
T ss_conf             079999689999999999986799679996557


No 54 
>>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} (A:)
Probab=53.97  E-value=14  Score=17.17  Aligned_cols=74  Identities=8%  Similarity=-0.055  Sum_probs=52.0

Q ss_pred             CEEEEEECC---CCHHHHHHHHHHHCCCCEEEEEECCCCCC------CCC------CCCEEEEEHHHHHHHHHHHHHCCC
Q ss_conf             739999779---80389999999978997899995486673------103------885678738999999999986495
Q gi|254780768|r    2 KRLLIIAGS---GMLPYYVAKAARLKNDEPVIASVLNECSF------DWQ------DFECRELPLGDFCVLRSILHQYNI   66 (281)
Q Consensus         2 ~kigIIAG~---G~LP~~ia~~~~~~g~~~~ii~l~~~~~~------~~~------~~~~~~~~ig~ig~li~~Lk~~~i   66 (281)
                      +++++|.-+   |.+-..+..+++..|++++.+.-.+....      .+.      +......+=.+...+++.+...++
T Consensus        15 ~~iaVvGas~~~~~~g~~i~~~l~~~g~~v~~Vnp~~~~i~g~~~y~sl~di~~~vDl~vi~vp~~~~~~~v~ea~~~gi   94 (138)
T 1y81_A           15 RKIALVGASKNPAKYGNIILKDLLSKGFEVLPVNPNYDEIEGLKCYRSVRELPKDVDVIVFVVPPKVGLQVAKEAVEAGF   94 (138)
T ss_dssp             CEEEEETCCSCTTSHHHHHHHHHHHTTCEEEEECTTCSEETTEECBSSGGGSCTTCCEEEECSCHHHHHHHHHHHHHTTC
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCC
T ss_conf             77999832799998199999999978997999715543147973555641134332068998078999999999985699


Q ss_pred             CEEEEECCC
Q ss_conf             406770242
Q gi|254780768|r   67 GRIVVAGAI   75 (281)
Q Consensus        67 ~~ivmaG~V   75 (281)
                      +.++|...-
T Consensus        95 ~~~~~~~~g  103 (138)
T 1y81_A           95 KKLWFQPGA  103 (138)
T ss_dssp             CEEEECTTS
T ss_pred             CEEEEECCC
T ss_conf             889850660


No 55 
>>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.07A {Escherichia coli K12} (A:1-94,A:422-459)
Probab=53.93  E-value=7.8  Score=18.90  Aligned_cols=69  Identities=13%  Similarity=0.066  Sum_probs=48.6

Q ss_pred             CCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             85678738999999999986495406770242321000111026035789999998751048035899999999976974
Q gi|254780768|r   44 FECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS  123 (281)
Q Consensus        44 ~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~  123 (281)
                      ......+-...-.+++.+.+.+++-++|..++.  ...             .               +.+.+.-++.|++
T Consensus        39 laVI~vpp~~v~~vi~ea~~~GvkvViIt~G~~--e~~-------------~---------------~~l~~~Ar~~Gir   88 (132)
T 3dmy_A           39 LALISVAGEYAAELANQALDRNLNVXXFSDNVT--LED-------------E---------------IQLKTRAREKGLL   88 (132)
T ss_dssp             EEEECSCHHHHHHHHHHHHHTTCEEEECCCCCC--HHH-------------H---------------HHHHHHHHHTTCC
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCCEEEEECCCC--HHH-------------H---------------HHHHHHHHHCCCE
T ss_conf             899972889999999999987997899959999--899-------------9---------------9999999987999


Q ss_pred             EECHHHCCHHHCCCCCCCC
Q ss_conf             8211222524203543345
Q gi|254780768|r  124 VVGAHEIVPELLVQVGSLG  142 (281)
Q Consensus       124 vi~~~~~l~~ll~~~G~l~  142 (281)
                      +++++-..|+++-+-.++.
T Consensus        89 IIGPNC~~~~~~~~~~~~~  107 (132)
T 3dmy_A           89 VXGPDCHTPSLLENVAVIN  107 (132)
T ss_dssp             EECSSCCCCHHHHCCCEEE
T ss_pred             EECCCCCCCCCCCCCCHHH
T ss_conf             9989986776433420244


No 56 
>>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii OT3} (A:1-126)
Probab=53.81  E-value=8.7  Score=18.56  Aligned_cols=75  Identities=13%  Similarity=0.057  Sum_probs=46.0

Q ss_pred             CEEEEEEC---CCCHHHHHHHHHHHC-CCCEEEEEECCCCC------CCCC------CCCEEEEEHHHHHHHHHHHHHCC
Q ss_conf             73999977---980389999999978-99789999548667------3103------88567873899999999998649
Q gi|254780768|r    2 KRLLIIAG---SGMLPYYVAKAARLK-NDEPVIASVLNECS------FDWQ------DFECRELPLGDFCVLRSILHQYN   65 (281)
Q Consensus         2 ~kigIIAG---~G~LP~~ia~~~~~~-g~~~~ii~l~~~~~------~~~~------~~~~~~~~ig~ig~li~~Lk~~~   65 (281)
                      ++++++..   .|.+-..+.++++.. ++.++.+.-.+...      +.+.      |......+=.+...++..+.+.+
T Consensus         9 ~~iaVvG~s~~~~~~~~~v~~~l~~~~~~~V~pVnp~~~~i~g~~~y~sl~el~~~~D~v~i~~p~~~~~~~v~e~~~~g   88 (126)
T 2csu_A            9 KGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEIDLAIIVVPKRFVKDTLIQCGEKG   88 (126)
T ss_dssp             SEEEEETCCSCTTSHHHHHHHHHTTCCSSEEEEECSSCSEETTEECBSSTTSCSSCCSEEEECSCHHHHHHHHHHHHHHT
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCCEECCEECCCCHHHCCCCCCEEEEEECHHHHHHHHHHHHHCC
T ss_conf             86999885799986379999999847996189978998607987576998886999898999977899899999999849


Q ss_pred             CCEEEEE-CCCC
Q ss_conf             5406770-2423
Q gi|254780768|r   66 IGRIVVA-GAID   76 (281)
Q Consensus        66 i~~ivma-G~V~   76 (281)
                      ++.+++. |.++
T Consensus        89 i~~ii~~~~g~~  100 (126)
T 2csu_A           89 VKGVVIITAGFG  100 (126)
T ss_dssp             CCEEEECCCSST
T ss_pred             CCEEEEECCCCC
T ss_conf             988997167766


No 57 
>>2zkl_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, isomerase; 2.61A {Staphylococcus aureus} (A:1-130)
Probab=53.47  E-value=15  Score=16.92  Aligned_cols=74  Identities=9%  Similarity=0.038  Sum_probs=55.4

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--------------------CCCEEEEEHHHHHHHHHHHH
Q ss_conf             3999977980389999999978997899995486673103--------------------88567873899999999998
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--------------------DFECRELPLGDFCVLRSILH   62 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--------------------~~~~~~~~ig~ig~li~~Lk   62 (281)
                      ||-|..|+|-+=..+.+.+..+|+++++..-.........                    .......++...-.+++..+
T Consensus         2 kIlVtGasGfiG~~lv~~L~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~nv~~~~~l~~a~~   81 (130)
T 2zkl_A            2 NIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALLKADFIVHLAGVNRPEHDKEFSLGNVSYLDHVLDILT   81 (130)
T ss_dssp             EEEEETTTSHHHHHHHHHHHHHCCCEEEEECTTCCHHHHHHHHHHCSEEEECCCC--------CCSSCCCHHHHHHHHHT
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             89999999779999999998579949999679899999998707999999896757889889999999888664677642


Q ss_pred             HCCCCEEEEECCCC
Q ss_conf             64954067702423
Q gi|254780768|r   63 QYNIGRIVVAGAID   76 (281)
Q Consensus        63 ~~~i~~ivmaG~V~   76 (281)
                      +.+++++++...-.
T Consensus        82 ~~~~~~~v~~s~~~   95 (130)
T 2zkl_A           82 RNTKKPAILLSSSI   95 (130)
T ss_dssp             TCSSCCEEEEEEEG
T ss_pred             CCCCCCCCCCCCCC
T ss_conf             34211111222222


No 58 
>>1o7j_A L-asparaginase; atomic resolution, hydrolase; 1.0A {Erwinia chrysanthemi} (A:208-327)
Probab=53.44  E-value=12  Score=17.52  Aligned_cols=102  Identities=11%  Similarity=0.003  Sum_probs=42.1

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEE----EEECCCCCC
Q ss_conf             3999977980389999999978997899995486673103885678738999999999986495406----770242321
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRI----VVAGAIDRR   78 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~i----vmaG~V~kr   78 (281)
                      |+.|+-..-...-.+.+++...|.+-+|+.-.|.-+..     .      .+-..++.+.+++|-=+    |.-|.+.. 
T Consensus        12 ~V~il~~~pG~~~~~i~~~~~~~~~GiVi~~~G~G~~p-----~------~~~~~l~~~~~~gi~vv~~Sr~~~G~v~~-   79 (120)
T 1o7j_A           12 KVDILYGYQDDPEYLYDAAIQHGVKGIVYAGMGAGSVS-----V------RGIAGMRKALEKGVVVMRSTRTGNGIVPP-   79 (120)
T ss_dssp             CEEEEECCTTCCTHHHHHHHHTTCSEEEEEEBTTTBCC-----H------HHHHHHHHHHHTTCEEEEEESSSBSCBCC-
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCCCC-----H------HHHHHHHHHHHCCCEEEEEEECCCCCCCC-
T ss_conf             67999848999999999998579989999566898899-----8------99999999997897799986279986365-


Q ss_pred             CCHHHHC--CCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             0001110--2603578999999875104803589999999997
Q gi|254780768|r   79 PNVQDLC--FSIKDSLRISKMIWQLVSGGNAAILKASIDLLES  119 (281)
Q Consensus        79 P~~~~l~--~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~  119 (281)
                      -.....-  -|+.+-..-.++.+.+ .+++|  ...+.++|+-
T Consensus        80 ~~~~~~i~~g~Lt~ekAr~kL~~~L-~~~~~--~~~i~~~f~T  119 (120)
T 1o7j_A           80 DEELPGLVSDSLNPAHARILLMLAL-TRTSD--PKVIQEYFHT  119 (120)
T ss_dssp             CTTSSSEECBTCCHHHHHHHHHHHT-TTCCC--HHHHHHHHHH
T ss_pred             CCCCCEEECCCCCHHHHHHHHHHHH-HCCCC--HHHHHHHHHH
T ss_conf             6546946889989999999999998-28999--9999999974


No 59 
>>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} (A:1-122)
Probab=53.27  E-value=11  Score=17.77  Aligned_cols=106  Identities=9%  Similarity=-0.030  Sum_probs=50.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC-CCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCH
Q ss_conf             39999779803899999999789978999954866-73103885678738999999999986495406770242321000
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNV   81 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~-~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~   81 (281)
                      |+|+|.-+|..-...++.++..+ ++.++++.+.. ...... ...+-++.      +.+....++=++.+..-..++  
T Consensus         9 rvaiiG~g~~~~~~~~~~~~~~~-~~~i~~v~d~~~~~~~~~-~~~~~~~~------~~~~~~~~D~V~i~~p~~~h~--   78 (122)
T 2nu8_A            9 KVICQGFTGSQGTFHSEQAIAYG-TKMVGGVTPGKGGTTHLG-LPVFNTVR------EAVAATGATASVIYVPAPFCK--   78 (122)
T ss_dssp             EEEEETTTSHHHHHHHHHHHHHT-CEEEEEECTTCTTCEETT-EEEESSHH------HHHHHHCCCEEEECCCGGGHH--
T ss_pred             EEEEECCCCCHHHHHHHHHHHHC-CCEEEEECCCCCCEEEEC-CCCCCCHH------HHHHCCCCCEEEEECCCHHHH--
T ss_conf             29998897848789999999847-954887469967404417-50336323------433045870699832505666--


Q ss_pred             HHHCCCHHHHHHHHHHHHH----HHCC---CCHHHHHHHHHHHHHCCCEEECHH
Q ss_conf             1110260357899999987----5104---803589999999997697482112
Q gi|254780768|r   82 QDLCFSIKDSLRISKMIWQ----LVSG---GNAAILKASIDLLESYGVSVVGAH  128 (281)
Q Consensus        82 ~~l~~D~~~~~~l~k~l~~----~~~~---gDd~iL~~i~~~fe~~G~~vi~~~  128 (281)
                           +.     +...+..    +..+   -+..=+..+.+.-++.|..+++.+
T Consensus        79 -----~~-----~~~~~~~g~~v~~ekP~~~~~~~~~~l~~~a~~~~~~~~g~N  122 (122)
T 2nu8_A           79 -----DS-----ILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAGVRMIGPN  122 (122)
T ss_dssp             -----HH-----HHHHHHTTCSEEEECCCCCCHHHHHHHHHHHHHHTCEEECSS
T ss_pred             -----HH-----HHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHCCCEEECCC
T ss_conf             -----77-----889886799889962775278888999887763497898678


No 60 
>>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomics; HET: ADN; 1.40A {Thermus thermophilus HB8} (A:)
Probab=53.26  E-value=15  Score=16.90  Aligned_cols=37  Identities=22%  Similarity=0.228  Sum_probs=32.0

Q ss_pred             CCEEEEEECCC-CHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             97399997798-03899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSG-MLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G-~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+|.+||.|.+ -+=..+++.+-++|.++++.....+.
T Consensus         1 M~K~alITGas~GIG~a~a~~l~~~G~~Vv~~~r~~~~   38 (242)
T 1uay_A            1 MERSALVTGGASGLGRAAALALKARGYRVVVLDLRREG   38 (242)
T ss_dssp             -CCEEEEETTTSHHHHHHHHHHHHHTCEEEEEESSCCS
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             99899997888889999999999879989999786324


No 61 
>>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} (A:1-150)
Probab=52.71  E-value=12  Score=17.72  Aligned_cols=31  Identities=6%  Similarity=0.110  Sum_probs=16.0

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEE
Q ss_conf             3999977980389999999978997899995
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASV   33 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l   33 (281)
                      |+|||.-.|..-...++.+......+-++.+
T Consensus         6 ~v~iiG~~G~ig~~~~~~~~~~~~~~~~~~~   36 (150)
T 1r0k_A            6 TVTVLGATGSIGHSTLDLIERNLDRYQVIAL   36 (150)
T ss_dssp             EEEEETTTSHHHHHHHHHHHHTGGGEEEEEE
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             8999886879889999999839677279999


No 62 
>>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} (A:)
Probab=52.52  E-value=15  Score=16.90  Aligned_cols=74  Identities=8%  Similarity=-0.085  Sum_probs=51.5

Q ss_pred             CEEEEEECC---CCHHHHHHHHHHHCCCCEEEEEECCCCC--------CCCCCC----C--EEEEEHHHHHHHHHHHHHC
Q ss_conf             739999779---8038999999997899789999548667--------310388----5--6787389999999999864
Q gi|254780768|r    2 KRLLIIAGS---GMLPYYVAKAARLKNDEPVIASVLNECS--------FDWQDF----E--CRELPLGDFCVLRSILHQY   64 (281)
Q Consensus         2 ~kigIIAG~---G~LP~~ia~~~~~~g~~~~ii~l~~~~~--------~~~~~~----~--~~~~~ig~ig~li~~Lk~~   64 (281)
                      +++|+|..+   |.+-..+++.++..|++++.+..+....        +.+.+.    +  ....+=.....+++.+.+.
T Consensus        14 k~iAViG~S~~~~~~g~~v~~~l~~~g~~v~~v~p~~~~~ei~G~~~~~sl~eip~~iD~v~i~~p~~~~~~~i~e~~~~   93 (145)
T 2duw_A           14 RTIALVGASDKPDRPSYRVMKYLLDQGYHVIPVSPKVAGKTLLGQQGYATLADVPEKVDMVDVFRNSEAAWGVAQEAIAI   93 (145)
T ss_dssp             CCEEEESCCSCTTSHHHHHHHHHHHHTCCEEEECSSSTTSEETTEECCSSTTTCSSCCSEEECCSCSTHHHHHHHHHHHH
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCEEEEEEEECCCCHHHCCCCCCEEEEECCHHHHHHHHHHHHHC
T ss_conf             93999920799998389999999868986898524544125620622575444676211689951499999999999972


Q ss_pred             CCCEEEEECCC
Q ss_conf             95406770242
Q gi|254780768|r   65 NIGRIVVAGAI   75 (281)
Q Consensus        65 ~i~~ivmaG~V   75 (281)
                      +++.+++...-
T Consensus        94 g~k~~~~~~~~  104 (145)
T 2duw_A           94 GAKTLWLQLGV  104 (145)
T ss_dssp             TCCEEECCTTC
T ss_pred             CCCEEEECCCH
T ss_conf             99759952454


No 63 
>>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} (A:)
Probab=52.33  E-value=16  Score=16.80  Aligned_cols=168  Identities=10%  Similarity=0.027  Sum_probs=93.7

Q ss_pred             CEEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCCCCCCCCC--CCEEEEE---HHHHHHHHHHHHHC--CCCEEEEEC
Q ss_conf             73999977980-3899999999789978999954866731038--8567873---89999999999864--954067702
Q gi|254780768|r    2 KRLLIIAGSGM-LPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELP---LGDFCVLRSILHQY--NIGRIVVAG   73 (281)
Q Consensus         2 ~kigIIAG~G~-LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~--~~~~~~~---ig~ig~li~~Lk~~--~i~~ivmaG   73 (281)
                      +|+++|.|.+. +=..+++.+.+.|.+++++....+.....+.  -.+...+   ..++.++++.+.++  .++-+|-.-
T Consensus         6 gkvalITGassGIG~aia~~la~~Ga~Vv~~~r~~~~~~~~~~~~~~~~~~Dvt~~~~i~~~~~~~~~~~G~iD~linnA   85 (256)
T 2d1y_A            6 GKGVLVTGGARGIGRAIAQAFAREGALVALCDLRPEGKEVAEAIGGAFFQVDLEDERERVRFVEEAAYALGRVDVLVNNA   85 (256)
T ss_dssp             TCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSTTHHHHHHHHTCEEEECCTTCHHHHHHHHHHHHHHHSCCCEEEECC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEEEECC
T ss_conf             98899948987899999999998799999996887899999875993999858999999999999998489971999899


Q ss_pred             CCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             42321000111026035789999998751048035899999999976974821122252420354334554653234788
Q gi|254780768|r   74 AIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus        74 ~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      .+.....+.....+  .   ..+.+ .....+--...+.....+........-...........+...   .+...-..-
T Consensus        86 g~~~~~~~~~~~~e--~---~~~~~-~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~  156 (256)
T 2d1y_A           86 AIAAPGSALTVRLP--E---WRRVL-EVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENA---AYNASKGGL  156 (256)
T ss_dssp             CCCCCBCTTTCCHH--H---HHHHH-HHHTHHHHHHHHHHHHHHHTTTCEEEEEECCGGGTSBCTTBH---HHHHHHHHH
T ss_pred             CCCCCCCHHHCCHH--H---HHHHH-HHHHHHHHHHHHHHHHCCCCCCCCCCCEEECHHHHCCCCCCC---HHHHHHHHH
T ss_conf             99999881129999--9---99999-973268877777653011134665342130244430344543---067899999


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEEECC
Q ss_conf             9989999997332672259998197
Q gi|254780768|r  154 ILAAMKSAEALSELDVGQSAVSIGG  178 (281)
Q Consensus       154 I~~g~~i~~~l~~~DiGQsvVv~~g  178 (281)
                      ..+....+..++...+--.+|.-+.
T Consensus       157 ~~~~~~~a~~~~~~~irvn~i~Pg~  181 (256)
T 2d1y_A          157 VNLTRSLALDLAPLRIRVNAVAPGA  181 (256)
T ss_dssp             HHHHHHHHHHHGGGTEEEEEEEECS
T ss_pred             HHHHHHHHHHHCHHCEEEEEEEECC
T ss_conf             9999999998542090899996098


No 64 
>>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} (A:)
Probab=52.19  E-value=16  Score=16.79  Aligned_cols=123  Identities=12%  Similarity=0.048  Sum_probs=64.3

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC----CCC--CCEEEEEHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             9739999779803899999999789978999954866731----038--8567873899999999998649540677024
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD----WQD--FECRELPLGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~----~~~--~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      |++==+|.|.|..-..+++.+.+.|++++++....+....    ..+  +...+-+.... ..++...-..++.++.+=.
T Consensus         2 ~~~~viIiG~G~~G~~ia~~L~~~g~~v~vid~d~~~~~~~~~~~~~~~~~~~~gD~~~~-~~l~~a~i~~ad~vi~~~~   80 (153)
T 1id1_A            2 RKDHFIVCGHSILAINTILQLNQRGQNVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDS-SVLKKAGIDRCRAILALSD   80 (153)
T ss_dssp             CCSCEEEECCSHHHHHHHHHHHHTTCCEEEEECCCHHHHHHHHHHHCTTCEEEESCTTSH-HHHHHHTTTTCSEEEECSS
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEECCCCH-HHHHHCCCCCCCEEEEEEC
T ss_conf             988799989998999999999976998799988837789999974138977999537998-9996368352999999848


Q ss_pred             CCCCCCHHHHCCCHHHHHHHHHHHHHHH----CCCCHHHHHHHHHHHHHCCC-EEECHHHCCHHHCCC
Q ss_conf             2321000111026035789999998751----04803589999999997697-482112225242035
Q gi|254780768|r   75 IDRRPNVQDLCFSIKDSLRISKMIWQLV----SGGNAAILKASIDLLESYGV-SVVGAHEIVPELLVQ  137 (281)
Q Consensus        75 V~krP~~~~l~~D~~~~~~l~k~l~~~~----~~gDd~iL~~i~~~fe~~G~-~vi~~~~~l~~ll~~  137 (281)
                      -+     ...   ... ..+.+.++...    .-.|+    .-...|++.|. .++.+..+....+..
T Consensus        81 ~d-----~~~---~~~-~~~~~~~~~~~~ii~~~~~~----~~~~~l~~~g~~~vi~~~~~~~~~l~~  135 (153)
T 1id1_A           81 ND-----ADN---AFV-VLSAKDMSSDVKTVLAVSDS----KNLNKIKMVHPDIILSPQLFGSEILAR  135 (153)
T ss_dssp             CH-----HHH---HHH-HHHHHHHTSSSCEEEECSSG----GGHHHHHTTCCSEEECHHHHHHHHHHH
T ss_pred             CH-----HHH---HHH-HHHHHHHCCCCEEEEEECCH----HHHHHHHHCCCCEEECHHHHHHHHHHH
T ss_conf             85-----999---999-99999978998399997899----999999978999999989999999999


No 65 
>>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* (A:1-97,A:210-269)
Probab=52.18  E-value=16  Score=16.78  Aligned_cols=71  Identities=13%  Similarity=0.089  Sum_probs=44.3

Q ss_pred             CEEEEE-ECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             739999-77980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    2 KRLLII-AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         2 ~kigII-AG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      .+||++ +|-|-|.+  ++++++.--+.-++.+.+.+...+-+.+..++. .-.-.+.++|.+++|+-+|+|=.-
T Consensus         6 ~~IgifDSGvGGltv--~~~i~~~lP~~~~iy~~D~~~~PYG~ks~~~i~-~~~~~~~~~l~~~~~~~iviACNT   77 (157)
T 3ist_A            6 QAIGFIDSGVGGLTV--VREVLKQLPHEQVYYLGDTARCPYGPRDKEEVA-KFTWEXTNFLVDRGIKXLVIACNT   77 (157)
T ss_dssp             CCEEEEESSSTTHHH--HHHHHHHCTTCCEEEEECGGGCCCTTSCHHHHH-HHHHHHHHHHHHTTCSEEEECCHH
T ss_pred             CCEEEEECCCCHHHH--HHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHH-HHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             968999689657999--999999789999899953789998999999999-999999999986599879994485


No 66 
>>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} (A:1-125,A:392-441)
Probab=51.57  E-value=16  Score=16.72  Aligned_cols=119  Identities=12%  Similarity=0.072  Sum_probs=73.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC----CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             7399997798038999999997899789999548667310----388567873899999999998649540677024232
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDR   77 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~k   77 (281)
                      +|-.+|-|+|-+-..+++.+.+.|+++++.....+.-..+    .+......++.+...+-+.++.  ++-||-.-....
T Consensus         3 gK~VLVtGAGgIG~~ia~~L~~~G~~V~v~~r~~e~~~~l~~~~~~~~~v~~Dv~d~~~l~~~v~~--~DiVI~~ag~~~   80 (175)
T 1ff9_A            3 TKSVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESAKKLSAGVQHSTPISLDVNDDAALDAEVAK--HDLVISLIPYTF   80 (175)
T ss_dssp             CCEEEEECCSTTHHHHHHHHHTTTCEEEEEESSHHHHHHTTTTCTTEEEEECCTTCHHHHHHHHTT--SSEEEECCC--C
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHCC--CCEEEECCCCCC
T ss_conf             877999888899999999998294979999798999999997578887068347897999998628--999999999522


Q ss_pred             CCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHC
Q ss_conf             10001110260357899999987510480358999999999769748211222
Q gi|254780768|r   78 RPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEI  130 (281)
Q Consensus        78 rP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~  130 (281)
                      .+.+.+..      ....+....  ..-.....+.+.....+.|..++..-..
T Consensus        81 ~~~v~~~~------~~~~~~~v~--~n~~~~~~~~l~~~~k~aG~~~i~~is~  125 (175)
T 1ff9_A           81 HATVIKSA------IRQKKHVVT--TSYVSPAMMELDQAAKDAGITVMNEIGL  125 (175)
T ss_dssp             HHHHHHHH------HHHTCEEEE--SSCCCHHHHHTHHHHHHTTCEEECSCBB
T ss_pred             CHHHHHHH------HHHCCCEEE--CCCCHHHHHHHHHHHHHCCCEEECCCCC
T ss_conf             79999999------984897993--6643267999999987549587325666


No 67 
>>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.3A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* (A:1-178)
Probab=51.50  E-value=16  Score=16.71  Aligned_cols=146  Identities=10%  Similarity=-0.065  Sum_probs=77.6

Q ss_pred             CC--EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC----CCCEEEEE-HHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             97--3999977980389999999978997899995486673103----88567873-89999999999864954067702
Q gi|254780768|r    1 MK--RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ----DFECRELP-LGDFCVLRSILHQYNIGRIVVAG   73 (281)
Q Consensus         1 M~--kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~----~~~~~~~~-ig~ig~li~~Lk~~~i~~ivmaG   73 (281)
                      |.  |||+| |.|..=..+|..+..+|+++.++...........    ........ ..+      ...  .++.++.+-
T Consensus         3 Ms~~~I~vI-G~G~mG~~iA~~l~~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~--~~d~v~~~~   73 (178)
T 2iz1_A            3 MAQANFGVV-GMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVFKEHQDKNLVFTKTLEE------FVG--SLEKPRRIM   73 (178)
T ss_dssp             CTTBSEEEE-CCSHHHHHHHHHHHHTTCCEEEECSSHHHHHHHHHHTTTSCEEECSSHHH------HHH--TBCSSCEEE
T ss_pred             CCCCCEEEE-EEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCEECCCHHH------HHH--HCCCCCEEE
T ss_conf             888987898-04899999999999779928999799999999998555589753699999------996--178999899


Q ss_pred             CCCCCCCHHHHCCCHHHHHHHHHHHH--------HHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCC
Q ss_conf             42321000111026035789999998--------7510480358999999999769748211222524203543345546
Q gi|254780768|r   74 AIDRRPNVQDLCFSIKDSLRISKMIW--------QLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCV  145 (281)
Q Consensus        74 ~V~krP~~~~l~~D~~~~~~l~k~l~--------~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~  145 (281)
                      ...  +......      .....++.        .........+.......+...+..++.....-+......+......
T Consensus        74 ~~~--~~~~~~~------~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  145 (178)
T 2iz1_A           74 LMV--QAGAATD------ATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGINFIGTGVSGGEKGALLGPSMMPG  145 (178)
T ss_dssp             ECC--CTTHHHH------HHHHHHGGGCCTTCEEEECSCCCHHHHHHHHHHTTTSSCEEEEEEECSHHHHHHHCCCEEEE
T ss_pred             EEC--CCCHHHH------HHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHHHHCCCCEEEE
T ss_conf             978--9817999------99999985177998898346654499999997413202220054235677878503665652


Q ss_pred             CCHHHHHHHHHHHHHHHHHCC
Q ss_conf             532347889989999997332
Q gi|254780768|r  146 PNRDVKRDILAAMKSAEALSE  166 (281)
Q Consensus       146 p~~~~~~dI~~g~~i~~~l~~  166 (281)
                      -   +....+...++++.+|.
T Consensus       146 ~---~~~~~~~v~~l~~~lG~  163 (178)
T 2iz1_A          146 G---QKEAYDLVAPIFEQIAA  163 (178)
T ss_dssp             E---CHHHHHHHHHHHHHHSC
T ss_pred             C---CHHHHHHHHHHHHHHHC
T ss_conf             6---39999999999998613


No 68 
>>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} (A:)
Probab=51.48  E-value=16  Score=16.71  Aligned_cols=71  Identities=14%  Similarity=0.108  Sum_probs=50.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             97399997798038999999997899789999548667310---38856787389999999999864954067702
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---QDFECRELPLGDFCVLRSILHQYNIGRIVVAG   73 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG   73 (281)
                      |+|+-|..|.|-+=..+++.+.++|+++.++..........   .........+.+...+...+..  ++.++..-
T Consensus         4 mk~ilItGatG~iG~~l~~~Ll~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~~~~~~~~--~d~v~~~~   77 (253)
T 1xq6_A            4 LPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQG--IDALVILT   77 (253)
T ss_dssp             CCEEEEESTTSHHHHHHHHHHHHTTTTCEEEEEESCHHHHHHTTCCTTEEECCTTSHHHHHHHHTT--CSEEEECC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCHHHHHHCCCCCEEEEEEEECHHHHHHHHCC--CCEEEEEE
T ss_conf             997999898658999999999976994799997078788775146734898543110467898729--76899985


No 69 
>>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} (A:1-204)
Probab=51.29  E-value=16  Score=16.69  Aligned_cols=35  Identities=20%  Similarity=0.370  Sum_probs=29.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |+|++|| |.|.-=..+|..+..+|+++.++....+
T Consensus        15 ~krVaVI-GaG~~Gl~~A~~la~~G~~V~v~er~~~   49 (204)
T 1f0y_A           15 VKHVTVI-GGGLMGAGIAQVAAATGHTVVLVDQTED   49 (204)
T ss_dssp             CCEEEEE-CCSHHHHHHHHHHHHTTCEEEEECSCHH
T ss_pred             EEEEEEE-CCCHHHHHHHHHHHHCCCCEEEEECCHH
T ss_conf             3289998-9698999999999928996799989889


No 70 
>>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} (A:18-74)
Probab=51.07  E-value=16  Score=16.85  Aligned_cols=35  Identities=14%  Similarity=0.242  Sum_probs=28.1

Q ss_pred             HHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHH
Q ss_conf             999997332672259998197488962534217999999
Q gi|254780768|r  158 MKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRI  196 (281)
Q Consensus       158 ~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~  196 (281)
                      ..+++.|...++|+-+|+.+|.++++    =|+.=|.|.
T Consensus        12 ~ea~~~M~~~~i~~l~Vvd~~~lvGI----iT~~Dl~~~   46 (57)
T 2rc3_A           12 FNAMQKMAADNIGALLVMKDEKLVGI----LTERDFSRK   46 (57)
T ss_dssp             HHHHHHHHHHTCSEEEEEETTEEEEE----EEHHHHHHH
T ss_pred             HHHHHHHHHCCCCEEEEEECCEEEEE----EEEEEEEEE
T ss_conf             99999999859878999509999988----753101100


No 71 
>>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoid, oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* (A:)
Probab=50.91  E-value=17  Score=16.65  Aligned_cols=76  Identities=14%  Similarity=0.098  Sum_probs=55.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---------CC----------------------C-----
Q ss_conf             97399997798038999999997899789999548667310---------38----------------------8-----
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---------QD----------------------F-----   44 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---------~~----------------------~-----   44 (281)
                      |.|+.|..|.|.+=..+++.+.++|++++++.-........         .+                      .     
T Consensus        10 ~~~VlVtGatG~iG~~lv~~Ll~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (346)
T 3i6i_A           10 KGRVLIAGATGFIGQFVATASLDAHRPTYILARPGPRSPSKAKIFKALEDKGAIIVYGLINEQEAMEKILKEHEIDIVVS   89 (346)
T ss_dssp             -CCEEEECTTSHHHHHHHHHHHHTTCCEEEEECSSCCCHHHHHHHHHHHHTTCEEEECCTTCHHHHHHHHHHTTCCEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHCCCCCEEEEE
T ss_conf             99199989984899999999996899789998999887546889887532880899930345105777644675027992


Q ss_pred             CEEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             56787389999999999864954067702423
Q gi|254780768|r   45 ECRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus        45 ~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      .....++.....+++..+..++..+++.....
T Consensus        90 ~~~~~~~~~~~~~~~a~~~~~~~~~v~~ss~~  121 (346)
T 3i6i_A           90 TVGGESILDQIALVKAMKAVGTIKRFLPSEFG  121 (346)
T ss_dssp             CCCGGGGGGHHHHHHHHHHHCCCSEEECSCCS
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEE
T ss_conf             68861266788999999973976999985666


No 72 
>>1vi2_A Shikimate 5-dehydrogenase 2; structural genomics, oxidoreductase; HET: MSE NAD; 2.10A {Escherichia coli} (A:123-257)
Probab=50.44  E-value=17  Score=16.61  Aligned_cols=116  Identities=11%  Similarity=0.078  Sum_probs=64.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC-C----------CCCCEEEEEHHHHHHHHHHHHHCCCCEEE
Q ss_conf             739999779803899999999789978999954866731-0----------38856787389999999999864954067
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-W----------QDFECRELPLGDFCVLRSILHQYNIGRIV   70 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~-~----------~~~~~~~~~ig~ig~li~~Lk~~~i~~iv   70 (281)
                      +|.++|-|.|-+=+.+++.+.+.|..++++.-++..... +          .+..........+..+.....  .++-+|
T Consensus         4 ~K~~lVtGa~GiG~aia~~la~~G~~vi~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~D~lV   81 (135)
T 1vi2_A            4 GKTXVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEFFDKALAFAQRVNENTDCVVTVTDLADQQAFAEALA--SADILT   81 (135)
T ss_dssp             TCEEEEECCSHHHHHHHHHHHHTTCSEEEEEECSSTTHHHHHHHHHHHHHHSSCEEEEEETTCHHHHHHHHH--TCSEEE
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEECCCCHHHHHHHHCC--CCCEEE
T ss_conf             886688535552047889987517653311368878899999999984325454420021000145676525--773785


Q ss_pred             EECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH---HCCCEEE
Q ss_conf             702423210001110260357899999987510480358999999999---7697482
Q gi|254780768|r   71 VAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE---SYGVSVV  125 (281)
Q Consensus        71 maG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe---~~G~~vi  125 (281)
                      -...+.....+.+.-.+..     .+ ++...-.++-...+.+..++.   +.|-.++
T Consensus        82 nnag~~~~~~~~~~~~~~~-----~~-~~~~n~~~~~~~~~~~~~~m~~~~~~g~~II  133 (135)
T 1vi2_A           82 NGTKVGXKPLENESLVNDI-----SL-LHPGLLVTECVYNPHXTKLLQQAQQAGCKTI  133 (135)
T ss_dssp             ECSSTTSTTSCSCCSCCCG-----GG-SCTTCEEEECCCSSSSCHHHHHHHTTTCEEE
T ss_pred             ECCCCCCCCCCCCCCCCHH-----HC-CCCCCEEEEECCCCCCCHHHHHHHHCCCEEE
T ss_conf             3045664223465556503-----20-4789779981148866799999998859087


No 73 
>>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} (A:1-110)
Probab=49.95  E-value=15  Score=17.04  Aligned_cols=70  Identities=14%  Similarity=0.064  Sum_probs=47.0

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC--CCCCEEEE--------EHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             99997798038999999997899789999548667310--38856787--------389999999999864954067702
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECREL--------PLGDFCVLRSILHQYNIGRIVVAG   73 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~--~~~~~~~~--------~ig~ig~li~~Lk~~~i~~ivmaG   73 (281)
                      ==|||-.|.-...+.+.++..|++.+.+.-....+...  ...+...+        +.-.+.++++.-++++|+-+ ..|
T Consensus         8 rvLIANRGeiA~Riirt~~elgi~tvavys~~D~~~~~v~~ad~~v~~~~~~~~~~sYl~~~~Ii~~A~~~g~dAi-hPG   86 (110)
T 2dzd_A            8 KVLVANRGEIAIRVFRACTELGIRTVAIYSKEDVGSYHRYKADEAYLVGEGKKPIEAYLDIEGIIEIAKAHDVDAI-HPG   86 (110)
T ss_dssp             EEEECSCHHHHHHHHHHHHHHTCEEEEEECGGGTTCTHHHHSSSEEECSTTSCTTGGGTCHHHHHHHHHHTTCCEE-ECC
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECHHHHCCCCHHHCCEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCEE-EEC
T ss_conf             8999898499999999999879969999384773679977898999918988722000599999999999785999-708


Q ss_pred             C
Q ss_conf             4
Q gi|254780768|r   74 A   74 (281)
Q Consensus        74 ~   74 (281)
                      +
T Consensus        87 y   87 (110)
T 2dzd_A           87 Y   87 (110)
T ss_dssp             S
T ss_pred             H
T ss_conf             7


No 74 
>>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} (C:)
Probab=49.00  E-value=18  Score=16.46  Aligned_cols=166  Identities=12%  Similarity=0.021  Sum_probs=82.7

Q ss_pred             CCEEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCCCCCCC--------CCCCEEEE-----EHHHHHHHHHHHHHC--
Q ss_conf             973999977980-38999999997899789999548667310--------38856787-----389999999999864--
Q gi|254780768|r    1 MKRLLIIAGSGM-LPYYVAKAARLKNDEPVIASVLNECSFDW--------QDFECREL-----PLGDFCVLRSILHQY--   64 (281)
Q Consensus         1 M~kigIIAG~G~-LP~~ia~~~~~~g~~~~ii~l~~~~~~~~--------~~~~~~~~-----~ig~ig~li~~Lk~~--   64 (281)
                      |+|.+||.|.+. +=..+|+.+-+.|..++++....+.-...        .......+     +-.++..+++...++  
T Consensus         1 mnk~vlITGas~GIG~a~a~~la~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~g   80 (258)
T 3a28_C            1 MSKVAMVTGGAQGIGRGISEKLAADGFDIAVADLPQQEEQAAETIKLIEAADQKAVFVGLDVTDKANFDSAIDEAAEKLG   80 (258)
T ss_dssp             -CCEEEEETTTSHHHHHHHHHHHHHTCEEEEEECGGGHHHHHHHHHHHHTTTCCEEEEECCTTCHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             99899990788689999999999879989999589887899999999985699489999027999999999999999829


Q ss_pred             CCCEEEE-ECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC-CCEEECHHHCCHHHCCC-CCCC
Q ss_conf             9540677-0242321000111026035789999998751048035899999999976-97482112225242035-4334
Q gi|254780768|r   65 NIGRIVV-AGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY-GVSVVGAHEIVPELLVQ-VGSL  141 (281)
Q Consensus        65 ~i~~ivm-aG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~-G~~vi~~~~~l~~ll~~-~G~l  141 (281)
                      .++-++- +|.....|.+...--+      ..+.+......+--.+-+++...+.+. +=+|+.......-.-.+ ...|
T Consensus        81 ~id~linnag~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~m~~~~~G~Ii~isS~~~~~~~~~~~~Y  154 (258)
T 3a28_C           81 GFDVLVNNAGIAQIKPLLEVTEED------LKQIYSVNVFSVFFGIQAASRKFDELGVKGKIINAASIAAIQGFPILSAY  154 (258)
T ss_dssp             CCCEEEECCCCCCCCCGGGCCHHH------HHHHHHHHTHHHHHHHHHHHHHHHHHTCCCEEEEECCGGGTSCCTTCHHH
T ss_pred             CCCEEEECCCCCCCCCCCCCCHHH------HHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCEEEEEEHHHCCCCCCCHHH
T ss_conf             983999899889998756599999------99999862122311101144344304788740688403224688641588


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEC
Q ss_conf             554653234788998999999733267225999819
Q gi|254780768|r  142 GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG  177 (281)
Q Consensus       142 ~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~  177 (281)
                      +   .+|..  -..+...++.++++..|.=.+|.-+
T Consensus       155 ~---asKaa--l~~l~~~la~el~~~gIrvn~i~PG  185 (258)
T 3a28_C          155 S---TTKFA--VRGLTQAAAQELAPKGHTVNAYAPG  185 (258)
T ss_dssp             H---HHHHH--HHHHHHHHHHHHGGGTCEEEEEEEC
T ss_pred             H---HHHHH--HHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             9---99999--9999999999956218379999639


No 75 
>>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, PSI-2, protein structure initiative; HET: MSE; 2.08A {Ruegeria pomeroyi} (A:1-101)
Probab=48.77  E-value=18  Score=16.43  Aligned_cols=72  Identities=11%  Similarity=0.101  Sum_probs=47.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCC-CCEEEEEECCCCCCCCC--CCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             739999779803899999999789-97899995486673103--885678738999999999986495406770242
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKN-DEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g-~~~~ii~l~~~~~~~~~--~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      ++--+|.|.|..=..+++.+.+.| ++++++.-..+....+.  .......++.....+-+.++.  |+-++.+...
T Consensus         5 ~~~ilI~GaG~iG~~l~~~l~~~g~~~v~~~~r~~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~--~d~Vi~~~~~   79 (101)
T 3ic5_A            5 RWNICVVGAGKIGQXIAALLKTSSNYSVTVADHDLAALAVLNRXGVATKQVDAKDEAGLAKALGG--FDAVISAAPF   79 (101)
T ss_dssp             CEEEEEECCSHHHHHHHHHHHHCSSEEEEEEESCHHHHHHHHTTTCEEEECCTTCHHHHHHHTTT--CSEEEECSCG
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHCCCCCCEEECCCCCHHHHHHHHCC--CCEEEECCCH
T ss_conf             54989986699999999999858998778750668887641022221354033234689999669--9999989773


No 76 
>>3l83_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2, protein structure initiative; 1.50A {Methylobacillus flagellatus} (A:)
Probab=48.63  E-value=18  Score=16.42  Aligned_cols=35  Identities=11%  Similarity=-0.023  Sum_probs=30.6

Q ss_pred             CCEEEEE-ECCCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             9739999-7798038999999997899789999548
Q gi|254780768|r    1 MKRLLII-AGSGMLPYYVAKAARLKNDEPVIASVLN   35 (281)
Q Consensus         1 M~kigII-AG~G~LP~~ia~~~~~~g~~~~ii~l~~   35 (281)
                      |+||+|| .|.+..|..+++.+...|.++.++....
T Consensus         3 ~~~iliid~~~~~~~~~~~~~l~~~g~~~~~~~~~~   38 (250)
T 3l83_A            3 LKPVMIIQFSASEGPGHFGDFLAGEHIPFQVLRMDR   38 (250)
T ss_dssp             --CEEEEECSSSCCCTHHHHHHHHTTCCEEEEEGGG
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHCCCEEEEEECCC
T ss_conf             864999967899980599999984898799997899


No 77 
>>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} (A:)
Probab=48.49  E-value=18  Score=16.41  Aligned_cols=76  Identities=16%  Similarity=0.171  Sum_probs=57.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CCC---CEEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             97399997798038999999997899789999548667310-388---56787389999999999864954067702423
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDF---ECRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-~~~---~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |.|+-|..|+|-+=..+++.+.++|++++++.......... ...   .....++.+...+...++...+..++-+....
T Consensus        21 ~~~ilItGatG~iG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~  100 (333)
T 2q1w_A           21 MKKVFITGICGQIGSHIAELLLERGDKVVGIDNFATGRREHLKDHPNLTFVEGSIADHALVNQLIGDLQPDAVVHTAASY  100 (333)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCSSCCGGGSCCCTTEEEEECCTTCHHHHHHHHHHHCCSEEEECCCCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCCCEEEEEECCCCHHHHHHHHCCCCCEEEEEEECC
T ss_conf             47799927888899999999997829899997998556877603799389980455805535655326531476300001


No 78 
>>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* (A:)
Probab=47.78  E-value=19  Score=16.34  Aligned_cols=170  Identities=11%  Similarity=0.031  Sum_probs=91.2

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC--CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
Q ss_conf             399997798038999999997899789999548667310--388567873899999999998649540677024232100
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPN   80 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~--~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~   80 (281)
                      |+-|..|+|-+=..+++.+.++|++++++.-........  .........+.....+-..+....++.++.+.... .+.
T Consensus         2 kVlVtGatG~iG~~lv~~Ll~~g~~V~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~~~~~~~~~~~d~vi~~a~~~-~~~   80 (311)
T 2p5y_A            2 RVLVTGGAGFIGSHIVEDLLARGLEVAVLDNLATGKRENVPKGVPFFRVDLRDKEGVERAFREFRPTHVSHQAAQA-SVK   80 (311)
T ss_dssp             EEEEETTTSHHHHHHHHHHHTTTCEEEEECCCSSCCGGGSCTTCCEECCCTTCHHHHHHHHHHHCCSEEEECCSCC-CHH
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCCCCCCCCC-CCC
T ss_conf             6999888788999999999978698999978886676451337967997555889999999742334222323356-640


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC---EEECHHHCCHHHCCCCCCC---CCCCCCHHHHHHH
Q ss_conf             011102603578999999875104803589999999997697---4821122252420354334---5546532347889
Q gi|254780768|r   81 VQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV---SVVGAHEIVPELLVQVGSL---GTCVPNRDVKRDI  154 (281)
Q Consensus        81 ~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~---~vi~~~~~l~~ll~~~G~l---~~~~p~~~~~~dI  154 (281)
                      ...-  +       ..........+...+|    +...+.+.   .+++...............   +...|...--..-
T Consensus        81 ~~~~--~-------~~~~~~~n~~~~~~~l----~~~~~~~~~~~~~~ss~~~~~~~~~~~~~~~e~~~~~~~~~Y~~sK  147 (311)
T 2p5y_A           81 VSVE--D-------PVLDFEVNLLGGLNLL----EACRQYGVEKLVFASTGGAIYGEVPEGERAEETWPPRPKSPYAASK  147 (311)
T ss_dssp             HHHH--C-------HHHHHHHHTHHHHHHH----HHHHHTTCSEEEEEEEHHHHHCCCCTTCCBCTTSCCCCCSHHHHHH
T ss_pred             HHHH--C-------HHHHHHHHHHHHHHHH----HHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH
T ss_conf             6665--9-------6988884689889999----9755224330243102222222223566521357899988346779


Q ss_pred             HHHHHHHHHHCCCCCEEEEEEECCEEEEEECC
Q ss_conf             98999999733267225999819748896253
Q gi|254780768|r  155 LAAMKSAEALSELDVGQSAVSIGGRVVALEGI  186 (281)
Q Consensus       155 ~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~  186 (281)
                      ..+..++....+..--+.++++-..|.+...-
T Consensus       148 ~~~E~~~~~~~~~~~~~~~i~R~~~v~G~~~~  179 (311)
T 2p5y_A          148 AAFEHYLSVYGQSYGLKWVSLRYGNVYGPRQD  179 (311)
T ss_dssp             HHHHHHHHHHHHHHCCCEEEEEECEEECTTCC
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCEEEECCCC
T ss_conf             99999999889873998699823558826444


No 79 
>>2qip_A Protein of unknown function VPA0982; APC85975, structural genomics, PSI-2, protein structure initiative; 1.48A {Vibrio parahaemolyticus rimd 2210633} (A:)
Probab=46.57  E-value=19  Score=16.21  Aligned_cols=54  Identities=11%  Similarity=0.058  Sum_probs=27.0

Q ss_pred             HHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
Q ss_conf             9999999997697482112225242035433455465323478899899999973326722599981
Q gi|254780768|r  110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI  176 (281)
Q Consensus       110 L~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~  176 (281)
                      .+.....+++.||++.....           ........+...|+..+..+.....+.|.  .|+|.
T Consensus        63 ~~~~~~~l~~~g~~v~~~~~-----------~~~~~~~~~k~~Dv~laid~~~~~~~~d~--~vlvS  116 (165)
T 2qip_A           63 QRQFHHILRGVGFEVXLKPY-----------IQRRDGSAKGDWDVGITLDAIEIAPDVDR--VILVS  116 (165)
T ss_dssp             HHHHHHHHHHHTCEEEECCC-----------CCCSSCCCSCCCHHHHHHHHHHHGGGCSE--EEEEC
T ss_pred             HCCHHHHHHHCCCEEEEEEE-----------EECCCCCCCCCCHHHHHHHHHHHHHHCCE--EEEEE
T ss_conf             41256898845742566411-----------55167878872379999999976523799--99997


No 80 
>>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} (A:1-104)
Probab=46.41  E-value=19  Score=16.20  Aligned_cols=64  Identities=14%  Similarity=0.024  Sum_probs=44.3

Q ss_pred             EEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CCCEEEE-------EHHHHHHHHHHHHHCCCCEE
Q ss_conf             9977980389999999978997899995486673103--8856787-------38999999999986495406
Q gi|254780768|r    6 IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECREL-------PLGDFCVLRSILHQYNIGRI   69 (281)
Q Consensus         6 IIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--~~~~~~~-------~ig~ig~li~~Lk~~~i~~i   69 (281)
                      |||-.|.-...+.+.++..|++.+.+.-....+...-  ..+...+       +.-.+.++++.-++.+++-+
T Consensus         5 LIANRGeiA~Ri~rt~~elgi~tvav~s~~D~~~~~v~~ade~v~~~~~~~~~sYl~~~~Ii~~A~~~g~~ai   77 (104)
T 2vpq_A            5 LIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGV   77 (104)
T ss_dssp             EECCCHHHHHHHHHHHHHTTCEEEEEEEGGGTTCHHHHHSSEEEEEECSSGGGTTTCHHHHHHHHHHTTCSEE
T ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEECCCHHHCCCCHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCEE
T ss_conf             9989729999999999987994999868167468997788999980898643343689999999999798999


No 81 
>>3eyw_A C-terminal domain of glutathione-regulated potassium-efflux system protein KEFC fused...; KTN, RCK, K+ channel, K+ transport, K+ efflux; HET: FMN NAD; 2.40A {Escherichia coli K12} (A:1-123)
Probab=45.89  E-value=20  Score=16.14  Aligned_cols=73  Identities=10%  Similarity=-0.088  Sum_probs=45.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CCCEEEEEHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             973999977980389999999978997899995486673103--88567873899999999998649540677024
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      |++=-+|.|.|.+=..+++.+.++|++++++....+.-..+.  .......+..+... .....-.+++-++++=.
T Consensus         3 ~~~~v~IiG~G~~G~~ia~~L~~~G~~V~v~d~~~~~~~~~~~~g~~~~~~d~~~~~~-~~~~~~~~ad~vi~~~~   77 (123)
T 3eyw_A            3 HGMRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDL-LESAGAAKAEVLINAID   77 (123)
T ss_dssp             --CCEEEECCSHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHTTCCCEESCTTCHHH-HHHHTTTTCSEEEECCS
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHHH-HHHCCCCCCCEEEEEEC
T ss_conf             8898999898889999999999689988999899999999997699099953899999-98569764899999719


No 82 
>>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} (B:)
Probab=45.35  E-value=20  Score=16.09  Aligned_cols=36  Identities=19%  Similarity=0.189  Sum_probs=32.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |+||+||--...+...+++.++..|.++.++.....
T Consensus         1 M~~i~iid~g~~~~~~~~~~l~~~g~~~~v~~~~~~   36 (195)
T 1qdl_B            1 MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEI   36 (195)
T ss_dssp             CCEEEEEECSCSSHHHHHHHHHHTTCEEEEEETTTS
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             987999978871799999999978993799848989


No 83 
>>3dzb_A Prephenate dehydrogenase; domain SWAP, PSI2, NYSGXRC, tyrosine biosynthesis, EC:1.3.12.-, structural genomics; 2.46A {Streptococcus thermophilus lmg 18311} (A:1-179,A:292-317)
Probab=44.77  E-value=21  Score=16.03  Aligned_cols=36  Identities=19%  Similarity=0.163  Sum_probs=29.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+|+|+ -|.|..=..+|..+..+|+++.++......
T Consensus         5 ~~kIgi-IGaG~mG~~iA~~L~~~G~~V~i~~~~~~~   40 (205)
T 3dzb_A            5 KKTIYI-AGLGLIGGSLALGIKRDHPDYEILGYNRSD   40 (205)
T ss_dssp             -CEEEE-SCCSHHHHHHHHHHHTTCTTSEEEEECSCH
T ss_pred             CCEEEE-EECCHHHHHHHHHHHHCCCCCEEEEEECCH
T ss_conf             987999-910899999999998409998899997999


No 84 
>>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* (A:1-117,A:229-290)
Probab=44.67  E-value=21  Score=16.02  Aligned_cols=70  Identities=14%  Similarity=0.095  Sum_probs=43.2

Q ss_pred             EEEEE-ECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             39999-77980389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    3 RLLII-AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         3 kigII-AG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      .||++ +|-|-|.++  +++++.--..-++.+.+.+...+.+.+..++. .-.-.++.+|.+++|+-+|+|=.=
T Consensus        26 ~IgifDSG~GGLtv~--~~i~~~lP~~~~iy~~D~a~~PYG~ks~~~i~-~~~~~~~~~l~~~~~~~iViACNT   96 (179)
T 2vvt_A           26 AIGLIDSGVGGLTVL--KEALKQLPNERLIYLGDTARCPYGPRPAEQVV-QFTWEMADFLLKKRIKMLVIACNT   96 (179)
T ss_dssp             CEEEEESSSTTHHHH--HHHHHHCTTSCEEEEECTTTCCCTTSCHHHHH-HHHHHHHHHHHTTTCSEEEECCHH
T ss_pred             CEEEEECCCCHHHHH--HHHHHHCCCCCEEEEECCCCCCCCCCCHHHHH-HHHHHHHHHHHHCCCCCEEEECCH
T ss_conf             689997896889999--99999789999899944889998989999999-999999999975388604762336


No 85 
>>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} (A:1-167)
Probab=44.58  E-value=21  Score=16.01  Aligned_cols=157  Identities=17%  Similarity=0.088  Sum_probs=87.1

Q ss_pred             CC-EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEE-EEHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             97-3999977980389999999978997899995486673103885678-738999999999986495406770242321
Q gi|254780768|r    1 MK-RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE-LPLGDFCVLRSILHQYNIGRIVVAGAIDRR   78 (281)
Q Consensus         1 M~-kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~-~~ig~ig~li~~Lk~~~i~~ivmaG~V~kr   78 (281)
                      |. |||+| |.|..=.-+|+.+.++|+++++.......-..+....... -+..+      ..+.  ++-++. --.. .
T Consensus         4 m~~~IgvI-G~G~mG~~lA~~L~~~G~~V~~~dr~~~~~~~l~~~g~~~~~s~~e------~~~~--~d~v~~-~v~~-~   72 (167)
T 1vpd_A            4 MTXKVGFI-GLGIXGKPXSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKA------IAEQ--CDVIIT-XLPN-S   72 (167)
T ss_dssp             --CEEEEE-CCSTTHHHHHHHHHHTTCEEEEECSCHHHHHHHHHTTCEECSSHHH------HHHH--CSEEEE-CCSS-H
T ss_pred             CCCEEEEE-EEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEECCCHHH------HHHC--CCEEEE-ECCC-H
T ss_conf             44518898-1089889999999978996999939999999999869956489999------9848--999999-8798-6


Q ss_pred             CCHHHHCCCHHHHHHH--HHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             0001110260357899--99998751048035899999999976974821122252420354334554653234788998
Q gi|254780768|r   79 PNVQDLCFSIKDSLRI--SKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILA  156 (281)
Q Consensus        79 P~~~~l~~D~~~~~~l--~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~  156 (281)
                      +...............  ...+.-....-+-..-+.+.+.+.+.|+..++..-.-..-.+..|.++-.--  .+....+.
T Consensus        73 ~~~~~v~~~~~~~~~~~~~g~~ii~~st~~~~~~~~~~~~~~~~g~~~v~a~v~g~~~~a~~g~l~~~~g--g~~~~~~~  150 (167)
T 1vpd_A           73 PHVKEVALGENGIIEGAKPGTVLIDXSSIAPLASREISDALKAKGVEXLDAPVSGGEPKAIDGTLSVXVG--GDKAIFDK  150 (167)
T ss_dssp             HHHHHHHHSTTCHHHHCCTTCEEEECSCCCHHHHHHHHHHHHTTTCEEEECCEESHHHHHHHTCEEEEEE--SCHHHHHH
T ss_pred             HHHHHHHHCCHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEE--EHHHHHHH
T ss_conf             8899999383468841899988997878886899999999997699540774336857885498438986--30667788


Q ss_pred             HHHHHHHHCC--CCCE
Q ss_conf             9999997332--6722
Q gi|254780768|r  157 AMKSAEALSE--LDVG  170 (281)
Q Consensus       157 g~~i~~~l~~--~DiG  170 (281)
                      ...++..++.  +++|
T Consensus       151 ~~~~l~~~g~~~~~~G  166 (167)
T 1vpd_A          151 YYDLXKAXAGSVVHTG  166 (167)
T ss_dssp             HHHHHHTTEEEEEEEE
T ss_pred             HHHHHHHHCCCCCCCC
T ss_conf             8888887606745579


No 86 
>>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, structural genomics; 2.00A {Exiguobacterium sibiricum 255-15} (A:1-104)
Probab=44.40  E-value=21  Score=15.99  Aligned_cols=95  Identities=15%  Similarity=0.147  Sum_probs=57.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEE----HHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             399997798038999999997899789999548667310388567873----8999999999986495406770242321
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP----LGDFCVLRSILHQYNIGRIVVAGAIDRR   78 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~----ig~ig~li~~Lk~~~i~~ivmaG~V~kr   78 (281)
                      |+-+++++|.-....+.++...|++++.+.....+.....-..++.++    -..+..++++.++++|+=++ .|. +  
T Consensus         6 kVLv~g~G~~~al~~a~~~~~~~~~vi~~d~~~~~~~~~~~d~~~~iP~~~~~~~~~~l~~i~~~~~iD~vi-p~~-~--   81 (104)
T 2pn1_A            6 HLLITSAGRRAKLVEYFVKEFKTGRVSTADCSPLASALYXADQHYIVPKIDEVEYIDHLLTLCQDEGVTALL-TLI-D--   81 (104)
T ss_dssp             EEEEESCTTCHHHHHHHHHHCCSSEEEEEESCTTCGGGGGSSSEEECCCTTSTTHHHHHHHHHHHHTCCEEE-ESS-H--
T ss_pred             EEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEE-ECC-C--
T ss_conf             899917846999999999769999899986999986788428679768987377999999999985999894-046-4--


Q ss_pred             CCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECH
Q ss_conf             0001110260357899999987510480358999999999769748211
Q gi|254780768|r   79 PNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGA  127 (281)
Q Consensus        79 P~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~  127 (281)
                      |                          +..++....+.||++|+.++++
T Consensus        82 ~--------------------------E~~~~a~~~~~~~~~Gi~v~~S  104 (104)
T 2pn1_A           82 P--------------------------ELGLLAQATERFQAIGVTVIVS  104 (104)
T ss_dssp             H--------------------------HHHHHHHTHHHHHTTTCEECCC
T ss_pred             C--------------------------HHHHHHHHHHHHHHCCCEEECC
T ss_conf             0--------------------------0267999866787659808669


No 87 
>>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, FMN, FAD, iron, 3Fe-4S, 4Fe-4S, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} (G:117-216,G:400-456)
Probab=44.39  E-value=21  Score=15.99  Aligned_cols=65  Identities=14%  Similarity=-0.019  Sum_probs=42.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CCCCEEEEEHHHHHHHHHHHHHCCCC
Q ss_conf             7399997798038999999997899789999548667310-38856787389999999999864954
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-~~~~~~~~~ig~ig~li~~Lk~~~i~   67 (281)
                      +|++|| |+|-==...|..+.++|+++.++--.+..--.+ ..++...++-.-+.+.++.+++.+++
T Consensus         7 kkVaVI-GaGpaGl~~A~~La~~G~~Vti~E~~~~~GG~l~~gip~~~l~~~~~~~~i~~~~~~gv~   72 (157)
T 2vdc_G            7 LSVGVI-GAGPAGLAAAEELRAKGYEVHVYDRYDRMGGLLVYGIPGFKLEKSVVERRVKLLADAGVI   72 (157)
T ss_dssp             CCEEEE-CCSHHHHHHHHHHHHHTCCEEEECSSSSCSTHHHHTSCTTTSCHHHHHHHHHHHHHTTCE
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             669997-776589999999984699789994477567668876788766089999999999961950


No 88 
>>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} (A:1-122)
Probab=44.12  E-value=21  Score=15.97  Aligned_cols=105  Identities=10%  Similarity=0.122  Sum_probs=50.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC-CCCCCCCCEEEE-EHHHHHHHHHHHHHCCCCEEEEECCCCCCCC
Q ss_conf             39999779803899999999789978999954866-731038856787-3899999999998649540677024232100
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECREL-PLGDFCVLRSILHQYNIGRIVVAGAIDRRPN   80 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~-~~~~~~~~~~~~-~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~   80 (281)
                      |+|+|.-+|..-....+.++..+ .+-++++.+.. .....  ...++ ++.+      .+....++=++.+..-.    
T Consensus         9 ri~iiG~gg~~g~~~~~~~~~~~-~~~i~~v~~~~~~~~~~--~~~~~~~~~~------~~~~~~vD~v~i~t~~~----   75 (122)
T 1oi7_A            9 RVLVQGITGREGQFHTKQMLTYG-TKIVAGVTPGKGGMEVL--GVPVYDTVKE------AVAHHEVDASIIFVPAP----   75 (122)
T ss_dssp             EEEEETTTSHHHHHHHHHHHHHT-CEEEEEECTTCTTCEET--TEEEESSHHH------HHHHSCCSEEEECCCHH----
T ss_pred             EEEEECCCCCHHHHHHHHHHHHC-CCEEEEECCCCCCCEEE--CCCCCCCHHH------HHCCCCCCEEEEECCHH----
T ss_conf             49998998858789999999809-95799864898863787--9203474677------43467876799962789----


Q ss_pred             HHHHCCCHHHHHHHHHHHHH----HHC---CCCHHHHHHHHHHHHHCCCEEECHH
Q ss_conf             01110260357899999987----510---4803589999999997697482112
Q gi|254780768|r   81 VQDLCFSIKDSLRISKMIWQ----LVS---GGNAAILKASIDLLESYGVSVVGAH  128 (281)
Q Consensus        81 ~~~l~~D~~~~~~l~k~l~~----~~~---~gDd~iL~~i~~~fe~~G~~vi~~~  128 (281)
                      ..   ++     .....+..    ...   .-+..=+..+.+.-++.|..+++.+
T Consensus        76 ~h---~~-----~~~~~~~~g~~v~~ekP~~~~~~~~~~l~~~a~~~g~~~ig~N  122 (122)
T 1oi7_A           76 AA---AD-----AALEAAHAGIPLIVLITEGIPTLDMVRAVEEIKALGSRLIGGN  122 (122)
T ss_dssp             HH---HH-----HHHHHHHTTCSEEEECCSCCCHHHHHHHHHHHHHHTCEEEESS
T ss_pred             HH---HH-----HHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEECCC
T ss_conf             99---99-----9999986799889996799873356789986515695787688


No 89 
>>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase, ligase; 2.20A {Aquifex aeolicus VF5} (A:1-104)
Probab=43.56  E-value=22  Score=15.91  Aligned_cols=73  Identities=12%  Similarity=0.033  Sum_probs=49.6

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CCCEEEE------EHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             973999977980389999999978997899995486673103--8856787------38999999999986495406770
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECREL------PLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--~~~~~~~------~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      |-+==|||-.|.-...+++.++..|++++.+.-....+...-  ..+...+      +.-.+.++++..++.+|+-+ ..
T Consensus         1 m~~rvLIANRGeiA~Ri~r~~~~lgi~~vavys~~D~~s~~v~~Ad~~~~~~~~~~~sYl~~~~Ii~~A~~~~~dAi-hP   79 (104)
T 1ulz_A            1 MVNKVLVANRGEIAVRIIRACKELGIPTVAIYNEVESTARHVKLADEAYMIGTDPLDTYLNKQRIINLALEVGADAI-HP   79 (104)
T ss_dssp             CCSSEEECCCHHHHHHHHHHHHHHTCCEEEEECGGGTTCHHHHHSSEEEECCSSTTHHHHCHHHHHHHHHHTTCCEE-EC
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCEEEEECCCHHHCCCCHHHCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCEE-EC
T ss_conf             95339999970999999999998599699987856856899878988898798768988828889999998199999-26


Q ss_pred             CC
Q ss_conf             24
Q gi|254780768|r   73 GA   74 (281)
Q Consensus        73 G~   74 (281)
                      |+
T Consensus        80 Gy   81 (104)
T 1ulz_A           80 GY   81 (104)
T ss_dssp             CS
T ss_pred             CH
T ss_conf             88


No 90 
>>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter} (A:1-195)
Probab=43.52  E-value=22  Score=15.91  Aligned_cols=34  Identities=18%  Similarity=0.066  Sum_probs=28.5

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             97399997798038999999997899789999548
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLN   35 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~   35 (281)
                      |.||+|| |.|..=..+|..+..+|+++.++....
T Consensus         4 ~mkI~Ii-GaG~~G~~~A~~La~~G~~V~l~d~~~   37 (195)
T 1bg6_A            4 SKTYAVL-GLGNGGHAFAAYLALKGQSVLAWDIDA   37 (195)
T ss_dssp             CCEEEEE-CCSHHHHHHHHHHHHTTCEEEEECSCH
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCH
T ss_conf             9969998-888999999999997899589998999


No 91 
>>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Ralstonia solanacearum MOLK2} (A:1-198)
Probab=43.43  E-value=22  Score=15.90  Aligned_cols=35  Identities=17%  Similarity=0.299  Sum_probs=29.5

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |.||++| |.|..=..+|..+.++|+++.+......
T Consensus         3 ~mkI~iI-G~G~mG~~iA~~l~~~G~~V~~~~~~~~   37 (198)
T 3ghy_A            3 LTRICIV-GAGAVGGYLGARLALAGEAINVLARGAT   37 (198)
T ss_dssp             CCCEEEE-SCCHHHHHHHHHHHHTTCCEEEECCHHH
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCCEEEEEEHHH
T ss_conf             8889998-8779999999999958991899976899


No 92 
>>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A (A:1-258)
Probab=43.15  E-value=22  Score=15.87  Aligned_cols=36  Identities=22%  Similarity=0.227  Sum_probs=19.4

Q ss_pred             HHHHHCCCEEEEEECCCEEEE-CHHHHHHHHHHCCCE
Q ss_conf             999984990999973977998-589999999987968
Q gi|254780768|r  236 QNVIKAGLAGIALEAGKSLVL-EKELVKKHADEAGIF  271 (281)
Q Consensus       236 ~~~~~ag~~giaiea~~~lil-d~~~~i~~a~~~~i~  271 (281)
                      +...+.+.-.++-|=|....- ..+...+++.+.++.
T Consensus       206 ~~~~~~~~P~~~~E~g~~~~~~~~~~~~~~~~~~~~g  242 (258)
T 2whl_A          206 DRVIDQDLALVIGEFGHRHTDVDEDTILSYSEETGTG  242 (258)
T ss_dssp             HHHHTTTCCEEEEEECCCCCCCCHHHHHHHHHHHTCE
T ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCE
T ss_conf             9998669988998557777897599999999986983


No 93 
>>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} (A:)
Probab=42.84  E-value=22  Score=15.84  Aligned_cols=74  Identities=11%  Similarity=0.015  Sum_probs=52.1

Q ss_pred             CEEEEEECC---CCHHHHHHHHHHHCCCCEEEEEECCCCC--------CCCC------CCCEEEEEHHHHHHHHHHHHHC
Q ss_conf             739999779---8038999999997899789999548667--------3103------8856787389999999999864
Q gi|254780768|r    2 KRLLIIAGS---GMLPYYVAKAARLKNDEPVIASVLNECS--------FDWQ------DFECRELPLGDFCVLRSILHQY   64 (281)
Q Consensus         2 ~kigIIAG~---G~LP~~ia~~~~~~g~~~~ii~l~~~~~--------~~~~------~~~~~~~~ig~ig~li~~Lk~~   64 (281)
                      +++++|..+   |.+-..++++++..|++.+++.......        ..+.      +......+=.....+++.+.+.
T Consensus        14 ~siaViGaS~~~~~~g~~v~~~L~~~g~~~~~~~p~~~~~~i~g~~~~~sl~~~~~~~D~vvi~vp~~~~~~~l~e~~~~   93 (140)
T 1iuk_A           14 KTIAVLGAHKDPSRPAHYVPRYLREQGYRVLPVNPRFQGEELFGEEAVASLLDLKEPVDILDVFRPPSALMDHLPEVLAL   93 (140)
T ss_dssp             CEEEEETCCSSTTSHHHHHHHHHHHTTCEEEEECGGGTTSEETTEECBSSGGGCCSCCSEEEECSCHHHHTTTHHHHHHH
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCEECCEEEECCHHHCCCCCCEEEEEECHHHHHHHHHHHHHC
T ss_conf             95999922699997199999999728983899787676425568275255677589972899980889989999999964


Q ss_pred             CCCEEEEECCC
Q ss_conf             95406770242
Q gi|254780768|r   65 NIGRIVVAGAI   75 (281)
Q Consensus        65 ~i~~ivmaG~V   75 (281)
                      +++.+++.-..
T Consensus        94 g~~~~~~~~g~  104 (140)
T 1iuk_A           94 RPGLVWLQSGI  104 (140)
T ss_dssp             CCSCEEECTTC
T ss_pred             CCCEEEECCCC
T ss_conf             98989989897


No 94 
>>1yco_A Branched-chain phosphotransacylase; structural genomics, protein structure initiative, PSI, PTB, nysgxrc; 2.40A {Enterococcus faecalis V583} (A:1-94,A:247-279)
Probab=42.42  E-value=22  Score=15.79  Aligned_cols=76  Identities=17%  Similarity=0.021  Sum_probs=52.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCC-CCE-EEEEECCCCCCCCCCCCEEEEE-HHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             9739999779803899999999789-978-9999548667310388567873-89999999999864954067702423
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKN-DEP-VIASVLNECSFDWQDFECRELP-LGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g-~~~-~ii~l~~~~~~~~~~~~~~~~~-ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |.|+++.++...-...-+..+...| .+| +.++-.......-+++++...+ -.+-...--.|-+.|=-+++|-|.++
T Consensus         1 ~krvAVa~a~D~~~L~Av~~A~e~gi~~p~iLvGd~~~I~~~a~~~eiI~~~~~~eAA~~AV~lVr~G~Ad~LMKG~i~   79 (127)
T 1yco_A            1 MITVSIAGGSQPEILQLVKKALKEAEQPLQFIVFDTNENLDTENLWKYVHCSDEAAVAQEAVSLVATGQAQILLKGIIQ   79 (127)
T ss_dssp             CEEEEEETCCSHHHHHHHHHHHHHCCSCEEEEEEESSCCCCSSCCSEEEECSSHHHHHHHHHHHHHSTTCSEEEECSSC
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHCCCCCCEEEECCCHHHCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             9699991689989999999999769988779942823306300287798799959999999999977998779758989


No 95 
>>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural genomics, PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} (C:1-117)
Probab=42.35  E-value=22  Score=15.79  Aligned_cols=66  Identities=15%  Similarity=0.063  Sum_probs=39.8

Q ss_pred             EEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC--CCEEEE-EHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             99779803899999999789978999954866731038--856787-38999999999986495406770
Q gi|254780768|r    6 IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECREL-PLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         6 IIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~--~~~~~~-~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      +|.|.|..-..+++.+...|++++++....+.......  .....+ +.... ..+....-.+++-++.+
T Consensus         4 ~IiG~G~iG~~la~~L~~~g~~v~v~~~~~~~~~~~~~~~~~~~~~gd~~~~-~~l~~~~~~~ad~vi~~   72 (117)
T 3l4b_C            4 IIIGGETTAYYLARSMLSRKYGVVIINKDRELCEEFAKKLKATIIHGDGSHK-EILRDAEVSKNDVVVIL   72 (117)
T ss_dssp             EEECCHHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHHSSSEEEESCTTSH-HHHHHHTCCTTCEEEEC
T ss_pred             EEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCCEEEECCCCCH-HHHHHCCCCCCCEEEEE
T ss_conf             9999889999999999968997999989999999998734730999568788-99986395303999994


No 96 
>>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3- epimerase, D-tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima} (A:)
Probab=42.17  E-value=23  Score=15.77  Aligned_cols=35  Identities=6%  Similarity=0.103  Sum_probs=22.2

Q ss_pred             ECCCCCCCEEEECCCCH-HHHHHHHHCCCEE-EEEEC
Q ss_conf             34888753121066279-9999999849909-99973
Q gi|254780768|r  216 MCKSQQDMRADLPSIGA-KTVQNVIKAGLAG-IALEA  250 (281)
Q Consensus       216 ~~K~~QD~r~DlP~IG~-~Ti~~~~~ag~~g-iaiea  250 (281)
                      -.|-.+-....-..+.. +.++.+.+.|++| +.+|.
T Consensus       228 H~kd~~~~~~g~G~id~~~~~~~l~~~gy~g~~~~E~  264 (290)
T 2zvr_A          228 HVADSNRWAPGCGHFDFRSVFNTLKEIGYNRYVSVEC  264 (290)
T ss_dssp             EECCTTSSSTTSSCCCHHHHHHHHHHTTCCSEEEECC
T ss_pred             EECCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEE
T ss_conf             9867899999997609999999999949980799985


No 97 
>>3egq_A TETR family transcriptional regulator; NP_070644.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PE8; 2.55A {Archaeoglobus fulgidus} (A:1-69)
Probab=41.95  E-value=19  Score=16.25  Aligned_cols=53  Identities=15%  Similarity=0.076  Sum_probs=44.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             03589999999997697482112225242035433455465323478899899
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM  158 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~  158 (281)
                      -..|+.+..+.|.++|+.=++..++....=++.|.+...-+++++...-....
T Consensus         6 r~~il~aa~~~~~~~G~~~~t~~~Ia~~~gis~~t~Y~~F~~K~~L~~~~~~~   58 (69)
T 3egq_A            6 SVRIIEAALRLYXKKPPHEVSIEEIAREAKVSKSLIFYHFESKQKLLEEAVXH   58 (69)
T ss_dssp             HHHHHHHHHHHHTTSCGGGCCHHHHHHHHTSCHHHHHHHCSSHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHCCCCHHHHHHHHHHH
T ss_conf             99999999999987292306799999986839420765089999999999999


No 98 
>>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} (A:1-152)
Probab=41.68  E-value=23  Score=15.72  Aligned_cols=38  Identities=24%  Similarity=0.054  Sum_probs=29.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             399997798038999999997899789999548667310
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW   41 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~   41 (281)
                      |||+| |.|+.-..+++.+.++|+++++..-.......+
T Consensus         2 kIgiI-G~G~MG~aia~~L~~~G~~v~~~~r~~~~~~~~   39 (152)
T 1i36_A            2 RVGFI-GFGEVAQTLASRLRSRGVEVVTSLEGRSPSTIE   39 (152)
T ss_dssp             EEEEE-SCSHHHHHHHHHHHHTTCEEEECCTTCCHHHHH
T ss_pred             EEEEE-EHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHH
T ss_conf             79998-468999999999998899689979984153799


No 99 
>>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} (A:)
Probab=40.89  E-value=24  Score=15.64  Aligned_cols=35  Identities=26%  Similarity=0.240  Sum_probs=30.6

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             39999779803899999999789978999954866
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |||+|.+.|..=..+++.+.++|+++++.......
T Consensus         2 kI~iIG~aG~mG~ala~~l~~~G~~V~~~~r~~~~   36 (212)
T 1jay_A            2 RVALLGGTGNLGKGLALRLATLGHEIVVGSRREEK   36 (212)
T ss_dssp             EEEEETTTSHHHHHHHHHHHTTTCEEEEEESSHHH
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEECCCHHH
T ss_conf             89999566799999999999789979998399999


No 100
>>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} (A:1-246)
Probab=40.80  E-value=24  Score=15.63  Aligned_cols=56  Identities=9%  Similarity=-0.021  Sum_probs=46.5

Q ss_pred             CCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCEE---EECHHHHHHHHHHCCCEEEE
Q ss_conf             887531210662799999999849909999739779---98589999999987968999
Q gi|254780768|r  219 SQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSL---VLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       219 ~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~l---ild~~~~i~~a~~~~i~i~g  274 (281)
                      .-.+.-.+..++-++.++..+.-+-+.|.++.-...   +.|-+++.++|+++|+.++-
T Consensus       114 ~~~~~~~~~~~~d~~~i~~~i~~~t~~i~~~~~~~~~g~~~Di~~i~~ia~~~g~~li~  172 (246)
T 1cs1_A          114 RGCYRVLFVDQGDEQALRAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVV  172 (246)
T ss_dssp             TTSCEEEEECTTCHHHHHHHHHTCCSEEEEECSCTTTCCCCCHHHHHHHHHHTTCEEEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEE
T ss_conf             23332224568987888751276662799714565531004579886666524866997


No 101
>>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, structural genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} (A:1-198)
Probab=40.78  E-value=24  Score=15.63  Aligned_cols=39  Identities=18%  Similarity=0.242  Sum_probs=33.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             973999977980389999999978997899995486673
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF   39 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~   39 (281)
                      |+++-|+.|.|-+=..+++.+..+|++++++........
T Consensus        27 ~k~VlVtGgtGfIG~~lv~~L~~~g~~V~~~~~~~~~~~   65 (198)
T 2b69_A           27 RKRILITGGAGFVGSHLTDKLXXDGHEVTVVDNFFTGRK   65 (198)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCSSCCG
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCH
T ss_conf             989999789728999999999978698999968876777


No 102
>>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} (A:)
Probab=40.56  E-value=24  Score=15.61  Aligned_cols=182  Identities=7%  Similarity=0.038  Sum_probs=89.0

Q ss_pred             CCEEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHH--CCCCEEEEECCCCC
Q ss_conf             973999977-980389999999978997899995486673103885678738999999999986--49540677024232
Q gi|254780768|r    1 MKRLLIIAG-SGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ--YNIGRIVVAGAIDR   77 (281)
Q Consensus         1 M~kigIIAG-~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~--~~i~~ivmaG~V~k   77 (281)
                      ++|.+||-| ++.+=..+++++-+.|.+++++....+...+...+.+-.-+-.++..++....+  -.++-+|-.-++.+
T Consensus        14 ~gk~vlVTGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~d~~~~~~i~~~~~~~~~~~g~id~linnAg~~~   93 (247)
T 1uzm_A           14 VSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVEVDVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSA   93 (247)
T ss_dssp             CCCEEEETTTTSHHHHHHHHHHHHTTCEEEEEESSSCCCTTSEEEECCTTCHHHHHHHHHHHHHHHSSCSEEEEECSCCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             99979993888889999999999879989999798221067538996448999999999999985698238987511246


Q ss_pred             CCCHHHHCC---------CHHHHHHHHHHHHHH-H----------------------------CCCCHHHHHHHHHHHHH
Q ss_conf             100011102---------603578999999875-1----------------------------04803589999999997
Q gi|254780768|r   78 RPNVQDLCF---------SIKDSLRISKMIWQL-V----------------------------SGGNAAILKASIDLLES  119 (281)
Q Consensus        78 rP~~~~l~~---------D~~~~~~l~k~l~~~-~----------------------------~~gDd~iL~~i~~~fe~  119 (281)
                      .-.+.++-.         .+++.+.+.+.+... .                            +-+=..+.+.+..++..
T Consensus        94 ~~~~~~~~~~~~~~~~~vn~~~~~~~~~~~~p~m~~~~~G~Ii~isS~~~~~~~~~~~~Y~asKaal~~l~~~la~E~~~  173 (247)
T 1uzm_A           94 DAFLMRMTEEKFEKVINANLTGAFRVAQRASRSMQRNKFGRMIFIGSVSGLWGIGNQANYAASKAGVIGMARSIARELSK  173 (247)
T ss_dssp             -----CCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHTTCEEEEEECCCCC-----CCHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred             CCCHHHCCHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCEEEEECHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             52266599999999998543331234443133312357886489812777467754176899999999999987765314


Q ss_pred             CCCEEECHHHCCH--HHCC---CC--CCCCCCCCCHH--HHHHHHHHHHHH-HHHCCCCCEEEEEEECCEEEE
Q ss_conf             6974821122252--4203---54--33455465323--478899899999-973326722599981974889
Q gi|254780768|r  120 YGVSVVGAHEIVP--ELLV---QV--GSLGTCVPNRD--VKRDILAAMKSA-EALSELDVGQSAVSIGGRVVA  182 (281)
Q Consensus       120 ~G~~vi~~~~~l~--~ll~---~~--G~l~~~~p~~~--~~~dI~~g~~i~-~~l~~~DiGQsvVv~~g~Via  182 (281)
                      .|+++.....-.-  +...   ++  ..+....|...  .-.|+....-.+ ..-+.+=.||.++|.+|..++
T Consensus       174 ~gI~vn~i~pg~~~t~~~~~~~~~~~~~~~~~~p~~r~~~p~eva~~v~fL~s~~~~~itG~~i~vDGG~~lg  246 (247)
T 1uzm_A          174 ANVTANVVAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVDGGMGMG  246 (247)
T ss_dssp             GTEEEEEEEECSBCCHHHHHSCHHHHHHHGGGCTTCSCBCHHHHHHHHHHHHSGGGTTCCSCEEEESTTTTC-
T ss_pred             CCCCEEEECCCCCCCHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCCEEEECCCCCCC
T ss_conf             7834545444767780012059999999985599889859999999999995822259768658969581158


No 103
>>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} (A:)
Probab=40.21  E-value=24  Score=15.57  Aligned_cols=202  Identities=12%  Similarity=0.073  Sum_probs=98.0

Q ss_pred             EEEEEEC--CCCHHH-HHHHHHHHCCCCEEEEEECCCC-----CCC-------CCCC--CEEE----------------E
Q ss_conf             3999977--980389-9999999789978999954866-----731-------0388--5678----------------7
Q gi|254780768|r    3 RLLIIAG--SGMLPY-YVAKAARLKNDEPVIASVLNEC-----SFD-------WQDF--ECRE----------------L   49 (281)
Q Consensus         3 kigIIAG--~G~LP~-~ia~~~~~~g~~~~ii~l~~~~-----~~~-------~~~~--~~~~----------------~   49 (281)
                      |||+-.-  .+++|. ...+.+.+.|++.+=+...+.-     +..       +..+  ....                .
T Consensus         2 kig~~~~~~~~~~~l~~~~~~~~~~G~~~iEl~~~~~~~~~~~~~~~~~~~~~~~~~gl~i~~~~~~~~~~~~~~~~~~~   81 (278)
T 1i60_A            2 KLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTXDKLPEYLKDHSLDDLAEYFQTHHIKPLALNALVFFNNRDEKGHNE   81 (278)
T ss_dssp             EEEEEGGGGTTTCCHHHHHHHHHHTTCSEEEEETTTHHHHHTTSSCHHHHHHHHHTSSCEEEEEEEEECCSSCCHHHHHH
T ss_pred             EEEEEHHHCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHH
T ss_conf             76850865758999999999999829898984667787011483069999999998199389996777778999899999


Q ss_pred             EHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHH
Q ss_conf             38999999999986495406770242321000111026035789999998751048035899999999976974821122
Q gi|254780768|r   50 PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHE  129 (281)
Q Consensus        50 ~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~  129 (281)
                      .+.++.+.+...+.-+++.+++.+... ++...       ... ..+.+.        .-++.+..+.++.|+++.=-+.
T Consensus        82 ~~~~~~~~i~~a~~lg~~~i~~~~~~~-~~~~~-------~~~-~~~~~~--------~~l~~~~~~a~~~Gv~l~~E~~  144 (278)
T 1i60_A           82 IITEFKGXXETCKTLGVKYVVAVPLVT-EQKIV-------KEE-IKKSSV--------DVLTELSDIAEPYGVKIALEFV  144 (278)
T ss_dssp             HHHHHHHHHHHHHHHTCCEEEEECCBC-SSCCC-------HHH-HHHHHH--------HHHHHHHHHHGGGTCEEEEECC
T ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCC-CCCCC-------HHH-HHHHHH--------HHHHHHHHHHHHCCCEEEEEEC
T ss_conf             999999999999982939899926988-77778-------799-999999--------9999999999974998999835


Q ss_pred             CCHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             25242035433455465323478899899999973326722599981974889625342179999999754312345667
Q gi|254780768|r  130 IVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGK  209 (281)
Q Consensus       130 ~l~~ll~~~G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~~~~~~~~~~~  209 (281)
                               +.      ......+......+++.++.-.+|=..=+.+-..    .-+...+++++.++...        
T Consensus       145 ---------~~------~~~~~~~~~~~~~li~~~~~~~~g~~~D~~h~~~----~g~~~~~~~~~~~~~i~--------  197 (278)
T 1i60_A          145 ---------GH------PQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHA----XGSNIESLKQADGKKIF--------  197 (278)
T ss_dssp             ---------CC------TTBSSCSHHHHHHHHHHHCCTTEEEEEEHHHHHH----TTCCHHHHHTSCGGGEE--------
T ss_pred             ---------CC------CCCCCCCHHHHHHHHHHCCCCCEEEEECHHHHHH----CCCCHHHHHHHHCCCEE--------
T ss_conf             ---------77------7555689999999998511663789854178886----49999999986045167--------


Q ss_pred             CEEEEEECCCC---CCCEEE--ECCCC----HHHHHHHHHCCCEEEE-EE
Q ss_conf             71899934888---753121--06627----9999999984990999-97
Q gi|254780768|r  210 SGVLVKMCKSQ---QDMRAD--LPSIG----AKTVQNVIKAGLAGIA-LE  249 (281)
Q Consensus       210 ~~ilvK~~K~~---QD~r~D--lP~IG----~~Ti~~~~~ag~~gia-ie  249 (281)
                       -+=+|-.+..   ...+.+  .|-=|    .+.++.+.+.|+.|.. +|
T Consensus       198 -~~H~~D~~~~~~~~~~~~~~~~~G~G~id~~~i~~~L~~~g~~g~i~~E  246 (278)
T 1i60_A          198 -IYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFSDVVSVE  246 (278)
T ss_dssp             -EEEECEECCCCTTTCCGGGEESTTSSSSCHHHHHHHHHHTTCCSEEEEC
T ss_pred             -EEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEE
T ss_conf             -9999336777644345657759978224899999999984997179996


No 104
>>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} (A:1-189)
Probab=40.02  E-value=24  Score=15.55  Aligned_cols=75  Identities=15%  Similarity=0.136  Sum_probs=54.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC--------CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             97399997798038999999997899789999548667310--------3885678738999999999986495406770
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--------QDFECRELPLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~--------~~~~~~~~~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      |+++-+..|.|-+=..+++++...|++++++..........        .+.......+.+.......+...+...++..
T Consensus        14 ~~~ilVTGgtGfiG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~   93 (189)
T 1rpn_A           14 TRSALVTGITGQDGAYLAKLLLEKGYRVHGLVARRSSDTRWRLRELGIEGDIQYEDGDMADACSVQRAVIKAQPQEVYNL   93 (189)
T ss_dssp             -CEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCCSSCCCHHHHHTTCGGGEEEEECCTTCHHHHHHHHHHHCCSEEEEC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHCCCCCCEEEEEECCCCHHHHHCCCCCCCCCCCCC
T ss_conf             75499975887899999999997849899998999765177798733368948998215672321000223332222222


Q ss_pred             CCC
Q ss_conf             242
Q gi|254780768|r   73 GAI   75 (281)
Q Consensus        73 G~V   75 (281)
                      -..
T Consensus        94 a~~   96 (189)
T 1rpn_A           94 AAQ   96 (189)
T ss_dssp             CSC
T ss_pred             CCC
T ss_conf             222


No 105
>>3hno_A Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_A (A:1-148,A:302-364)
Probab=39.88  E-value=24  Score=15.54  Aligned_cols=107  Identities=21%  Similarity=0.218  Sum_probs=60.4

Q ss_pred             CCEEEEEECCCCHHH------HHHHHHHHCCCCE-EEEEECCCC----CCC---CC-----------C-----C-CEE--
Q ss_conf             973999977980389------9999999789978-999954866----731---03-----------8-----8-567--
Q gi|254780768|r    1 MKRLLIIAGSGMLPY------YVAKAARLKNDEP-VIASVLNEC----SFD---WQ-----------D-----F-ECR--   47 (281)
Q Consensus         1 M~kigIIAG~G~LP~------~ia~~~~~~g~~~-~ii~l~~~~----~~~---~~-----------~-----~-~~~--   47 (281)
                      |+|++|+-+.|.=|.      -+.+.+...+.++ -++++.+.-    +.+   +.           .     + .+.  
T Consensus         3 ~kni~I~~sGG~tpgiNasi~gvv~~a~~~~~~v~~iyG~~~G~~GLl~~~~~dl~~~~~~~~~~l~~tpGs~LGS~R~k   82 (211)
T 3hno_A            3 AKNAFYAQSGGVTAVINASAAGVIEAARKQSGKIGRIYAGRNGIIGALTEDLIDTGQESDAAISALRYTPSGAFGSCRYK   82 (211)
T ss_dssp             CCEEEEEECSSCCSSHHHHHHHHHHHHHHHCSSCCCEEEETTTHHHHHTTCEEEGGGSCHHHHHHGGGCCSCTTCCCCCC
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHHHHCCCCEECCCCCHHHHHHHCCCCCCCCCCCCCC
T ss_conf             76489988888258897999999999998399487997673582235548837786024777877525797645777888


Q ss_pred             ----EEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC--
Q ss_conf             ----87389999999999864954067702423210001110260357899999987510480358999999999769--
Q gi|254780768|r   48 ----ELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG--  121 (281)
Q Consensus        48 ----~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G--  121 (281)
                          +..-.+..++++.|++++|+.++++|+=.   ++       .+    .               ..+.+++++.|  
T Consensus        83 l~~~~~~~~~~~~i~~~l~k~~I~~li~IGGnd---Sm-------~t----a---------------~kLse~~~~~~~~  133 (211)
T 3hno_A           83 LKSLEQNRREYERLIEVFKAHDIGYFFYNGGGD---SA-------DT----C---------------LKVSQLSGTLGYP  133 (211)
T ss_dssp             ------CHHHHHHHHHHHHHTTEEEEEEEESHH---HH-------HH----H---------------HHHHHHHHHTTCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCH---HH-------HH----H---------------HHHHHHHHHHCCC
T ss_conf             776532357999999999982998799972727---89-------99----9---------------9999998971899


Q ss_pred             CEEECHHHCCHHHCC
Q ss_conf             748211222524203
Q gi|254780768|r  122 VSVVGAHEIVPELLV  136 (281)
Q Consensus       122 ~~vi~~~~~l~~ll~  136 (281)
                      +++++.-.=..+-++
T Consensus       134 i~vIGIPKTIDNDl~  148 (211)
T 3hno_A          134 IQAIHVPKTVDNDLP  148 (211)
T ss_dssp             CEEEEEECCTTCCCS
T ss_pred             CEEEEECCCCCCCCC
T ss_conf             429961133368977


No 106
>>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, cytoplasm, oxidoreductase, phospholipid biosynthesis, structural genomics; HET: EPE; 2.10A {Coxiella burnetii rsa 493} (A:1-204)
Probab=39.70  E-value=25  Score=15.52  Aligned_cols=33  Identities=18%  Similarity=0.111  Sum_probs=28.3

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9739999779803899999999789978999954
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVL   34 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~   34 (281)
                      |.|||+| |.|..=..+|..+..+|+++.++...
T Consensus        29 ~~kI~iI-GaG~mG~~iA~~L~~~G~~V~~~~r~   61 (204)
T 3k96_A           29 KHPIAIL-GAGSWGTALALVLARKGQKVRLWSYE   61 (204)
T ss_dssp             CSCEEEE-CCSHHHHHHHHHHHTTTCCEEEECSC
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             9889998-95999999999999789978999828


No 107
>>3bqs_A Uncharacterized protein; 10114F, NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.42A {Listeria monocytogenes str} PDB: 3bqt_A (A:)
Probab=39.16  E-value=20  Score=16.19  Aligned_cols=19  Identities=47%  Similarity=0.803  Sum_probs=9.2

Q ss_pred             EECCCCHHHHHHHHHCCCE
Q ss_conf             1066279999999984990
Q gi|254780768|r  226 DLPSIGAKTVQNVIKAGLA  244 (281)
Q Consensus       226 DlP~IG~~Ti~~~~~ag~~  244 (281)
                      |+|-|||.|-+.+.+.|+.
T Consensus         8 ~LPNiG~~~e~~L~~iGI~   26 (93)
T 3bqs_A            8 ELPNIGKVLEQDLIKAGIK   26 (93)
T ss_dssp             GSTTCCHHHHHHHHHTTCC
T ss_pred             HCCCCCHHHHHHHHHCCCC
T ss_conf             6899999999999983999


No 108
>>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} (A:1-86,A:293-306)
Probab=38.85  E-value=25  Score=15.43  Aligned_cols=68  Identities=10%  Similarity=0.046  Sum_probs=41.9

Q ss_pred             CC-EEEEEECCCCHHHH--------HHHHHHHCCCCEEEEEECCCCCCCCCCCC-EEEEE-----HHHHHHHHHHHHHCC
Q ss_conf             97-39999779803899--------99999978997899995486673103885-67873-----899999999998649
Q gi|254780768|r    1 MK-RLLIIAGSGMLPYY--------VAKAARLKNDEPVIASVLNECSFDWQDFE-CRELP-----LGDFCVLRSILHQYN   65 (281)
Q Consensus         1 M~-kigIIAG~G~LP~~--------ia~~~~~~g~~~~ii~l~~~~~~~~~~~~-~~~~~-----ig~ig~li~~Lk~~~   65 (281)
                      |+ |||+++|..+==..        +++++.+.|++++.+.....-....+... ...++     .|+=|.+-..|...+
T Consensus         1 MkmkI~il~GG~SsE~evSl~Sa~~i~~aL~~~g~~v~~i~~~~~~~~~~~~~~~D~vf~~lHG~~GEDG~IQglLE~lg   80 (100)
T 1iow_A            1 MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMG   80 (100)
T ss_dssp             CCCEEEEECCCSSTTHHHHHHHHHHHHHHHHHTTCEEEEECTTTSCGGGTTTTTEEEEEECCCSTTTSSSHHHHHHHHHT
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHCC
T ss_conf             98509999386874228499999999999988699799988984118887545987999916788543779999999849


Q ss_pred             CCE
Q ss_conf             540
Q gi|254780768|r   66 IGR   68 (281)
Q Consensus        66 i~~   68 (281)
                      |-+
T Consensus        81 IPY   83 (100)
T 1iow_A           81 LPY   83 (100)
T ss_dssp             CCB
T ss_pred             CEE
T ss_conf             845


No 109
>>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} (A:1-128,A:208-274)
Probab=38.72  E-value=25  Score=15.42  Aligned_cols=63  Identities=8%  Similarity=-0.166  Sum_probs=36.3

Q ss_pred             CCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHH-HHHHHHHHHHHCCCCEEEEECC
Q ss_conf             79803899999999789978999954866731038856787389-9999999998649540677024
Q gi|254780768|r    9 GSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG-DFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         9 G~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig-~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      |++..-..+++.+..+|+.++.+.+++.-........   .++. ...-+..+++..++++++++|.
T Consensus        30 ~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~---~~~~~~~~~i~~~l~~l~~~~~~lvG~   93 (195)
T 1a8q_A           30 LNGDAWQDQLKAVVDAGYRGIAHDRRGHGHSTPVWDG---YDFDTFADDLNDLLTDLDLRDVTLVAH   93 (195)
T ss_dssp             CCGGGGHHHHHHHHHTTCEEEEECCTTSTTSCCCSSC---CSHHHHHHHHHHHHHHTTCCSEEEEEE
T ss_pred             CCHHHHHHHHHHHHHCCCEEEEEECCHHHCCCCCCCC---CCHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             8878999999999978998999835000014443322---211466777777887654322011343


No 110
>>2qtq_A Transcriptional regulator, TETR family; YP_496351.1, predicted DNA-binding transcriptional regulator; HET: MSE; 1.85A {Novosphingobium aromaticivorans DSM12444} PDB: 2rha_A* (A:1-81)
Probab=38.60  E-value=17  Score=16.60  Aligned_cols=54  Identities=9%  Similarity=0.025  Sum_probs=45.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788998999
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMK  159 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~~  159 (281)
                      -..|+.+....|.++||+=++..++....=++.|.+...-+++++.-.-....-
T Consensus        18 r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~~iY~~F~sk~~L~~~~~~~~   71 (81)
T 2qtq_A           18 RDLLLQTASNIXREGDVVDISLSELSLRSGLNSALVKYYFGNKAGLLKALLDRD   71 (81)
T ss_dssp             HHHHHHHHHHHHHHHTSSCCCHHHHHHHHCCCHHHHHHHHSSHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             999999999999971966378999999979098899777565999999999999


No 111
>>2fd5_A Transcriptional regulator; DNA-binding protein, structural genomics, PSI, protein structure initiative; 1.70A {Pseudomonas aeruginosa PAO1} (A:1-75)
Probab=38.12  E-value=26  Score=15.36  Aligned_cols=50  Identities=20%  Similarity=0.132  Sum_probs=44.4

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             03589999999997697482112225242035433455465323478899
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDIL  155 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~  155 (281)
                      -..|+.+....|+++|+.=++..+++.+.=+++|.+...-+++.+...-.
T Consensus         9 r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~~~y~~F~~K~~l~~~~   58 (75)
T 2fd5_A            9 RARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEA   58 (75)
T ss_dssp             HHHHHHHHHHHHHHHTTTSCCHHHHHHHTTCCGGGGGGTCSCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHCCCHHHHHHHH
T ss_conf             99999999999997194516899999873899426979819899999999


No 112
>>1xhc_A NADH oxidase /nitrite reductase; southeast collaboratory for structural genomics, secsg, hyperthermophIle; HET: FAD; 2.35A {Pyrococcus furiosus dsm 3638} (A:144-230)
Probab=38.00  E-value=26  Score=15.35  Aligned_cols=56  Identities=11%  Similarity=0.077  Sum_probs=39.6

Q ss_pred             EEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99779803899999999789978999954866731038856787389999999999864954067
Q gi|254780768|r    6 IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIV   70 (281)
Q Consensus         6 IIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~iv   70 (281)
                      +|-|+|..-.++|..+...|.++.++.-.+.-   .. ++     -.--..+.+.|++++|+-..
T Consensus         4 ~VvGgG~~G~E~A~~l~~~g~~Vtii~~~~~~---~~-~~-----~~~~~~~~~~l~~~gI~~~~   59 (87)
T 1xhc_A            4 IIIGGGFIGLELAGNLAEAGYHVKLIHRGAMF---LG-LD-----EELSNMIKDMLEETGVKFFL   59 (87)
T ss_dssp             EEEECSHHHHHHHHHHHHTTCEEEEECSSSCC---TT-CC-----HHHHHHHHHHHHHTTEEEEC
T ss_pred             CCCCCCCCCCHHHHHHHHCCCCEEEEEEECCC---CC-CC-----HHHHHHHHHHHHHCCCEEEE
T ss_conf             13467654311266686558721564310244---35-76-----48999999999865971543


No 113
>>3c85_A Putative glutathione-regulated potassium-efflux system protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} (A:)
Probab=37.76  E-value=18  Score=16.36  Aligned_cols=119  Identities=10%  Similarity=-0.010  Sum_probs=64.4

Q ss_pred             EEEEEECCCCHHHHHHHHHHH-CCCCEEEEEECCCCCCCC--CCCCEEEEEHHHHHHHHHHHHHCCC-C--EEEEECCCC
Q ss_conf             399997798038999999997-899789999548667310--3885678738999999999986495-4--067702423
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARL-KNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQYNI-G--RIVVAGAID   76 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~-~g~~~~ii~l~~~~~~~~--~~~~~~~~~ig~ig~li~~Lk~~~i-~--~ivmaG~V~   76 (281)
                      +=-||+|.|.+-..+++.+++ .|.+++++....+.....  .++....-+..+..    .|++.++ .  +.+++..=+
T Consensus        40 ~hviI~G~g~~g~~i~~~L~~~~~~~vviid~d~~~~~~~~~~g~~~i~GD~~~~~----~L~~a~~~~~a~~ii~~~~~  115 (183)
T 3c85_A           40 AQVLILGXGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDPD----FWERILDTGHVKLVLLAXPH  115 (183)
T ss_dssp             CSEEEECCSHHHHHHHHHHHHHHCSCEEEEESCHHHHHHHHHTTCCEEECCTTCHH----HHHTBCSCCCCCEEEECCSS
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHCCCCCHH----HHHHHHCCCCCEEEEECCCC
T ss_conf             80899898429999999999977996699838668888876311133321579999----99974464777099983680


Q ss_pred             CCCCHHHHCCCHHHHHHHHHHHHHH----HCCCCHHHHHHHHHHHHHCCC-EEECHHHCCHHHCCC
Q ss_conf             2100011102603578999999875----104803589999999997697-482112225242035
Q gi|254780768|r   77 RRPNVQDLCFSIKDSLRISKMIWQL----VSGGNAAILKASIDLLESYGV-SVVGAHEIVPELLVQ  137 (281)
Q Consensus        77 krP~~~~l~~D~~~~~~l~k~l~~~----~~~gDd~iL~~i~~~fe~~G~-~vi~~~~~l~~ll~~  137 (281)
                      -.-++       ... ...+-+...    ..-.|+    .-...|+..|. .++.+.+...+.+..
T Consensus       116 d~~n~-------~~~-~~~~~l~~~~~iia~~~~~----~~~~~l~~~gad~vi~p~~~~a~~l~~  169 (183)
T 3c85_A          116 HQGNQ-------TAL-EQLQRRNYKGQIAAIAEYP----DQLEGLLESGVDAAFNIYSEAGSGFAR  169 (183)
T ss_dssp             HHHHH-------HHH-HHHHHTTCCSEEEEEESSH----HHHHHHHHHTCSEEEEHHHHHHHHHHH
T ss_pred             HHHHH-------HHH-HHHHHHCCCCEEEEEECCH----HHHHHHHHCCCCEEECHHHHHHHHHHH
T ss_conf             88899-------999-9999859874068884698----999999987999999819999999999


No 114
>>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* (A:1-107)
Probab=37.68  E-value=26  Score=15.31  Aligned_cols=66  Identities=15%  Similarity=0.051  Sum_probs=45.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEE----------EHHHHHHHHHHHHHCCCCEE
Q ss_conf             9999779803899999999789978999954866731038856787----------38999999999986495406
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL----------PLGDFCVLRSILHQYNIGRI   69 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~----------~ig~ig~li~~Lk~~~i~~i   69 (281)
                      ==|||-.|.-...+.+.++..|.+++.+.-...............+          +.-.+.++++.-++++|+-+
T Consensus         6 riLIANRGeiA~Ri~rt~~elgi~~v~vys~~D~~~~h~~~ade~v~i~~~~~~~~sYl~~~~Ii~~A~~~g~dAi   81 (107)
T 3hbl_A            6 KLLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAI   81 (107)
T ss_dssp             EEEECCCHHHHHHHHHHHHHTTCEEEEEECGGGTTCGGGGTSSEEEECCTTSCTTGGGTCHHHHHHHHHHTTCSEE
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEECCHHHHCCCCHHHCCEEEECCCCCCHHHCCCCHHHHHHHHHHHCCCEE
T ss_conf             8999897199999999999869939998184784688978878889828988633211599999999999792999


No 115
>>3dew_A Transcriptional regulator, TETR family; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.75A {Geobacter sulfurreducens} (A:1-72)
Probab=37.57  E-value=14  Score=17.25  Aligned_cols=53  Identities=8%  Similarity=0.104  Sum_probs=45.4

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             03589999999997697482112225242035433455465323478899899
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM  158 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~  158 (281)
                      -..|+.+....|.++||.=++..++....=++.|.+...-|++++........
T Consensus        10 r~~Il~aa~~~~~~~G~~~~t~~~ia~~~gvs~~~~Y~~F~~K~~l~~~~~~~   62 (72)
T 3dew_A           10 RSRLXEVATELFAQKGFYGVSIRELAQAAGASISXISYHFGGKEGLYAAVLQE   62 (72)
T ss_dssp             HHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHSCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHHHH
T ss_conf             99999999999998592417799999996939999966658999999888899


No 116
>>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthesis, methyltransferase, transferase; 2.3A {Escherichia coli} (A:)
Probab=37.42  E-value=27  Score=15.29  Aligned_cols=74  Identities=11%  Similarity=-0.038  Sum_probs=51.5

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             399997798038999999997899789999548667310---38856787389999999999864954067702423
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      |+-|..|.|-+=..+++.+.++|++++++..........   .........+.........+...+++.|+-++...
T Consensus         2 kVLVtGatGfiG~~lv~~Ll~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~Vih~Aa~~   78 (345)
T 2bll_A            2 RVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIA   78 (345)
T ss_dssp             EEEEETCSSHHHHHHHHHHHHSTTCEEEEEESCCGGGGGGTTCTTEEEEECCTTTCSHHHHHHHHHCSEEEECBCCC
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             79998988689999999999779988999968972447653689808997805785999999985898211433332


No 117
>>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} (A:1-96,A:209-272)
Probab=37.40  E-value=27  Score=15.28  Aligned_cols=70  Identities=19%  Similarity=0.080  Sum_probs=40.4

Q ss_pred             EEEEE-ECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHH-HHCCCCEEEEECCC
Q ss_conf             39999-779803899999999789978999954866731038856787389999999999-86495406770242
Q gi|254780768|r    3 RLLII-AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL-HQYNIGRIVVAGAI   75 (281)
Q Consensus         3 kigII-AG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~L-k~~~i~~ivmaG~V   75 (281)
                      .||++ +|-|-|...  +++++.=-.--++.+.+.+...+.+.+..++. ...-.+..+| .+.+++-+|+|=.-
T Consensus         5 ~IgifDSGiGGLtv~--~~i~~~lP~e~~iy~~D~~~~PYG~ks~~~i~-~~~~~~~~~l~~~~~~~~iViACNT   76 (160)
T 1zuw_A            5 PIGVIDSGVGGLTVA--KEIMRQLPKENIIYVGDTKRCPYGPRPEEEVL-QYTWELTNYLLENHHIKMLVIACNT   76 (160)
T ss_dssp             CEEEEESSSTTHHHH--HHHHHHSTTCCEEEEECGGGCCCSSSCHHHHH-HHHHHHHHHHHHHSCCSEEEECCHH
T ss_pred             CEEEEECCCCHHHHH--HHHHHHCCCCCEEEEECCCCCCCCCCCHHHHH-HHHHHHHHHHHHCCCCCEEEECCCH
T ss_conf             889998897689999--99999789998899956889998989999999-9999999998633698299982747


No 118
>>3bqz_B HTH-type transcriptional regulator QACR; multidrug resistance, TETR, malachite green, DNA- binding, plasmid, repressor; HET: MGR; 2.17A {Staphylococcus aureus} PDB: 3br1_B* 3br3_B* 1rkw_B* 1jt0_A* 1jty_B* 1jum_B* 1jup_B* 1jtx_B* 1jus_B* 2dtz_B 2gby_B* 2hq5_B 3br2_B* 3br5_B* 1qvt_B* 1qvu_B* 3br0_B* 3br6_B* 1jt6_B* 1rpw_A* ... (B:1-71)
Probab=37.39  E-value=18  Score=16.49  Aligned_cols=49  Identities=18%  Similarity=0.078  Sum_probs=43.0

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHH
Q ss_conf             0358999999999769748211222524203543345546532347889
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDI  154 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI  154 (281)
                      -+.|+.+..+.|.++|++=++..+++...=++.|.+...-|++++.-.-
T Consensus         4 r~~il~aa~~l~~~~G~~~~t~~~Ia~~agis~~t~y~~F~~Ke~L~~~   52 (71)
T 3bqz_B            4 KDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLE   52 (71)
T ss_dssp             CHHHHHHHHHHHHHHTTTTCCHHHHHHHTTCCHHHHHHHTSSHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHH
T ss_conf             9999999999999759151779999998790988881438899999999


No 119
>>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} (A:1-199)
Probab=37.30  E-value=21  Score=15.98  Aligned_cols=152  Identities=11%  Similarity=-0.076  Sum_probs=71.3

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---------------CCCCEEEEEHHHHHHHHHHHHHCC
Q ss_conf             97399997798038999999997899789999548667310---------------388567873899999999998649
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---------------QDFECRELPLGDFCVLRSILHQYN   65 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---------------~~~~~~~~~ig~ig~li~~Lk~~~   65 (281)
                      |.|+|+| |.|..=..+|..+..+|+++.++..........               ..........      ...+.   
T Consensus        15 ~~~I~VI-GaG~~G~~lA~~La~~G~~V~~~dr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~---   84 (199)
T 1evy_A           15 LNKAVVF-GSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDV------EKAYN---   84 (199)
T ss_dssp             EEEEEEE-CCSHHHHHHHHHHTTTEEEEEEECSCHHHHHHHHHHTBCTTTSTTCBCCTTEEEESCH------HHHHT---
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCEEEECCH------HHHHH---
T ss_conf             5779998-8889999999999978996999989999999999479997668997067876998899------99970---


Q ss_pred             CCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHC---------CCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCC
Q ss_conf             54067702423210001110260357899999987510---------480358999999999769748211222524203
Q gi|254780768|r   66 IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVS---------GGNAAILKASIDLLESYGVSVVGAHEIVPELLV  136 (281)
Q Consensus        66 i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~---------~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~  136 (281)
                      ...+++.---  .+.......+..+.............         .........+.+++.++++.++....+..+...
T Consensus        85 ~~d~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (199)
T 1evy_A           85 GAEIILFVIP--TQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVAT  162 (199)
T ss_dssp             TCSSEEECCC--HHHHHHHHHHHCHHHHHHHHHHTCCEEECCCSCCTTTCCCHHHHHTTTSCGGGEEEEESSCCHHHHHT
T ss_pred             CCCEEEEECC--CCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHCCCCCEEECCCCCCCCHHHH
T ss_conf             7989999637--40006677777888888764126753333789977963018899998748773520247655625652


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             543345546532347889989999997332
Q gi|254780768|r  137 QVGSLGTCVPNRDVKRDILAAMKSAEALSE  166 (281)
Q Consensus       137 ~~G~l~~~~p~~~~~~dI~~g~~i~~~l~~  166 (281)
                      ..+.....  ...+.+..+...++++.+++
T Consensus       163 ~~~~~~~~--~~~~~~~~~~~~~l~~~~g~  190 (199)
T 1evy_A          163 GVFTCVSI--ASADINVARRLQRIMSTGDR  190 (199)
T ss_dssp             TCCEEEEE--ECSSHHHHHHHHHHHSCTTS
T ss_pred             CCCCEEEE--CCCCHHHHHHHHHHHCCCCC
T ss_conf             48856763--68998999999999565664


No 120
>>2of7_A Putative TETR-family transcriptional regulator; APC7240, streptomyces coelicolor A3, structural genomics, PSI-2; 2.30A {Streptomyces coelicolor} (A:1-95)
Probab=36.74  E-value=11  Score=17.74  Aligned_cols=46  Identities=20%  Similarity=0.234  Sum_probs=40.5

Q ss_pred             CCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHH
Q ss_conf             8035899999999976974821122252420354334554653234
Q gi|254780768|r  105 GNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDV  150 (281)
Q Consensus       105 gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~  150 (281)
                      --+.||.+..+.|.++||.=++..++....=+..+-+...-+++++
T Consensus        49 ~r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~slY~~F~sK~~   94 (95)
T 2of7_A           49 TREAIRAATYGLIRQQGYEATTVEQIAERAEVSPSTVLRYFPTRED   94 (95)
T ss_dssp             HHHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHHHCSSHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHH
T ss_conf             9999999999999980955278999999979399899998698899


No 121
>>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, GALE, NAD, SYK, UDP, N- acetylglucosamine, N-acetylgalactosamine, UDP-GLC; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} (A:)
Probab=36.72  E-value=27  Score=15.21  Aligned_cols=37  Identities=14%  Similarity=0.028  Sum_probs=32.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+|+-|..|.|-+=..+++.+..+|++++++......
T Consensus        27 ~~~VlVTGatGfiG~~lv~~Ll~~g~~v~~~~~~~~~   63 (352)
T 1sb8_A           27 PKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATG   63 (352)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCSSC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             9989996687889999999999784989999788876


No 122
>>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} (A:184-247)
Probab=36.09  E-value=28  Score=15.15  Aligned_cols=56  Identities=11%  Similarity=0.070  Sum_probs=39.6

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             9997798038999999997899789999548667310388567873899999999998649540
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      .+|-|+|-.-.++|..+...|.++.++...+..   ++.++.     .--..+.+.|++++++-
T Consensus         5 v~ViG~G~iGlE~A~~l~~~g~~Vtiie~~~~i---l~~~d~-----~~~~~~~~~l~~~gv~~   60 (64)
T 2hqm_A            5 VVVVGAGYIGIELAGVFHGLGSETHLVIRGETV---LRKFDE-----CIQNTITDHYVKEGINV   60 (64)
T ss_dssp             EEEECSSHHHHHHHHHHHHTTCEEEEECSSSSS---CTTSCH-----HHHHHHHHHHHHHTCEE
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEHHCCC---CCCCCH-----HHHHHHHHHHHHHCCCC
T ss_conf             999898878999999999649842553001244---433303-----44334555444201001


No 123
>>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} (A:)
Probab=35.98  E-value=28  Score=15.14  Aligned_cols=74  Identities=7%  Similarity=-0.089  Sum_probs=51.0

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC-CCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             739999779803899999999789978999954866731-03885678738999999999986495406770242
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~-~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      .|+-|..|.|-+=..+++.+.++|++++++......... ..........+.........+....+..++.....
T Consensus        30 ~~ILItGatGfiG~~lv~~L~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~v~~~~a~  104 (379)
T 2c5a_A           30 LKISITGAGGFIASHIARRLKHEGHYVIASDWKKNEHMTEDMFCDEFHLVDLRVMENCLKVTEGVDHVFNLAADM  104 (379)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSCCSSSCGGGTCSEEEECCTTSHHHHHHHHTTCSEEEECCCCC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCCEEEEECHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             979997888889999999999782989999689852113423667379924252899999873898885314442


No 124
>>3gaa_A Uncharacterized protein TA1441; the protein with unknown function from thermoplasma acidophilum, structural genomics,PSI, MCSG; 2.70A {Thermoplasma acidophilum} (A:)
Probab=35.98  E-value=28  Score=15.14  Aligned_cols=77  Identities=9%  Similarity=-0.066  Sum_probs=47.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCC--CCCCHHHHCCCHHHHHHHHHHHHHH-----HCCCCHHHHHHHHHHHHHCCCEEEC
Q ss_conf             99999999864954067702423--2100011102603578999999875-----1048035899999999976974821
Q gi|254780768|r   54 FCVLRSILHQYNIGRIVVAGAID--RRPNVQDLCFSIKDSLRISKMIWQL-----VSGGNAAILKASIDLLESYGVSVVG  126 (281)
Q Consensus        54 ig~li~~Lk~~~i~~ivmaG~V~--krP~~~~l~~D~~~~~~l~k~l~~~-----~~~gDd~iL~~i~~~fe~~G~~vi~  126 (281)
                      ...+++++++.+++++++.|.+.  .+|.-..+..-. + ....+.+..+     ....-..+...+..+..++|+..+.
T Consensus       107 ~~~i~~~~~~~gv~~vi~l~g~~~~~~~~~~~~~~~~-s-~~~~~~l~~~~~~~~~~~~~~G~~~~L~~~~~~~gi~~~~  184 (252)
T 3gaa_A          107 SNTLMNWIDQVGASEIVIMEGSPANGIPEERPVFAVA-E-KPKLDKFKKAGIQPADSAIIAGMGGGILNECLVRKITGLS  184 (252)
T ss_dssp             HHHHHHHHHHHTCSEEEEEEEEEESCCCSSCCCEEEC-C-HHHHHHHHHTTCEECCCSEECHHHHHHHHHHHHHTCEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEE-C-CCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             9999999997499769997032278999876269996-7-6117788745887456776656999999999986997699


Q ss_pred             HHHCCH
Q ss_conf             122252
Q gi|254780768|r  127 AHEIVP  132 (281)
Q Consensus       127 ~~~~l~  132 (281)
                      .--+.+
T Consensus       185 l~~~~~  190 (252)
T 3gaa_A          185 FITPTS  190 (252)
T ss_dssp             EEEEEE
T ss_pred             EEEECC
T ss_conf             998568


No 125
>>2d1p_B TUSC, hypothetical UPF0116 protein YHEM; tRNA modification, sulfur transfer, structural genomics, translation; 2.15A {Escherichia coli} (B:)
Probab=35.77  E-value=28  Score=15.12  Aligned_cols=39  Identities=13%  Similarity=0.062  Sum_probs=29.8

Q ss_pred             CCEEEEEECCC-------CHHHHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             97399997798-------0389999999978997899995486673
Q gi|254780768|r    1 MKRLLIIAGSG-------MLPYYVAKAARLKNDEPVIASVLNECSF   39 (281)
Q Consensus         1 M~kigIIAG~G-------~LP~~ia~~~~~~g~~~~ii~l~~~~~~   39 (281)
                      |+|+.||.=.|       ..+..+|..+...|+++.++...+....
T Consensus         1 M~kv~ii~t~~p~~~~~~~~al~~A~~~~~~g~eV~vf~~~~gV~~   46 (119)
T 2d1p_B            1 MKRIAFVFSTAPHGTAAGREGLDALLATSALTDDLAVFFIADGVFQ   46 (119)
T ss_dssp             CCCEEEEECSCTTTSTHHHHHHHHHHHHHTTCSCEEEEECGGGGGG
T ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHHHH
T ss_conf             9779999668998867899999999999847997799993458998


No 126
>>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} (A:)
Probab=35.73  E-value=28  Score=15.11  Aligned_cols=72  Identities=17%  Similarity=0.201  Sum_probs=48.2

Q ss_pred             CCEEEEEECC-CCHHHHHHHHHHHCCCCEEEEEECCCCCCC-----CCCC--CEEEE-----EHHHHHHHHHHHHHCC--
Q ss_conf             9739999779-803899999999789978999954866731-----0388--56787-----3899999999998649--
Q gi|254780768|r    1 MKRLLIIAGS-GMLPYYVAKAARLKNDEPVIASVLNECSFD-----WQDF--ECREL-----PLGDFCVLRSILHQYN--   65 (281)
Q Consensus         1 M~kigIIAG~-G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~-----~~~~--~~~~~-----~ig~ig~li~~Lk~~~--   65 (281)
                      |+|.++|.|. +-+=..+|+++-+.|.+++++....+....     .+.+  .+..+     +-.++..+++...++.  
T Consensus         1 MnK~vlITGas~GIG~aiA~~la~~G~~Vvi~~r~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~   80 (250)
T 2cfc_A            1 MSRVAIVTGASSGNGLAIATRFLARGDRVAALDLSAETLEETARTHWHAYADKVLRVRADVADEGDVNAAIAATMEQFGA   80 (250)
T ss_dssp             CCCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHSTTTGGGEEEEECCTTCHHHHHHHHHHHHHHHSC
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             99899992889789999999999879989999898899999999999864994899981279999999999999998099


Q ss_pred             CCEEEEE
Q ss_conf             5406770
Q gi|254780768|r   66 IGRIVVA   72 (281)
Q Consensus        66 i~~ivma   72 (281)
                      ++-+|..
T Consensus        81 id~lv~~   87 (250)
T 2cfc_A           81 IDVLVNN   87 (250)
T ss_dssp             CCEEEEC
T ss_pred             CCEEEEC
T ss_conf             8799975


No 127
>>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; NP_601885.1; HET: MSE; 2.07A {Corynebacterium glutamicum} (A:1-132)
Probab=35.44  E-value=22  Score=15.80  Aligned_cols=116  Identities=14%  Similarity=-0.001  Sum_probs=62.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHC-CCCEEEEE-CCCCCC
Q ss_conf             9739999779803899999999789978999954866731038856787389999999999864-95406770-242321
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQY-NIGRIVVA-GAIDRR   78 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~-~i~~ivma-G~V~kr   78 (281)
                      |-|||+| |.|..=..+++++.++|++++.+.-...    .+.-+...+.+-.-....+.+... .-.++++- ..+..+
T Consensus         6 ~m~IgiI-G~G~mG~~la~~L~~~G~~V~~~~~~~~----~~~aD~vil~vpd~~~v~~~l~~~~~~g~~iid~st~~~~   80 (132)
T 3dfu_A            6 RLRVGIF-DDGSSTVNXAEKLDSVGHYVTVLHAPED----IRDFELVVIDAHGVEGYVEKLSAFARRGQXFLHTSLTHGI   80 (132)
T ss_dssp             CCEEEEE-CCSCCCSCHHHHHHHTTCEEEECSSGGG----GGGCSEEEECSSCHHHHHHHHHTTCCTTCEEEECCSSCCG
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCEEEEECCHHH----HCCCCEEEECCCCHHHHHHHHHHCCCCCCEEEECCCCCCH
T ss_conf             7679998-9877999999999988993887548656----2248889966876899999985018999789971564658


Q ss_pred             CCHHHHCC------CHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             00011102------603578999999875104803589999999997697482
Q gi|254780768|r   79 PNVQDLCF------SIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV  125 (281)
Q Consensus        79 P~~~~l~~------D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi  125 (281)
                      ..+..+.-      +..|..   - -.-..-.||+..+..+-..|+.-|-++.
T Consensus        81 ~~~~~~~~~~~~~~~~~Pv~---g-~~~~~~gg~~~~~~~~~~l~~~~g~~v~  129 (132)
T 3dfu_A           81 TVXDPLETSGGIVXSAHPIG---Q-DRWVASALDELGETIVGLLVGELGGSIV  129 (132)
T ss_dssp             GGGHHHHHTTCEEEEEEEEE---T-TEEEEEESSHHHHHHHHHHHHHTTCEEC
T ss_pred             HHHHHHHHCCCCEEEECCCC---C-CCCCCCCCCHHHHHHHHHHHHHHCCCEE
T ss_conf             99868885899479966777---7-7652003888899999999999489779


No 128
>>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus VF5} (A:1-172)
Probab=35.06  E-value=29  Score=15.04  Aligned_cols=34  Identities=24%  Similarity=0.180  Sum_probs=29.1

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             73999977980389999999978997899995486
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      +|+||| |.|..=..+|..++..|+++.+....-.
T Consensus         2 ~~I~iI-G~G~mG~~iA~~l~~~G~~v~v~~~~~~   35 (172)
T 2g5c_A            2 QNVLIV-GVGFXGGSFAKSLRRSGFKGKIYGYDIN   35 (172)
T ss_dssp             CEEEEE-SCSHHHHHHHHHHHHTTCCSEEEEECSC
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             779999-2388999999999805998389999799


No 129
>>2hy5_B Intracellular sulfur oxidation protein DSRF; DSRE, DSRF, sulfur, structural genomics, PSI, protein structure initiative, berkeley structural genomics center, BSGC, transferase; 1.72A {Allochromatium vinosum} (B:)
Probab=34.57  E-value=16  Score=16.73  Aligned_cols=37  Identities=5%  Similarity=0.067  Sum_probs=29.0

Q ss_pred             CCEEEEEECCCCH-------HHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803-------899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGML-------PYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~L-------P~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      |+|+.|+.=+|..       +..+|..+...|+++.++...+..
T Consensus         5 m~k~~ii~~~~p~~~~~~~~al~~A~~a~~~g~~V~ifl~~dgV   48 (136)
T 2hy5_B            5 VKKFMYLNRKAPYGTIYAWEALEVVLIGAAFDQDVCVLFLDDGV   48 (136)
T ss_dssp             CCEEEEEECSCTTTSSHHHHHHHHHHHHGGGCCEEEEEECGGGG
T ss_pred             HCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECHHH
T ss_conf             12668896689987579999999999997279976999965188


No 130
>>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics, protein structure initiative; 2.75A {Pyrococcus horikoshii} (A:121-240)
Probab=34.36  E-value=30  Score=14.97  Aligned_cols=56  Identities=9%  Similarity=0.026  Sum_probs=34.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCC
Q ss_conf             9999779803899999999789978999954866731038856787389999999999864954
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~   67 (281)
                      =..|.|+|..-..+|..+...|.++.++.-.+.-   ++.+..     .....+++.+++++|+
T Consensus        30 ~v~ViGgG~~g~E~A~~l~~~g~~Vtlv~~~~~~---l~~~~~-----~~~~~~~~~l~~~gv~   85 (120)
T 3kd9_A           30 NVVIIGGGYIGIEMAEAFAAQGKNVTMIVRGERV---LRRSFD-----KEVTDILEEKLKKHVN   85 (120)
T ss_dssp             EEEEECCSHHHHHHHHHHHHTTCEEEEEESSSST---TTTTSC-----HHHHHHHHHHHTTTSE
T ss_pred             EEECCCCCCHHHHHHHHHHHCCCCCEEEEECCCC---CCCCCC-----CCHHHHHHHHCCEEEE
T ss_conf             0431678852777889987528743168632334---555332-----2102222210220245


No 131
>>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} (A:)
Probab=34.26  E-value=30  Score=14.96  Aligned_cols=165  Identities=12%  Similarity=0.117  Sum_probs=89.3

Q ss_pred             CCEEEEEECCC-CHHHHHHHHHHHCCCCEEEEEECCCCCCCC----C----CCCEEEE---EHHHHHHHHHHHHHC--CC
Q ss_conf             97399997798-038999999997899789999548667310----3----8856787---389999999999864--95
Q gi|254780768|r    1 MKRLLIIAGSG-MLPYYVAKAARLKNDEPVIASVLNECSFDW----Q----DFECREL---PLGDFCVLRSILHQY--NI   66 (281)
Q Consensus         1 M~kigIIAG~G-~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----~----~~~~~~~---~ig~ig~li~~Lk~~--~i   66 (281)
                      |+|.++|.|.+ -+=..+++.+-++|.++++++...+.....    .    +......   +..++.++++...++  .+
T Consensus         1 m~K~vlITGas~GIG~aia~~la~~G~~V~l~~r~~~~l~~~~~~~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~g~i   80 (256)
T 1geg_A            1 MKKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGF   80 (256)
T ss_dssp             -CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTTCCEEEEECCTTSHHHHHHHHHHHHHHTTCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99899994785099999999999879989999898999999999998528971378512100057789999999963997


Q ss_pred             CEEEEE-CCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC--CCEEECHHHCCHHHCCC-CCCCC
Q ss_conf             406770-242321000111026035789999998751048035899999999976--97482112225242035-43345
Q gi|254780768|r   67 GRIVVA-GAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY--GVSVVGAHEIVPELLVQ-VGSLG  142 (281)
Q Consensus        67 ~~ivma-G~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~--G~~vi~~~~~l~~ll~~-~G~l~  142 (281)
                      +-+|=- |.....| +.+.-.+     ...+ .+...-.+--.+.++....+.++  |-.++......-..-.+ ...|+
T Consensus        81 DilvnnAg~~~~~~-~~~~~~~-----~~~~-~~~vN~~~~~~~~~~~lp~m~~~~~~g~Iv~isS~~~~~~~~~~~~Y~  153 (256)
T 1geg_A           81 DVIVNNAGVAPSTP-IESITPE-----IVDK-VYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYS  153 (256)
T ss_dssp             CEEEECCCCCCCBC-GGGCCHH-----HHHH-HHHHHTHHHHHHHHHHHHHHHHHTSCEEEEEECCGGGTSCCTTBHHHH
T ss_pred             EEEEECCCCCCCCC-CCCCCHH-----HHHH-HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEHHHCCCCCCCHHHH
T ss_conf             09998987666887-6779999-----9999-999983999999999988888608875102252046536887508899


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEC
Q ss_conf             54653234788998999999733267225999819
Q gi|254780768|r  143 TCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG  177 (281)
Q Consensus       143 ~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~  177 (281)
                         .+|.  .-..+...++.++++..|-=.+|.-+
T Consensus       154 ---asKa--al~~l~~~la~E~~~~gIrVn~I~PG  183 (256)
T 1geg_A          154 ---SSKF--AVRGLTQTAARDLAPLGITVNGYCPG  183 (256)
T ss_dssp             ---HHHH--HHHHHHHHHHHHHGGGTEEEEEEEEC
T ss_pred             ---HHHH--HHHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             ---9999--99999999999856038479998636


No 132
>>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; 15025322, structural genomics, JCSG, protein structure initiative, PSI; HET: NAI UNL; 2.05A {Clostridium acetobutylicum atcc 824} (A:)
Probab=34.21  E-value=30  Score=14.95  Aligned_cols=37  Identities=24%  Similarity=0.231  Sum_probs=31.5

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             9739999779803899999999789978999954866
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      ++||-|+.|+|-+=..+++.+.++|++++.+......
T Consensus        12 ~~kILVtGatGfIG~~lv~~L~~~g~~V~~~~r~~~~   48 (292)
T 1vl0_A           12 HXKILITGANGQLGREIQKQLKGKNVEVIPTDVQDLD   48 (292)
T ss_dssp             CEEEEEESTTSHHHHHHHHHHTTSSEEEEEECTTTCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECHHCC
T ss_conf             8779998999889999999998687989992032357


No 133
>>3fiw_A Putative TETR-family transcriptional regulator; TETR-family transcriptional regulator streptomyces, structural genomics, PSI-2; 2.20A {Streptomyces coelicolor} (A:1-88)
Probab=34.02  E-value=23  Score=15.72  Aligned_cols=52  Identities=17%  Similarity=0.216  Sum_probs=45.7

Q ss_pred             CCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHH
Q ss_conf             0480358999999999769748211222524203543345546532347889
Q gi|254780768|r  103 SGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDI  154 (281)
Q Consensus       103 ~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI  154 (281)
                      ..--+.||.+....|.++||.=+...++....=++.+-+...-|+++++-..
T Consensus        24 ~~~r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~~iY~~F~~K~~L~~a   75 (88)
T 3fiw_A           24 KXNRETVITEALDLLDEVGLDGVSTRRLAKRLGVEQPSLYWYFRTKRDLLTA   75 (88)
T ss_dssp             CCCHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCTHHHHTTCSSHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHH
T ss_conf             8799999999999999859353659999999893886999988999999999


No 134
>>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, antibiotic biosynthesis, NADPH; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* (A:)
Probab=34.01  E-value=30  Score=14.93  Aligned_cols=176  Identities=15%  Similarity=0.027  Sum_probs=91.1

Q ss_pred             CEEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC----C--CCCEEEE-----EHHHHHHHHHHHHHC--CCC
Q ss_conf             73999977-98038999999997899789999548667310----3--8856787-----389999999999864--954
Q gi|254780768|r    2 KRLLIIAG-SGMLPYYVAKAARLKNDEPVIASVLNECSFDW----Q--DFECREL-----PLGDFCVLRSILHQY--NIG   67 (281)
Q Consensus         2 ~kigIIAG-~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----~--~~~~~~~-----~ig~ig~li~~Lk~~--~i~   67 (281)
                      +|.++|.| ++.+=..+|+.+-+.|.+++++....+.....    .  .-.+..+     +..++..+++...++  .++
T Consensus         7 gk~vlITGas~GIG~aiA~~la~~G~~vvi~~r~~~~~~~~~~~~~~~g~~~~~~~~D~~~~~~~~~~~~~~~~~~g~id   86 (247)
T 2jah_A            7 GKVALITGASSGIGEATARALAAEGAAVAIAARRVEKLRALGDELTAAGAKVHVLELDVADRQGVDAAVASTVEALGGLD   86 (247)
T ss_dssp             TCEEEEESCSSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHHHTTCCEEEEECCTTCHHHHHHHHHHHHHHHSCCS
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             79899938788899999999998899899998989999999999996499489998338999999999999999849973


Q ss_pred             EEEEECCCCCCCCHHHHCCC---------HHHHHHHHHHHHHHHCC----------------------------CCHHHH
Q ss_conf             06770242321000111026---------03578999999875104----------------------------803589
Q gi|254780768|r   68 RIVVAGAIDRRPNVQDLCFS---------IKDSLRISKMIWQLVSG----------------------------GNAAIL  110 (281)
Q Consensus        68 ~ivmaG~V~krP~~~~l~~D---------~~~~~~l~k~l~~~~~~----------------------------gDd~iL  110 (281)
                      -+|-..++.....+.+.-.+         +.+.+.+.+.+.....+                            +=..+.
T Consensus        87 vlvnnAg~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~G~Iv~isS~~~~~~~~~~~~Y~~sKaai~~lt  166 (247)
T 2jah_A           87 ILVNNAGIXLLGPVEDADTTDWTRXIDTNLLGLXYXTRAALPHLLRSKGTVVQXSSIAGRVNVRNAAVYQATKFGVNAFS  166 (247)
T ss_dssp             EEEECCCCCCCCCSTTCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEECCGGGTCCCTTCHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             89964776677764569999999999998599999999999999986997245404432469999768999999999999


Q ss_pred             HHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCC-----------CCH--HHHHHHHHHHHH-HHHHCCCCCEEEEEEE
Q ss_conf             99999999769748211222524203543345546-----------532--347889989999-9973326722599981
Q gi|254780768|r  111 KASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCV-----------PNR--DVKRDILAAMKS-AEALSELDVGQSAVSI  176 (281)
Q Consensus       111 ~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~-----------p~~--~~~~dI~~g~~i-~~~l~~~DiGQsvVv~  176 (281)
                      +.++.++...|+++-.   +.|.....+..-....           |..  -.-+|+....-. +..-+.+=.||.++|.
T Consensus       167 ~~lA~e~~~~gIrvn~---i~PG~i~T~~~~~~~~~~~~~~~~~~~p~~r~~~peevA~~~~~L~s~~s~~itG~~i~vd  243 (247)
T 2jah_A          167 ETLRQEVTERGVRVVV---IEPGTTDTELRGHITHTATKEXYEQRISQIRKLQAQDIAEAVRYAVTAPHHATVHEIFIRP  243 (247)
T ss_dssp             HHHHHHHGGGTCEEEE---EEECSBSSSGGGGCCCHHHHHHHHHHTTTSCCBCHHHHHHHHHHHHHSCTTEEEEEEEEEE
T ss_pred             HHHHHHHCCCCEEEEE---EEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCEECEEEEEE
T ss_conf             9999984611949999---9719896744212586478999982389889789999999999998499997643199996


Q ss_pred             CCEE
Q ss_conf             9748
Q gi|254780768|r  177 GGRV  180 (281)
Q Consensus       177 ~g~V  180 (281)
                      +|.+
T Consensus       244 GG~~  247 (247)
T 2jah_A          244 TDQV  247 (247)
T ss_dssp             TTCC
T ss_pred             CCCC
T ss_conf             8879


No 135
>>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} (A:1-329)
Probab=33.90  E-value=30  Score=14.92  Aligned_cols=74  Identities=11%  Similarity=0.073  Sum_probs=51.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---------CCCCEEEEEHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             97399997798038999999997899789999548667310---------388567873899999999998649540677
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---------QDFECRELPLGDFCVLRSILHQYNIGRIVV   71 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---------~~~~~~~~~ig~ig~li~~Lk~~~i~~ivm   71 (281)
                      |+|+-|..|.|-+=..+++.+.++|++++++..........         ..+.....++.+.......  ..+++.++.
T Consensus         4 ~~~VlVTGatGfiG~~lv~~Ll~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~~~~~--~~~~~~vih   81 (329)
T 1oc2_A            4 FKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKL--AAKADAIVH   81 (329)
T ss_dssp             CSEEEEETTTSHHHHHHHHHHHHHCTTCEEEEEECCCTTCCGGGTGGGCSSSEEEEECCTTCHHHHHHH--HTTCSEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHH--HHCCCCHHH
T ss_conf             988989688858999999999977997399998488743447788886158828997747899999999--714760345


Q ss_pred             ECCCC
Q ss_conf             02423
Q gi|254780768|r   72 AGAID   76 (281)
Q Consensus        72 aG~V~   76 (281)
                      +....
T Consensus        82 ~aa~~   86 (329)
T 1oc2_A           82 YAAES   86 (329)
T ss_dssp             CCSCC
T ss_pred             HHHHC
T ss_conf             45422


No 136
>>2qs7_A Uncharacterized protein; NP_342590.1, protein of unknown function, structural genomics, joint center for structural genomics, JCSG; HET: MSE EPE; 2.09A {Sulfolobus solfataricus P2} (A:)
Probab=33.33  E-value=31  Score=14.86  Aligned_cols=33  Identities=24%  Similarity=0.127  Sum_probs=29.0

Q ss_pred             CCEEEEEECCCCH-----HHHHHHHHHHCCCCEEEEEE
Q ss_conf             9739999779803-----89999999978997899995
Q gi|254780768|r    1 MKRLLIIAGSGML-----PYYVAKAARLKNDEPVIASV   33 (281)
Q Consensus         1 M~kigIIAG~G~L-----P~~ia~~~~~~g~~~~ii~l   33 (281)
                      |+|+.||..+|++     |..+|..+...|+++.++..
T Consensus         7 ~~kl~Ii~~sg~~~r~~~a~~~A~~Aaa~G~eV~iF~t   44 (144)
T 2qs7_A            7 KKKLSIIVFSGTIDKLXPVGILTSGAAASGYEVNLFFT   44 (144)
T ss_dssp             CCEEEEEECCCSHHHHHHHHHHHHHHHHTTCEEEEEEC
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             67789999679889999999999999986995799984


No 137
>>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} (A:312-610)
Probab=33.13  E-value=31  Score=14.84  Aligned_cols=81  Identities=10%  Similarity=0.049  Sum_probs=36.7

Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCH
Q ss_conf             99999999986495406770242321000111026035789999998751048035899999999976974821122252
Q gi|254780768|r   53 DFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVP  132 (281)
Q Consensus        53 ~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~  132 (281)
                      +..+-++.+|+.|+.-|=+.+... .                                ..+.+.-.+.|+.|+..-....
T Consensus        39 ~~~~d~~~~k~~G~N~iR~~~~~~-~--------------------------------~~~~~~ad~~Gi~V~~~~~~~~   85 (299)
T 1yq2_A           39 GAREDLALMKRFNVNAIRTSHYPP-H--------------------------------PRLLDLADEMGFWVILECDLET   85 (299)
T ss_dssp             HHHHHHHHHHHTTCCEEEETTSCC-C--------------------------------HHHHHHHHHHTCEEEEECSCBC
T ss_pred             HHHHHHHHHHHHHCCEEEECCCCC-C--------------------------------HHHHHHHHHCCCEEEEEEECCC
T ss_conf             999999999860107398358999-9--------------------------------9999866217827999730043


Q ss_pred             HHCCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHCC
Q ss_conf             420354334554653234788-9989999997332
Q gi|254780768|r  133 ELLVQVGSLGTCVPNRDVKRD-ILAAMKSAEALSE  166 (281)
Q Consensus       133 ~ll~~~G~l~~~~p~~~~~~d-I~~g~~i~~~l~~  166 (281)
                      ......+.......+...... .+...++++....
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~r~rn  120 (299)
T 1yq2_A           86 HGFEAGGWVENPSDVPAWRDALVDRMERTVERDKN  120 (299)
T ss_dssp             GGGTTTTTTTCGGGCGGGHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             45556665578676789999999999999986069


No 138
>>1rkt_A Protein YFIR; transcription regulator, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.95A {Bacillus subtilis} (A:1-82)
Probab=33.10  E-value=31  Score=14.87  Aligned_cols=48  Identities=17%  Similarity=0.211  Sum_probs=42.9

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      -+.|+.+....|.++|+.=++..+++...=+++|.+...-|++++.-.
T Consensus        14 r~~il~aa~~l~~~~G~~~~ti~~ia~~agvs~~t~Y~~F~~k~~Ll~   61 (82)
T 1rkt_A           14 QAEILEAAKTVFKRKGFELTTXKDVVEESGFSRGGVYLYFSSTEEXFR   61 (82)
T ss_dssp             HHHHHHHHHHHHHHHCSTTCCHHHHHHHHTSCHHHHHTTCSCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHCCCCCHHHHHH
T ss_conf             999999999999981924088999999858996521016899999999


No 139
>>1u1j_A 5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase; methionine, synthase, methyltetrahydrofolate; HET: C2F; 2.40A {Arabidopsis thaliana} (A:430-487,A:682-765)
Probab=32.83  E-value=31  Score=14.81  Aligned_cols=89  Identities=13%  Similarity=0.098  Sum_probs=54.2

Q ss_pred             EEECCCCCCCC-HHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEC--HHHCCHHHCCCCCCCCCCCC
Q ss_conf             77024232100-0111026035789999998751048035899999999976974821--12225242035433455465
Q gi|254780768|r   70 VVAGAIDRRPN-VQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVG--AHEIVPELLVQVGSLGTCVP  146 (281)
Q Consensus        70 vmaG~V~krP~-~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~--~~~~l~~ll~~~G~l~~~~p  146 (281)
                      -.+|.+. ||. +...+-++..    -++-..-+..--+.-.+.++...|+.|+.++.  -..+-.+--.-.|+++.+.|
T Consensus         6 t~vGS~p-rp~~L~~ar~~~~~----g~i~~e~l~~~~~~ai~~~V~~Qe~~Gldvit~e~~~~~~~k~i~~Gvid~~~~   80 (142)
T 1u1j_A            6 TTIGSFP-QTVELRRVRREYKA----KKVSEEDYVKAIKEEIKKVVDLQEELDIDVLVVFREGVKYGAGIGPGVYDIHSP   80 (142)
T ss_dssp             BCCSBCC-CCSCCC-----------------CCHHHHHHHHHHHHHHHHHSSCCSBBCGGTTTTCCCSEECCBSSCTTSS
T ss_pred             CCCCCCC-CCHHHHHHHHHHHC----CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHCCCCCEEEEEEEECCCC
T ss_conf             7525898-98899999999765----999999999999999999999999847998848887578999899988858999


Q ss_pred             CHHHHHHHHHHHHHHHH
Q ss_conf             32347889989999997
Q gi|254780768|r  147 NRDVKRDILAAMKSAEA  163 (281)
Q Consensus       147 ~~~~~~dI~~g~~i~~~  163 (281)
                      .-....+|..-+.-+-+
T Consensus        81 ~vE~~eei~~ri~~a~~   97 (142)
T 1u1j_A           81 RIPSSEEIADRVNKXLA   97 (142)
T ss_dssp             SCCTHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHH
T ss_conf             99999999999999997


No 140
>>2pw9_A Putative formate dehydrogenase accessory protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Desulfotalea psychrophila LSV54} (A:32-268)
Probab=32.83  E-value=31  Score=14.80  Aligned_cols=107  Identities=16%  Similarity=0.120  Sum_probs=74.1

Q ss_pred             HHHHHHHHHHHCCC-----CCEEEEEEECCEEEEE-ECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCEEEE
Q ss_conf             99899999973326-----7225999819748896-25342179999999754312345667718999348887531210
Q gi|254780768|r  154 ILAAMKSAEALSEL-----DVGQSAVSIGGRVVAL-EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADL  227 (281)
Q Consensus       154 I~~g~~i~~~l~~~-----DiGQsvVv~~g~Viai-Ea~eGTD~mi~R~~~~~~~~~~~~~~~~ilvK~~K~~QD~r~Dl  227 (281)
                      |....+.+..-+.+     -+=-+.+..+|.++.+ |++-=-+++-+=+|......   ..++.+++=+.+-.       
T Consensus       104 i~~~~~~l~~~~~l~~~Tgg~H~aal~~~g~~l~~~EDIGRHNAlDK~iG~~L~~~---~~~~~~l~~SGRis-------  173 (237)
T 2pw9_A          104 IKSFIREALHSSPLGPQTHCVHGCGLWNNGRLQVYHEDVGRHNAVDKVLGSILLGR---ASNNSAVYTTGRLT-------  173 (237)
T ss_dssp             HHHHHHHHHTSCSHHHHHSCCEEEEEEETTEEEEEEEESSHHHHHHHHHHHHHTTS---SCSSSEEEESSCBC-------
T ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEEEEECCCEEEEEEECCHHHHHHHHHHHHHHHC---CCCCCEEEECCCCC-------
T ss_conf             99999999861923245643479999626829999991734678999999999736---67788999858788-------


Q ss_pred             CCCCHHHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEEECHHH
Q ss_conf             6627999999998499099997397799858999999998796899957754
Q gi|254780768|r  228 PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF  279 (281)
Q Consensus       228 P~IG~~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g~~~~~  279 (281)
                          -+-+..++.+|+..|+=-+.-|     ..-+++|+++||+|+|+-.+.
T Consensus       174 ----~emv~Ka~~aGIpvivS~sapT-----~lavelA~~~giTLigf~R~~  216 (237)
T 2pw9_A          174 ----SDMVLKCARIGIPIIMSRTSPS-----SLGLALAKRSGATLVAYSRPE  216 (237)
T ss_dssp             ----HHHHHHHHHHTCCEEEESSCBC-----HHHHHHHHHHTCEEEEEEETT
T ss_pred             ----HHHHHHHHHCCCCEEEECCCHH-----HHHHHHHHHCCCEEEEEECCC
T ss_conf             ----9999999985998999986312-----999999998099899996599


No 141
>>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide complex; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* (A:1-184)
Probab=32.79  E-value=31  Score=14.80  Aligned_cols=68  Identities=15%  Similarity=0.156  Sum_probs=42.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC-CCCCEE---EEEHHHHHHHHHHHHHCCCCEE
Q ss_conf             7399997798038999999997899789999548667310-388567---8738999999999986495406
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECR---ELPLGDFCVLRSILHQYNIGRI   69 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-~~~~~~---~~~ig~ig~li~~Lk~~~i~~i   69 (281)
                      +|+-|..|+|-+=..+++.+.+.|++++++.......... ......   .........++...+...+...
T Consensus        21 ~~VlItGatGfiG~~lv~~L~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~   92 (184)
T 2pzm_A           21 MRILITGGAGCLGSNLIEHWLPQGHEILVIDNFATGKREVLPPVAGLSVIEGSVTDAGLLERAFDSFKPTHV   92 (184)
T ss_dssp             CEEEEETTTSHHHHHHHHHHGGGTCEEEEEECCSSSCGGGSCSCTTEEEEECCTTCHHHHHHHHHHHCCSEE
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCCCCCEEEEEECCCCHHCCCCCCCCCCCEE
T ss_conf             869998887789999999999785989999788877765612035967999454572313232113442100


No 142
>>1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B (A:)
Probab=32.60  E-value=25  Score=15.44  Aligned_cols=22  Identities=9%  Similarity=0.238  Sum_probs=15.4

Q ss_pred             EEECCCCHHHHHHHHHCCCEEE
Q ss_conf             2106627999999998499099
Q gi|254780768|r  225 ADLPSIGAKTVQNVIKAGLAGI  246 (281)
Q Consensus       225 ~DlP~IG~~Ti~~~~~ag~~gi  246 (281)
                      .++|-||+.|++.+.++|++.+
T Consensus        10 ~~i~Gig~~~a~~L~~aGi~Tv   31 (70)
T 1wcn_A           10 LNLEGVDRDLAFKLAARGVCTL   31 (70)
T ss_dssp             HSSTTCCHHHHHHHHTTTCCSH
T ss_pred             HHCCCCCHHHHHHHHHCCCCCH
T ss_conf             8178989999999999699759


No 143
>>1agx_A Glutaminase-asparaginase; bacterial amidohydrolase; 2.90A {Acinetobacter glutaminasificans} (A:205-331)
Probab=32.53  E-value=32  Score=14.77  Aligned_cols=103  Identities=15%  Similarity=0.071  Sum_probs=44.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEE----EEECCCCCC
Q ss_conf             3999977980389999999978997899995486673103885678738999999999986495406----770242321
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRI----VVAGAIDRR   78 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~i----vmaG~V~kr   78 (281)
                      ++.|+-..-.+...+.+++...+.+-+|+.-.|.-+..  .        .....+.+...++++-=|    |.-|.+. .
T Consensus        13 ~V~il~~~pG~~~~~~~~~~~~~~~GiVl~~~G~Gn~p--~--------~~~~~l~~~~~~~gi~VV~~Sr~~~G~v~-~   81 (127)
T 1agx_A           13 GVQIVYGSDNMMPDAYQAFAKAGVKAIIHAGTGNGSMA--N--------YLVPEVRKLHDEQGLQIVRSSRVAQGFVL-R   81 (127)
T ss_dssp             CEEEEECCSSCCTHHHHHHHTTTCSEEEEEEBTTTBCC--T--------THHHHHHHHHHTTCCEEEEEESSCSSCBC-T
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCCCCCC--H--------HHHHHHHHHHHHCCCEEEEEEECCCCEEC-C
T ss_conf             77999778999999999876558857999454789898--7--------89999999986189189999858984346-6


Q ss_pred             CCHHHH-------CCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             000111-------02603578999999875104803589999999997
Q gi|254780768|r   79 PNVQDL-------CFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES  119 (281)
Q Consensus        79 P~~~~l-------~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~  119 (281)
                      ......       --|+.+-....++.+.+.+..|.   ..+.+.|+.
T Consensus        82 ~~~~~~~~~G~i~~~~lt~ekAr~kL~~~L~~~~~~---~~i~~~f~~  126 (127)
T 1agx_A           82 NAEQPDDKYGWIAAHDLNPQKARLLMALALTKTNDA---KEIQNMFWN  126 (127)
T ss_dssp             TTSSCHHHHTCEECBTCCHHHHHHHHHHHTTTCCCH---HHHHHHHTT
T ss_pred             CCCCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCH---HHHHHHHHH
T ss_conf             766660018989899989999999999998089999---999999975


No 144
>>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} (A:)
Probab=32.52  E-value=32  Score=14.77  Aligned_cols=72  Identities=13%  Similarity=-0.051  Sum_probs=50.0

Q ss_pred             EEEEECCCCHHH---HHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEE-HHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             999977980389---99999997899789999548667310388567873-8999999999986495406770242
Q gi|254780768|r    4 LLIIAGSGMLPY---YVAKAARLKNDEPVIASVLNECSFDWQDFECRELP-LGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         4 igIIAG~G~LP~---~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~-ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      |=++-|.|.=+.   .+++.+.++|+.++.+.+.|.-............. ...+..++..++..++++++++|.-
T Consensus        19 ivliHG~~~~~~~~~~~~~~L~~~G~~vi~~D~~G~G~s~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~G~S   94 (247)
T 1tqh_A           19 VLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLS   94 (247)
T ss_dssp             EEEECCTTCCTHHHHHHHHHHHHTTCEEEECCCTTSSSCHHHHTTCCHHHHHHHHHHHHHHHHHHTCCCEEEEEET
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             9998689999899999999999789989996020137766676543135678889999998875056867999755


No 145
>>2dpo_A L-gulonate 3-dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.70A {Oryctolagus cuniculus} PDB: 2ep9_A* 3f3s_A* (A:1-190)
Probab=32.48  E-value=32  Score=14.77  Aligned_cols=35  Identities=17%  Similarity=0.100  Sum_probs=28.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |+|||+| |.|..=..+|..+-++|++++++....+
T Consensus         6 ~~kIaVi-GaG~~G~~~A~~la~~G~~V~~~d~~~~   40 (190)
T 2dpo_A            6 AGDVLIV-GSGLVGRSWAMLFASGGFRVKLYDIEPR   40 (190)
T ss_dssp             -CEEEEE-CCSHHHHHHHHHHHHTTCCEEEECSCHH
T ss_pred             CCCEEEE-CCCHHHHHHHHHHHHCCCCEEEEECCHH
T ss_conf             9818998-8669999999999958991899979889


No 146
>>3b81_A Transcriptional regulator, ACRR family; NP_350189.1, predicted DNA-binding transcriptional regulator of TETR/ACRR family; 2.10A {Clostridium acetobutylicum atcc 824} (A:1-80)
Probab=32.37  E-value=19  Score=16.21  Aligned_cols=47  Identities=15%  Similarity=0.170  Sum_probs=42.0

Q ss_pred             HHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             35899999999976974821122252420354334554653234788
Q gi|254780768|r  107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       107 d~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      ..|+.+....|+++|+.=++..+++...=+++|.+...-|++++...
T Consensus        14 ~~il~aa~~l~~~~G~~~~t~~~Ia~~~gvs~~~~Y~~F~~K~~L~~   60 (80)
T 3b81_A           14 TELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYFSSKEECAD   60 (80)
T ss_dssp             HHHHHHHHHHHHHHCSTTCCHHHHHHHHTCCHHHHHTTCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHH
T ss_conf             99999999999974904078999999959898899871699999999


No 147
>>1jdw_A L-arginine\:glycine amidinotransferase; creatine biosynthesis, catalytic triad, reaction mechanism, novel fold, fivefold pseudosymmetry; 1.90A {Homo sapiens} (A:351-400)
Probab=32.22  E-value=28  Score=15.12  Aligned_cols=18  Identities=11%  Similarity=0.342  Sum_probs=11.8

Q ss_pred             HHHHHHHHHCCCEEECHH
Q ss_conf             999999997697482112
Q gi|254780768|r  111 KASIDLLESYGVSVVGAH  128 (281)
Q Consensus       111 ~~i~~~fe~~G~~vi~~~  128 (281)
                      ...++.||+.||++++..
T Consensus        27 ~~li~~lek~Gf~~ip~~   44 (50)
T 1jdw_A           27 VPIQKMFEKLGITTIKVN   44 (50)
T ss_dssp             HHHHHHHHHTTCEEEEEC
T ss_pred             HHHHHHHHHCCCEEEEEC
T ss_conf             999999998889899907


No 148
>>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus aureus subsp} (A:)
Probab=31.96  E-value=32  Score=14.71  Aligned_cols=75  Identities=12%  Similarity=0.047  Sum_probs=52.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC-CC--C--------------------CCEE----------E
Q ss_conf             739999779803899999999789978999954866731-03--8--------------------8567----------8
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQ--D--------------------FECR----------E   48 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~-~~--~--------------------~~~~----------~   48 (281)
                      .||-|..|+|.+=..+++.+.++|++++++......... ..  .                    ....          .
T Consensus         1 ~kIlVtGatG~iG~~lv~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~d~~d~~~~~~~~~~~~~~~~~~~~~~~~~   80 (289)
T 3e48_A            1 XNIXLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPDDWRGKVSVRQLDYFNQESXVEAFKGXDTVVFIPSIIHPSF   80 (289)
T ss_dssp             CCEEEETTTSHHHHHHHHHHHHTTCTTEEEEESSGGGSCGGGBTTBEEEECCTTCHHHHHHHTTTCSEEEECCCCCCSHH
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCHHHCHHHHCCCCEEEEEECCCHHHHHHHHCCCCEEEECCCCCCCHH
T ss_conf             95999898768999999999968998799997894766144249977999736785651121148878998367787413


Q ss_pred             EEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             7389999999999864954067702423
Q gi|254780768|r   49 LPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus        49 ~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      .++...-.+++..++.++++++++....
T Consensus        81 ~n~~~t~~l~~aa~~~~~~~~v~~ss~~  108 (289)
T 3e48_A           81 KRIPEVENLVYAAKQSGVAHIIFIGYYA  108 (289)
T ss_dssp             HHHHHHHHHHHHHHHTTCCEEEEEEESC
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             4322100244443330354236775033


No 149
>>2ras_A Transcriptional regulator, TETR family; YP_495839.1, predicted transcriptional regulator of TETR/ACRR family; 1.80A {Novosphingobium aromaticivorans DSM12444} (A:1-66)
Probab=31.89  E-value=28  Score=15.17  Aligned_cols=48  Identities=13%  Similarity=0.189  Sum_probs=42.4

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      -+.|+.+....|.+.|+.=++..++....=++.+-+...=|++++.-.
T Consensus        13 r~~Il~aa~~l~~~~G~~~~s~~~Ia~~~gvs~~~iY~~F~~K~~L~~   60 (66)
T 2ras_A           13 RARLVDVAQAIVEERGGAGLTLSELAARAGISQANLSRYFETREDLXE   60 (66)
T ss_dssp             HHHHHHHHHHHHHHHTSSCCCHHHHHHHHTSCHHHHTTTCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHCCHHHHHH
T ss_conf             999999999999975902067999999868487568786087789999


No 150
>>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} (A:)
Probab=31.71  E-value=33  Score=14.68  Aligned_cols=40  Identities=25%  Similarity=0.299  Sum_probs=31.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             7399997798038999999997899789999548667310
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW   41 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~   41 (281)
                      ++=-+|.|.|..=..+++.+..+|++++++....+....+
T Consensus         4 ~~~i~IiG~G~~G~~la~~l~~~g~~V~vid~~~~~~~~~   43 (140)
T 1lss_A            4 GMYIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKA   43 (140)
T ss_dssp             -CEEEEECCSHHHHHHHHHHHHTTCEEEEEESCHHHHHHH
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECHHHHHHHH
T ss_conf             9999998989999999999997799679985015666554


No 151
>>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Sulfolobus tokodaii str} (A:1-77)
Probab=31.52  E-value=33  Score=14.66  Aligned_cols=37  Identities=19%  Similarity=0.272  Sum_probs=29.2

Q ss_pred             HHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             99997332672259998197488962534217999999975
Q gi|254780768|r  159 KSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC  199 (281)
Q Consensus       159 ~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~  199 (281)
                      ++++.+....+++-.|+.+|+++++    =|+.=|.|+..-
T Consensus        25 ~a~~~m~~~~~~~lpVvd~~~lvGi----iT~~Di~r~~~~   61 (77)
T 2ef7_A           25 DIAKVXTEKNIGSVIVVDGNKPVGI----ITERDIVKAIGK   61 (77)
T ss_dssp             HHHHHHHHHTCSEEEEEETTEEEEE----EEHHHHHHHHHT
T ss_pred             HHHHHHHHCCCCEEEEECCCEEEEE----EEEHHHHHHHHH
T ss_conf             9999999869966877537358998----530146666542


No 152
>>1bwd_A ADT, protein (inosamine-phosphate amidinotransferase); streptomycin; 3.10A {Streptomyces griseus} (A:276-325)
Probab=31.37  E-value=30  Score=14.97  Aligned_cols=18  Identities=39%  Similarity=0.488  Sum_probs=11.7

Q ss_pred             HHHHHHHHHCCCEEECHH
Q ss_conf             999999997697482112
Q gi|254780768|r  111 KASIDLLESYGVSVVGAH  128 (281)
Q Consensus       111 ~~i~~~fe~~G~~vi~~~  128 (281)
                      ..+++.||+.||++++..
T Consensus        27 ~~li~~lek~Gf~vIpv~   44 (50)
T 1bwd_A           27 TALIRLLEKHGMNVLPLQ   44 (50)
T ss_dssp             HHHHHHHHHTTCEEEEEC
T ss_pred             HHHHHHHHHCCCEEEEEC
T ss_conf             999999998889999916


No 153
>>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} (A:1-129)
Probab=31.31  E-value=25  Score=15.43  Aligned_cols=43  Identities=9%  Similarity=0.017  Sum_probs=24.0

Q ss_pred             HHHHHHHHCCCEEEEEECCCEEEECHHHHHHHHHHCCCEEEEECHH
Q ss_conf             9999999849909999739779985899999999879689995775
Q gi|254780768|r  233 KTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE  278 (281)
Q Consensus       233 ~Ti~~~~~ag~~giaiea~~~lild~~~~i~~a~~~~i~i~g~~~~  278 (281)
                      +.++.+.+.++.+|++..|...   .+.+++.|+++++-++..+.+
T Consensus        71 ~~~~~~~~~~~~~iiit~~~~~---~~~i~~~a~~~~iPil~t~~~  113 (129)
T 1ko7_A           71 GRMRKLCRPETPAIIVTRDLEP---PEELIEAAKEHETPLITSKIA  113 (129)
T ss_dssp             THHHHHCCTTCCCEEECTTCCC---CHHHHHHHHHTTCCEEECCSC
T ss_pred             HHHHHHHCCCCCEEEEECCCCC---CHHHHHHHHHHCCEEEECCCC
T ss_conf             9999973679988999799999---899999999819839984874


No 154
>>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} (A:98-164)
Probab=31.29  E-value=33  Score=14.64  Aligned_cols=38  Identities=13%  Similarity=0.149  Sum_probs=29.2

Q ss_pred             HHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             999997332672259998197488962534217999999975
Q gi|254780768|r  158 MKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC  199 (281)
Q Consensus       158 ~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~  199 (281)
                      ..+++.+...++++-.||.+|+++++    =|..-+.|+..-
T Consensus        13 ~~a~~lm~~~~i~~lpVv~~g~lvGi----iT~~Dl~~~~~~   50 (67)
T 2pfi_A           13 HQAQNLFKLLNLQSLFVTSRGRAVGC----VSWVEMKKAISN   50 (67)
T ss_dssp             HHHHHHHHHTTCSEEEEEETTEEEEE----EEHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCEEEEECCCEEEEE----EEHHHHHHHHHH
T ss_conf             99999999819875468518837999----869999999997


No 155
>>2w70_A Biotin carboxylase; ligase, inhibitor, ATP-binding, fatty acid biosynthesis, nucleotide-binding, lipid synthesis, ATP-grAsp domain; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 1dv2_A* 2gps_A 2gpw_A 3g8c_A* ... (A:1-105)
Probab=31.11  E-value=33  Score=14.62  Aligned_cols=69  Identities=13%  Similarity=0.055  Sum_probs=45.9

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--CCCEEEE-------EHHHHHHHHHHHHHCCCCEE
Q ss_conf             973999977980389999999978997899995486673103--8856787-------38999999999986495406
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECREL-------PLGDFCVLRSILHQYNIGRI   69 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--~~~~~~~-------~ig~ig~li~~Lk~~~i~~i   69 (281)
                      |=+==|||-.|.-...+.+.++..|.+.+.+.-....+...-  ..+...+       +.-.+.++++.-++.+|+-+
T Consensus         1 mi~kvLIANRGeiA~Riirt~~elgi~~vavys~~D~~s~~v~~ade~~~lg~~~~~~sYl~~~~Ii~~A~~~g~~Ai   78 (105)
T 2w70_A            1 MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAI   78 (105)
T ss_dssp             CCSEEEECCCHHHHHHHHHHHHHHTCEEEEEEEGGGTTCHHHHHSSEEEEEECSSGGGTTTCHHHHHHHHHHHTCCEE
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEECCCHHHCCCCHHHCCEEEECCCCCHHHHHCCHHHHHHHHHHCCCCEE
T ss_conf             964199989719999999999986992999848133158897679899985998635300489999999988299999


No 156
>>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} (A:)
Probab=30.96  E-value=34  Score=14.60  Aligned_cols=35  Identities=11%  Similarity=0.179  Sum_probs=30.3

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             73999977980389999999978997899995486
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      .||-|+.|+|.+=..+++.+.++|+++.++.....
T Consensus         1 ~kIlItGatG~iG~~l~~~L~~~g~~V~~~~r~~~   35 (224)
T 3h2s_A            1 XKIAVLGATGRAGSAIVAEARRRGHEVLAVVRDPQ   35 (224)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTCEEEEEESCHH
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             96999998857999999999978698999988857


No 157
>>2g0w_A LMO2234 protein; 16411704, structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE PG4; 1.70A {Listeria monocytogenes} (A:)
Probab=30.88  E-value=34  Score=14.59  Aligned_cols=16  Identities=6%  Similarity=0.000  Sum_probs=11.4

Q ss_pred             HHHHHHHHHCCCEEEE
Q ss_conf             9999999984990999
Q gi|254780768|r  232 AKTVQNVIKAGLAGIA  247 (281)
Q Consensus       232 ~~Ti~~~~~ag~~gia  247 (281)
                      .+-++.+.+.|++|..
T Consensus       241 ~~il~~l~~~gy~G~~  256 (296)
T 2g0w_A          241 VGFAKILKEHGVNPRV  256 (296)
T ss_dssp             HHHHHHHHHHTCCCSC
T ss_pred             HHHHHHHHHHCCCCCE
T ss_conf             9999999984999887


No 158
>>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; HET: MSE; 1.90A {Pseudomonas putida} (A:1-168)
Probab=30.72  E-value=34  Score=14.58  Aligned_cols=153  Identities=8%  Similarity=-0.117  Sum_probs=87.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-CCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             973999977980389999999978997899995486673103-8856787389999999999864954067702423210
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRP   79 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP   79 (281)
                      |.|+|+| |-|..=..+|+.+..+|+++++..........+. .......++.+      .+++  ++-++.+=.-+  +
T Consensus         9 ~~~vgiI-G~G~iG~~iA~~L~~~G~~V~~~dr~~~~~~~~~~~~~~~~~~~~e------~~~~--aDvv~~~v~~~--~   77 (168)
T 3l6d_A            9 EFDVSVI-GLGAXGTIXAQVLLKQGKRVAIWNRSPGKAAALVAAGAHLCESVKA------ALSA--SPATIFVLLDN--H   77 (168)
T ss_dssp             SCSEEEE-CCSHHHHHHHHHHHHTTCCEEEECSSHHHHHHHHHHTCEECSSHHH------HHHH--SSEEEECCSSH--H
T ss_pred             CCCEEEE-EHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEECCCHHH------HHHC--CCEEEEECCCH--H
T ss_conf             9968998-1599999999999978996999809999999999868977699999------9837--99787405609--9


Q ss_pred             CHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             00111026035789999998751048035899999999976974821122252420354334554653234788998999
Q gi|254780768|r   80 NVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMK  159 (281)
Q Consensus        80 ~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~~  159 (281)
                      ..................+.-....+.-.....+...++..++..++..-+-++-.+..+.++-..-.  +....+....
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~v~g~~~~a~~~~l~~~~gg--~~~~~~~~~~  155 (168)
T 3l6d_A           78 ATHEVLGXPGVARALAHRTIVDYTTNAQDEGLALQGLVNQAGGHYVKGXIVAYPRNVGHRESHSIHTG--DREAFEQHRA  155 (168)
T ss_dssp             HHHHHHTSTTHHHHTTTCEEEECCCCCTTHHHHHHHHHHHTTCEEEEEEEESCGGGTTCTTCEEEEEE--CHHHHHHHHH
T ss_pred             HHHHHHHHHCHHHHCCCCEEECCCCCCHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCEEEEECC--CHHHHHHHHH
T ss_conf             99999972022553499754226767656666666554037825774255225333456640488527--6667778899


Q ss_pred             HHHHHCC
Q ss_conf             9997332
Q gi|254780768|r  160 SAEALSE  166 (281)
Q Consensus       160 i~~~l~~  166 (281)
                      ++..++.
T Consensus       156 ~~~~~g~  162 (168)
T 3l6d_A          156 LLEGLAG  162 (168)
T ss_dssp             HHHTTCS
T ss_pred             HHHHHCC
T ss_conf             9999577


No 159
>>1nba_A N-carbamoylsarcosine amidohydrolase; hydrolase(IN linear amides); 2.00A {Arthrobacter SP} (A:39-264)
Probab=30.61  E-value=15  Score=17.00  Aligned_cols=77  Identities=13%  Similarity=0.066  Sum_probs=49.1

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHH------HHHHHCCCCHHHHHHHHHHHHHCCCEEECHHH
Q ss_conf             999999864954067702423210001110260357899999------98751048035899999999976974821122
Q gi|254780768|r   56 VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKM------IWQLVSGGNAAILKASIDLLESYGVSVVGAHE  129 (281)
Q Consensus        56 ~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~------l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~  129 (281)
                      .+..+|++++|++++++|-.+- --..      .+..-+...      +.....--+...=....+.+...|-+|++..+
T Consensus       116 ~L~~~Lr~~gi~~ivv~Gi~Td-~CV~------~Ta~~A~~~G~~V~v~~Da~~~~~~e~~~~al~~l~~~~~~v~~~~~  188 (226)
T 1nba_A          116 NLELFLTSNRIDTLIVTGATAA-GCVR------HTVEDAIAKGFRPIIPRETIGDRVPGVVQWNLYDIDNKFGDVESTDS  188 (226)
T ss_dssp             SHHHHHHHTTCCEEEEEEECTT-THHH------HHHHHHHHHTCEEEEEGGGEECSSSSHHHHHHHHHHHHTCEEECHHH
T ss_pred             HHHHHHHHCCCCEEEEEEECCC-CHHH------HHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEHHH
T ss_conf             1778898669763899963656-6699------99999998899899955034799999999999999961969922999


Q ss_pred             CCHHHCCCCC
Q ss_conf             2524203543
Q gi|254780768|r  130 IVPELLVQVG  139 (281)
Q Consensus       130 ~l~~ll~~~G  139 (281)
                      ++..+-..+-
T Consensus       189 ~l~~l~~~~~  198 (226)
T 1nba_A          189 VVQYLDALPQ  198 (226)
T ss_dssp             HHHHHHHSCC
T ss_pred             HHHHHHHCCC
T ss_conf             9999984704


No 160
>>1vkm_A Conserved hypothetical protein TM1464; conserved hypothetical protein possibly involved in carbohydrate metabolism, structural genomics; HET: MSE UNL; 1.90A {Thermotoga maritima MSB8} (A:)
Probab=30.32  E-value=33  Score=14.69  Aligned_cols=126  Identities=16%  Similarity=0.220  Sum_probs=65.1

Q ss_pred             HHHHHHHHCCCCEEEEEECCCC------CCCCC---CCCEEEEEHHHHHHHH--------------HHHHHCCCCEEEE-
Q ss_conf             9999999789978999954866------73103---8856787389999999--------------9998649540677-
Q gi|254780768|r   16 YVAKAARLKNDEPVIASVLNEC------SFDWQ---DFECRELPLGDFCVLR--------------SILHQYNIGRIVV-   71 (281)
Q Consensus        16 ~ia~~~~~~g~~~~ii~l~~~~------~~~~~---~~~~~~~~ig~ig~li--------------~~Lk~~~i~~ivm-   71 (281)
                      .+-+..+.+|--|-.+++.+..      +.+++   +-...-++..+++..+              ..-+..||+=.+= 
T Consensus        48 ~~E~~vR~~GavPATiai~~G~i~VGl~~~eLe~~a~~~~~KvS~RDl~~~~a~g~~GaTTVsaTm~~A~~aGI~vFaTG  127 (297)
T 1vkm_A           48 RAKEISREKGFQLAVIGILKGKIVAGXSEEELEAXXREGADKVGTREIPIVVAEGKNAATTVSATIFLSRRIGIEVVVTG  127 (297)
T ss_dssp             HHHHHHHHHTCEEEEEEEETTEEEESCCHHHHHHHHHHCCEEECGGGHHHHHHHTCCEEECHHHHHHHHHHHTCCEEECS
T ss_pred             HHHHHHHHCCCCCEEEEEECCEEEECCCHHHHHHHHHCCHHHCCCCCHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             99999997798530799998975657899999998623102225325899961476665309999999985698289875


Q ss_pred             -ECCCCCCCCHHHHCCCHHHHHHHHHHHHHH----HCCCCHHH--HHHHHHHHHHCCCEEECHH-HCCHHHCCCC-CCCC
Q ss_conf             -024232100011102603578999999875----10480358--9999999997697482112-2252420354-3345
Q gi|254780768|r   72 -AGAIDRRPNVQDLCFSIKDSLRISKMIWQL----VSGGNAAI--LKASIDLLESYGVSVVGAH-EIVPELLVQV-GSLG  142 (281)
Q Consensus        72 -aG~V~krP~~~~l~~D~~~~~~l~k~l~~~----~~~gDd~i--L~~i~~~fe~~G~~vi~~~-~~l~~ll~~~-G~l~  142 (281)
                       .|+|. |-.+     |...|+.-   |.+.    .--|-.+|  +..-.+++|.+|+.|++.+ +.+|-++... |+-.
T Consensus       128 GiGGVH-r~t~-----DiSaDL~e---L~rtpV~VV~AG~KsILDi~~TlE~LET~GV~V~gy~t~~fPaFyt~~Sg~~~  198 (297)
T 1vkm_A          128 GTGGVH-PGRV-----DVSQDLTE---XSSSRAVLVSSGIKSILDVEATFEXLETLEIPLVGFRTNEFPLFFSRKSGRRV  198 (297)
T ss_dssp             CBCCBC-TTSS-----CBCHHHHH---HTTCCEEEEESBBCTTSCHHHHHHHHHHTTCCEEEESCSBCCBTTBSCCSCBC
T ss_pred             CCCCCC-CCCC-----CCCCCHHH---HHCCCEEEEECCCHHHCCCHHHHHHHHHCCEEEEEECCCCCCCEEECCCCCCC
T ss_conf             626656-7872-----22421888---71487589932726540556789999856627997368865540017889868


Q ss_pred             CCCCCHHH
Q ss_conf             54653234
Q gi|254780768|r  143 TCVPNRDV  150 (281)
Q Consensus       143 ~~~p~~~~  150 (281)
                      .+-.+..+
T Consensus       199 ~~~~~~~e  206 (297)
T 1vkm_A          199 PRIENVEE  206 (297)
T ss_dssp             CEECSHHH
T ss_pred             CCCCCHHH
T ss_conf             87499999


No 161
>>2i10_A Putative TETR transcriptional regulator; structural genomics, APC5890, TETR family, PSI-2, protein structure initiative; HET: MSE NPO PGE; 2.05A {Rhodococcus SP} (A:1-68)
Probab=30.24  E-value=14  Score=17.18  Aligned_cols=50  Identities=12%  Similarity=0.083  Sum_probs=44.1

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             48035899999999976974821122252420354334554653234788
Q gi|254780768|r  104 GGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       104 ~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      .--+.|+.+..+.|.++|+.=++..++....=++.|.+...-|++++.-.
T Consensus        11 ~~r~~Il~aa~~l~~~~G~~~~ti~~Ia~~~gvs~~~~Y~~F~sK~~L~~   60 (68)
T 2i10_A           11 FDDQVALQTAXELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFE   60 (68)
T ss_dssp             -CCHHHHHHHHHHHHHHTTTTCCHHHHHHHHTCCHHHHHHHHCSHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHH
T ss_conf             75999999999999986915188999999858785568861599999999


No 162
>>1t94_A Polymerase (DNA directed) kappa; replication, DNA repair, Y-family DNA polymerase, translesion DNA synthesis, lesion bypass; 2.40A {Homo sapiens} (A:271-340)
Probab=30.07  E-value=22  Score=15.83  Aligned_cols=19  Identities=21%  Similarity=0.321  Sum_probs=7.8

Q ss_pred             EECCCCHHHHHHHHHCCCE
Q ss_conf             1066279999999984990
Q gi|254780768|r  226 DLPSIGAKTVQNVIKAGLA  244 (281)
Q Consensus       226 DlP~IG~~Ti~~~~~ag~~  244 (281)
                      |+|-||..|-+.+.+.|+.
T Consensus        16 ~i~GIG~~~~~~L~~~gI~   34 (70)
T 1t94_A           16 KVSGIGKVTEKMLKALGII   34 (70)
T ss_dssp             GCTTSCHHHHHHHHHTTCC
T ss_pred             CCCCCCCCCHHHHHHHCCC
T ss_conf             0257631100454541358


No 163
>>2j9l_A Chloride channel protein 5; domain, membrane, transport, CBS domain, CLC, disease mutation, ION channel, ION transport, transmembrane; HET: ATP; 2.30A {Homo sapiens} (A:115-185)
Probab=29.74  E-value=35  Score=14.47  Aligned_cols=35  Identities=17%  Similarity=0.230  Sum_probs=26.7

Q ss_pred             HHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHH
Q ss_conf             999997332672259998197488962534217999999
Q gi|254780768|r  158 MKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRI  196 (281)
Q Consensus       158 ~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~  196 (281)
                      .++++.+.+.++++-.||.+|..+|+    =|..=|.|+
T Consensus        14 ~ea~~~m~~~~i~~lpVvd~g~lvGi----IT~~Di~~~   48 (71)
T 2j9l_A           14 EIVVDIFRKLGLRQCLVTHNGRLLGI----ITKKDVLKH   48 (71)
T ss_dssp             HHHHHHHHHHTCSEEEEEETTEEEEE----EEHHHHHHH
T ss_pred             HHHHHHHHHHCCCEEEEEECCEEEEE----EEHHHHHHH
T ss_conf             99999988637631379989989999----989999999


No 164
>>1r89_A TRNA nucleotidyltransferase; CCA adding enzyme, incoming nucleotide, nucleotidyltransferase superfamily; HET: CTP; 1.80A {Archaeoglobus fulgidus} (A:256-337,A:383-437)
Probab=29.53  E-value=32  Score=14.71  Aligned_cols=61  Identities=16%  Similarity=0.187  Sum_probs=38.6

Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHH
Q ss_conf             99999999864954067702423210001110260357899999987510480358999999999769748211222524
Q gi|254780768|r   54 FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPE  133 (281)
Q Consensus        54 ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~  133 (281)
                      -+.+.+.|++++-.-++.  .+ ++|.+       -.|...+.+ .+        ..+++.+.++++||+|+.+.-+..+
T Consensus         9 ~e~I~e~L~~RgT~iiaV--~F-~~Pdi-------VdDILyPQL-~R--------s~~sI~k~Le~~GF~Virs~~wsDe   69 (137)
T 1r89_A            9 PERLRKIVEERGTAVFAV--KF-RKPDI-------VDDNLYPQL-ER--------ASRKIFEFLERENFMPLRSAFKASE   69 (137)
T ss_dssp             HHHHHHHHHHHTCEEEEE--EE-ECCSC-------CHHHHHHHH-HH--------HHHHHHHHHHHTTCCEEEEEEEECS
T ss_pred             HHHHHHHHHHCCCEEEEE--EE-CCCCC-------CCCHHHHHH-HH--------HHHHHHHHHHHCCCEEEEEEEEECC
T ss_conf             788767763157559999--80-68778-------741367899-99--------9999999999769889973576279


No 165
>>2oos_A Enoyl-acyl carrier reductase; pfenr, malaria, triclosan analog, oxidoreductase; HET: NAD JPJ; 2.10A {Plasmodium falciparum} (A:)
Probab=29.46  E-value=36  Score=14.43  Aligned_cols=35  Identities=20%  Similarity=0.183  Sum_probs=30.5

Q ss_pred             CEEEEEECCCC---HHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             73999977980---389999999978997899995486
Q gi|254780768|r    2 KRLLIIAGSGM---LPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         2 ~kigIIAG~G~---LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      +|+++|-|.|.   +=..+|+.+-++|.++++......
T Consensus        10 gK~alVTGa~ss~GIG~aiA~~la~~G~~Vvl~~r~~~   47 (338)
T 2oos_A           10 EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPV   47 (338)
T ss_dssp             CCEEEEECCSSSSSHHHHHHHHHHHTTCEEEEEECHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             94899989899863999999999986998999827415


No 166
>>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} (A:123-237)
Probab=29.35  E-value=36  Score=14.42  Aligned_cols=56  Identities=11%  Similarity=0.089  Sum_probs=32.8

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             9997798038999999997899789999548667310388567873899999999998649540
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      -.|.|+|....++|..++..|.++.++.-.+..-+.+   ..   .  -...+.+.|+++||+-
T Consensus        29 i~IiGgG~~g~e~A~~l~~~g~~v~lv~~~~~~~~~~---~~---~--~~~~~~~~l~~~gI~~   84 (115)
T 1yqz_A           29 VLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKLM---DA---D--MNQPILDELDKREIPY   84 (115)
T ss_dssp             EEEECCSHHHHHHHHHHHHHTCEEEEEESSSCCSTTS---CG---G--GGHHHHHHHHHTTCCE
T ss_pred             EEEEEEEEECCCCCCCEECCCCCCCEEECCCCCCCCC---HH---H--HHHHHHHHCCCCEEEE
T ss_conf             5786311000122211000323210011000223320---13---4--5555542112340699


No 167
>>3ju2_A Uncharacterized protein SMC04130; structural genomics, PSI-2, TIM barrel protein, protein structure initiative, Zn binding domain; 1.80A {Sinorhizobium meliloti} (A:)
Probab=29.14  E-value=16  Score=16.78  Aligned_cols=204  Identities=9%  Similarity=-0.041  Sum_probs=95.2

Q ss_pred             EEEEEE-C-CCCH-HHHHHHHHHHCCCCEEEEEECCCCCCCC-------CCC--C---E-------------EEEEHHHH
Q ss_conf             399997-7-9803-8999999997899789999548667310-------388--5---6-------------78738999
Q gi|254780768|r    3 RLLIIA-G-SGML-PYYVAKAARLKNDEPVIASVLNECSFDW-------QDF--E---C-------------RELPLGDF   54 (281)
Q Consensus         3 kigIIA-G-~G~L-P~~ia~~~~~~g~~~~ii~l~~~~~~~~-------~~~--~---~-------------~~~~ig~i   54 (281)
                      |+|+-. . .+.. +...++.+.+.|++.+=+......+...       .+.  .   .             ....+..+
T Consensus         7 ~i~~~~~~~~~~~~~~~~~~~~~~~G~~~iEl~~~~~~~~~~~~~~~~l~~~gi~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (284)
T 3ju2_A            7 GLSINLATIREQCGFAEAVDICLKHGITAIAPWRDQVAAIGLGEAGRIVRANGLKLTGLCRGGFFPAPDASGREKAIDDN   86 (284)
T ss_dssp             TEEEEGGGGTTTCCHHHHHHHHHHTTCCEEECBHHHHHHHCHHHHHHHHHHTTCEESCEEEEECCCCSSHHHHHHHHHHH
T ss_pred             CHHHHHHHHCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             41145998747999999999999809999997576667579999999999709868883577666799989999999999


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHH
Q ss_conf             99999998649540677024232100011102603578999999875104803589999999997697482112225242
Q gi|254780768|r   55 CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPEL  134 (281)
Q Consensus        55 g~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~l  134 (281)
                      .+.++..+..+++.+++.......+..     +  ... ....+        -.-++.+.++.++.|+++.=-+ ..+..
T Consensus        87 ~~~i~~a~~lg~~~i~~~~~~~~~~~~-----~--~~~-~~~~~--------~~~~~~l~~~a~~~gi~l~iE~-~~~~~  149 (284)
T 3ju2_A           87 RRAVDEAAELGADCLVLVAGGLPGGSK-----N--IDA-ARRMV--------VEGIAAVLPHARAAGVPLAIEP-LHPMY  149 (284)
T ss_dssp             HHHHHHHHHHTBSCEEEECBCCCTTCC-----C--HHH-HHHHH--------HHHHHHHHHHHHHHTCCEEECC-CCGGG
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCC-----C--HHH-HHHHH--------HHHHHHHHHHHHHCCEEEEECC-CCCCC
T ss_conf             999899999689842133310246789-----9--999-99999--------9999999999875040011035-65646


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHH--HHHHHH-HHHHHHCCCCCCCCE
Q ss_conf             03543345546532347889989999997332672259998197488962534217--999999-975431234566771
Q gi|254780768|r  135 LVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTD--SMLQRI-VDCRNNGRILAGKSG  211 (281)
Q Consensus       135 l~~~G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD--~mi~R~-~~~~~~~~~~~~~~~  211 (281)
                           ......      .+....+..++.+..-++|=..=+.+-.      ..|-|  +.+.+. +...         ..
T Consensus       150 -----~~~~~~------~~~~~~~~~~~~~~~~~vg~~~D~~h~~------~~g~~~~~~~~~~~~~~i---------~~  203 (284)
T 3ju2_A          150 -----AADRAC------VNTLGQALDICETLGPGVGVAIDVYHVW------WDPDLANQIARAGKMKAI---------LA  203 (284)
T ss_dssp             -----TTTTBS------CCCHHHHHHHHHHHCTTEEEEEEHHHHT------TCTTHHHHHHHHHHTTCE---------EE
T ss_pred             -----CCCCCH------HHHHHHHHHHHHHCCCCEEEEECCHHHH------HCCCCHHHHHHHHHCCEE---------EE
T ss_conf             -----687212------0169999988874276003553202554------179968999986413558---------99


Q ss_pred             EEEEECCCCCCCEEE---ECC---CC-HHHHHHHHHCCCEEEE-EE
Q ss_conf             899934888753121---066---27-9999999984990999-97
Q gi|254780768|r  212 VLVKMCKSQQDMRAD---LPS---IG-AKTVQNVIKAGLAGIA-LE  249 (281)
Q Consensus       212 ilvK~~K~~QD~r~D---lP~---IG-~~Ti~~~~~ag~~gia-ie  249 (281)
                      +=+|-.+...+.+-|   .|-   +- ..-++.+.++|++|.. +|
T Consensus       204 vHi~D~~~~~~~~~~~~~~~G~G~id~~~~~~~L~~~gy~g~~~~E  249 (284)
T 3ju2_A          204 HHICDWLVPTKDMLTDRGMMGDGVIDLKGIRRRIEAAGFHGAQEVE  249 (284)
T ss_dssp             EEECBCCSSCCCSSSBCBCTTSSSCCHHHHHHHHHHTTCCCCEEEC
T ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEE
T ss_conf             9963566655334567778988314899999999981996489998


No 168
>>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A (A:1-137,A:210-451)
Probab=28.80  E-value=36  Score=14.36  Aligned_cols=107  Identities=19%  Similarity=0.122  Sum_probs=59.4

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHH
Q ss_conf             99997798038999999997899789999548667310388567873899999999998649540677024232100011
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQD   83 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~   83 (281)
                      ==+|+|+|..-..++.++.. +..+..+.....+........+..++..++..++++-++++|+-++ .|.-.  |....
T Consensus        23 kvLi~g~g~~e~ai~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~i~~~a~~~~id~v~-~g~~~--~~~~~   98 (379)
T 2yrx_A           23 NVLVIGRGGREHAIAWKAAQ-SPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLTI-VGPEA--PLASG   98 (379)
T ss_dssp             EEEEEECSHHHHHHHHHHHT-CTTEEEEEEEECCTTGGGTSEECCCCTTCHHHHHHHHHHTTCSEEE-ECSHH--HHHTT
T ss_pred             EEEEECCCHHHHHHHHHHHH-CCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEE-ECCCH--HHHHH
T ss_conf             89999978899999999972-9998889998998788740827753889999999999995999999-89846--88878


Q ss_pred             H-------CCC-HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCE
Q ss_conf             1-------026-035789999998751048035899999999976974
Q gi|254780768|r   84 L-------CFS-IKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS  123 (281)
Q Consensus        84 l-------~~D-~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~  123 (281)
                      +       ..- +.+...+.++.      +|-...|   ++++++|+-
T Consensus        99 ~~~~~~~~gi~~~Gps~~aa~~~------~dK~~~k---~~~~~~gIP  137 (379)
T 2yrx_A           99 IVDRFMAEGLRIFGPSQRAALIE------GSKAFAK---ELMKKYGIP  137 (379)
T ss_dssp             HHHHHHHTTCCEESCCHHHHHHH------HCHHHHH---HHHHHTTCC
T ss_pred             HHHHHHHCCCEEEECCHHHHHHH------HHHHHHH---HHHHHHCCC
T ss_conf             99999745982773368898776------6789999---999971875


No 169
>>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} (A:1-190)
Probab=28.58  E-value=37  Score=14.34  Aligned_cols=74  Identities=22%  Similarity=0.078  Sum_probs=51.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-------------CCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             73999977980389999999978997899995486673103-------------88567873899999999998649540
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-------------DFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-------------~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      +++-|..|.|-+-..+++++.++|+.++++...........             .+.....++.+...+...+....+..
T Consensus         2 K~ilVtGatG~iG~~lv~~Ll~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~~~~~~~~~~~~~   81 (190)
T 1db3_A            2 KVALITGVTGQDGSYLAEFLLEKGYEVHGIKRRASSFNTERVDHIYQDPHTCNPKFHLHYGDLSDTSNLTRILREVQPDE   81 (190)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTCEEEEECC---------------------CCEEECCCCSSCHHHHHHHHHHHCCSE
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCE
T ss_conf             88999577878999999999978598999978987543566888764120258965999855899999999998669864


Q ss_pred             EEEECCC
Q ss_conf             6770242
Q gi|254780768|r   69 IVVAGAI   75 (281)
Q Consensus        69 ivmaG~V   75 (281)
                      ++-+-..
T Consensus        82 vi~~a~~   88 (190)
T 1db3_A           82 VYNLGAM   88 (190)
T ss_dssp             EEECCCC
T ss_pred             EEEECCC
T ss_conf             8864122


No 170
>>3icj_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; HET: KCX; 1.95A {Pyrococcus furiosus} PDB: 3etk_A* 3igh_X* (A:1-96,A:487-534)
Probab=28.35  E-value=37  Score=14.31  Aligned_cols=27  Identities=26%  Similarity=0.208  Sum_probs=21.6

Q ss_pred             CCCCEEEEEEECCEEEEEECCCCHHHHHHHH
Q ss_conf             2672259998197488962534217999999
Q gi|254780768|r  166 ELDVGQSAVSIGGRVVALEGIEGTDSMLQRI  196 (281)
Q Consensus       166 ~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~  196 (281)
                      .-..-++++|++|+++++    |+++-+.+.
T Consensus        51 ~~p~aeAvaV~~grI~~v----Gs~~~~~~~   77 (144)
T 3icj_A           51 PVKKVSGLVISNERVLYA----GDSSTALRI   77 (144)
T ss_dssp             TEEEESEEEEETTEEEEE----ECHHHHHHH
T ss_pred             CCCEEEEEEEECCEEEEE----CCCHHHHHH
T ss_conf             986670899999999998----880898974


No 171
>>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} (A:308-654)
Probab=28.26  E-value=37  Score=14.30  Aligned_cols=20  Identities=10%  Similarity=0.177  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHCCCCEEEE
Q ss_conf             99999999998649540677
Q gi|254780768|r   52 GDFCVLRSILHQYNIGRIVV   71 (281)
Q Consensus        52 g~ig~li~~Lk~~~i~~ivm   71 (281)
                      ....+-++.+|..|+.-|=+
T Consensus        45 ~~~~~~l~~~k~~G~N~iR~   64 (347)
T 2je8_A           45 ERYQTLFRDMKEANMNMVRI   64 (347)
T ss_dssp             HHHHHHHHHHHHTTCCEEEE
T ss_pred             HHHHHHHHHHHHCCCCEEEC
T ss_conf             99999999998679978986


No 172
>>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} (A:)
Probab=28.26  E-value=37  Score=14.30  Aligned_cols=36  Identities=11%  Similarity=0.126  Sum_probs=30.7

Q ss_pred             CEEEEEECCC---CHHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             7399997798---03899999999789978999954866
Q gi|254780768|r    2 KRLLIIAGSG---MLPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         2 ~kigIIAG~G---~LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      +|.+||.|..   -+-..+|+.+-+.|.+++++....+.
T Consensus         6 gK~vlITGass~~GIG~aiA~~la~~Ga~V~~~~r~~~~   44 (275)
T 2pd4_A            6 GKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESL   44 (275)
T ss_dssp             TCEEEEECCCSTTSHHHHHHHHHHTTTCEEEEEESSTTT
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             898999899997289999999999879999999688899


No 173
>>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} (A:)
Probab=28.16  E-value=37  Score=14.29  Aligned_cols=75  Identities=8%  Similarity=-0.110  Sum_probs=53.9

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---------C--------C---------CCEEEEEHHHH
Q ss_conf             97399997798038999999997899789999548667310---------3--------8---------85678738999
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---------Q--------D---------FECRELPLGDF   54 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---------~--------~---------~~~~~~~ig~i   54 (281)
                      ++|+-|+.|+|-+=..+++.+.++|++++.+.-........         .        .         ......++...
T Consensus         4 ~~kVLVtGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (286)
T 3ius_A            4 XTGTLLSFGHGYTARVLSRALAPQGWRIIGTSRNPDQXEAIRASGAEPLLWPGEEPSLDGVTHLLISTAPDSGGDPVLAA   83 (286)
T ss_dssp             -CCEEEEETCCHHHHHHHHHHGGGTCEEEEEESCGGGHHHHHHTTEEEEESSSSCCCCTTCCEEEECCCCBTTBCHHHHH
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEECCCCCCCCCCCCEECCCCCCCCCCCCHHHH
T ss_conf             89848998960999999999997899899993881335788746946886141000011101000123431123423334


Q ss_pred             HHHHHHHHHCCCCEEEEECCC
Q ss_conf             999999986495406770242
Q gi|254780768|r   55 CVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus        55 g~li~~Lk~~~i~~ivmaG~V   75 (281)
                      ...+....++++.+++++...
T Consensus        84 ~~~~~~~~~~~~~~~i~~ss~  104 (286)
T 3ius_A           84 LGDQIAARAAQFRWVGYLSTT  104 (286)
T ss_dssp             HHHHHHHTGGGCSEEEEEEEG
T ss_pred             HHHHHHHHHCCCEEEEEECCC
T ss_conf             577777762584499993244


No 174
>>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grg_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grt_A* 1xan_A* 5grt_A* 2grt_A* 4grt_A* ... (A:186-247)
Probab=27.50  E-value=38  Score=14.21  Aligned_cols=58  Identities=10%  Similarity=0.059  Sum_probs=41.4

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCC
Q ss_conf             739999779803899999999789978999954866731038856787389999999999864954
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~   67 (281)
                      -+=.+|-|+|-.-.++|..+...|.++.++.-.+.   .++.++.     .--..+.+.|+++||+
T Consensus         2 pk~vvIiG~G~iG~E~A~~l~~~g~~Vtive~~~~---il~~~d~-----~~~~~~~~~l~~~GI~   59 (62)
T 3dk9_A            2 PGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDK---VLRSFDS-----MISTNCTEELENAGVE   59 (62)
T ss_dssp             CSEEEEECCSHHHHHHHHHHHHTTCEEEEECSSSS---SCTTSCH-----HHHHHHHHHHHHTTCE
T ss_pred             CCEEEEECCCCCCCEEEEEEEECCCCCCCEECCCC---CCCCCCC-----CCCHHHHHHHHCCCCE
T ss_conf             86699989963330220001201234431010221---1235421-----1102456654123210


No 175
>>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} (A:)
Probab=27.17  E-value=20  Score=16.17  Aligned_cols=66  Identities=9%  Similarity=-0.029  Sum_probs=35.9

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             73999977980389999999978997899995486673103885678738999999999986495406770
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      +-||-......=+..+.+.+.+.|++.+=+...+...     +.....+-..+.++.+.+++++++=..+.
T Consensus         2 ~~ig~~~~~~~~l~~~~~~~~~~G~~~iEl~~~~~~~-----~~~~~~~~~~~~~~~~~l~~~gl~~~~~~   67 (285)
T 1qtw_A            2 KYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQ-----WRAAPLTTQTIDEFKAACEKYHYTSAQIL   67 (285)
T ss_dssp             CEEEEECCCTTCHHHHHHHHHHTTCSEEECCSSCSSC-----SSCCCCCHHHHHHHHHHHHHTTCCGGGBC
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCC-----CCCCCCCHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             8479877654349999999997599999997999776-----78899999999999999998599852899


No 176
>>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} (A:1-342)
Probab=27.01  E-value=39  Score=14.15  Aligned_cols=175  Identities=11%  Similarity=0.066  Sum_probs=92.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---------CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             399997798038999999997899789999548667310---------38856787389999999999864954067702
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---------QDFECRELPLGDFCVLRSILHQYNIGRIVVAG   73 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---------~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG   73 (281)
                      |+-|..|.|-+=..+++.+...|++++++..........         ..+......+.+.......+...+++.|+-+.
T Consensus         2 kVlVTGatGfiG~~lv~~Ll~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~d~~~~~~~~~~~~~d~v~h~a   81 (342)
T 1kew_A            2 KILITGGAGFIGSAVVRHIIKNTQDTVVNIDKLTYAGNLESLSDISESNRYNFEHADICDSAEITRIFEQYQPDAVMHLA   81 (342)
T ss_dssp             EEEEESTTSHHHHHHHHHHHHHCSCEEEEEECCCTTCCGGGGTTTTTCTTEEEEECCTTCHHHHHHHHHHHCCSEEEECC
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCCCEEEECC
T ss_conf             69998888779999999999789968999847986443777876520688379986578989999999857999999897


Q ss_pred             CCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC------EEECH--HHCCHHHCC-C-------
Q ss_conf             4232100011102603578999999875104803589999999997697------48211--222524203-5-------
Q gi|254780768|r   74 AIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV------SVVGA--HEIVPELLV-Q-------  137 (281)
Q Consensus        74 ~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~------~vi~~--~~~l~~ll~-~-------  137 (281)
                      ... .+....-.+         .......-.|--++|.+..+.=.+.-+      .+...  .....+... +       
T Consensus        82 a~~-~~~~~~~~~---------~~~~~~Nv~gt~~ll~a~~~~~~~~~v~~ss~~~~~~~~~~~~~~~~~~~~~~~~~~~  151 (342)
T 1kew_A           82 AES-HVDRSITGP---------AAFIETNIVGTYALLEVARKYWSALGEDKKNNFRFHHISTDEVYGDLPHPDEVENSVT  151 (342)
T ss_dssp             SCC-CHHHHHHCT---------HHHHHHHTHHHHHHHHHHHHHHHTSCHHHHHHCEEEEEEEGGGGCCCCCGGGSCTTSC
T ss_pred             CCC-CHHHHHHCH---------HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCEEECCCCCCCCCCCCCC
T ss_conf             216-766677599---------9999999999999999999864543220368549999135234368888875444567


Q ss_pred             ---CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCC
Q ss_conf             ---43345546532347889989999997332672259998197488962534
Q gi|254780768|r  138 ---VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIE  187 (281)
Q Consensus       138 ---~G~l~~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~e  187 (281)
                         ........+...-...-..+..++...+..-.-+.++++-..+.+.....
T Consensus       152 ~~~~~~~~~~~~~~~y~~~k~~~e~~~~~~~~~~~~~~~~~r~~~~~g~~~~~  204 (342)
T 1kew_A          152 LPLFTETTAYAPSSPYSASKASSDHLVRAWRRTYGLPTIVTNCSNNYGPYHFP  204 (342)
T ss_dssp             CCCBCTTSCCCCCSHHHHHHHHHHHHHHHHHHHHCCCEEEEEECEEESTTCCT
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEECCCEECCCCCC
T ss_conf             88756688999999899999999999999999968989999138568929985


No 177
>>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} (A:1-207)
Probab=26.98  E-value=39  Score=14.15  Aligned_cols=76  Identities=18%  Similarity=0.002  Sum_probs=53.7

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC--------------CCCCEEEEEHHHHHHHHHHHHHCCC
Q ss_conf             97399997798038999999997899789999548667310--------------3885678738999999999986495
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--------------QDFECRELPLGDFCVLRSILHQYNI   66 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~--------------~~~~~~~~~ig~ig~li~~Lk~~~i   66 (281)
                      |+++-|..|+|-+-..+++.+..+|++++++.........-              .........+.+...+...++....
T Consensus        24 ~k~vlVTGatG~iG~~lv~~Ll~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  103 (207)
T 1t2a_A           24 RNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKP  103 (207)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEECCCSSCCCTTTGGGC---------CEEEEECCTTCHHHHHHHHHHHCC
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCHHHHCCCCEEEEEEECCCCCCCCCCHHCCCC
T ss_conf             98699970752899999999997849899997987555534488876464554247708998145774014211002464


Q ss_pred             CEEEEECCCC
Q ss_conf             4067702423
Q gi|254780768|r   67 GRIVVAGAID   76 (281)
Q Consensus        67 ~~ivmaG~V~   76 (281)
                      ..++.+....
T Consensus       104 ~~~~~~a~~~  113 (207)
T 1t2a_A          104 TEIYNLGAQS  113 (207)
T ss_dssp             SEEEECCSCC
T ss_pred             CCCCCCCCCC
T ss_conf             4222211035


No 178
>>1ulu_A Enoyl-acyl carrier protein reductase; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} (A:)
Probab=26.88  E-value=39  Score=14.14  Aligned_cols=184  Identities=10%  Similarity=-0.032  Sum_probs=90.0

Q ss_pred             CEEEEEECCCC---HHHHHHHHHHHCCCCEEEEEECCCCCCCC-----CCC-C-EEEEE---HHHHHH-HHHHHHHCCCC
Q ss_conf             73999977980---38999999997899789999548667310-----388-5-67873---899999-99999864954
Q gi|254780768|r    2 KRLLIIAGSGM---LPYYVAKAARLKNDEPVIASVLNECSFDW-----QDF-E-CRELP---LGDFCV-LRSILHQYNIG   67 (281)
Q Consensus         2 ~kigIIAG~G~---LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-----~~~-~-~~~~~---ig~ig~-li~~Lk~~~i~   67 (281)
                      +|.+||.|...   +=..+++.+.+.|.+++++..........     ... . .....   -.+... ........+-.
T Consensus         8 gK~~lVTGass~~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (261)
T 1ulu_A            8 GKKALVXGVTNQRSLGFAIAAKLKEAGAEVALSYQAERLRPEAEKLAEALGGALLFRADVTQDEELDALFAGVKEAFGGL   87 (261)
T ss_dssp             TCEEEEESCCCSSSHHHHHHHHHHHTTCEEEEEESSGGGHHHHHHHHHHTTCCEEEECCTTCHHHHHHHHHHHHHHHSSE
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99799979999864999999999987999999807477799999864025850210334699999999999999865997


Q ss_pred             EEEE--ECCC-CCCCCHHHHCCCHHHH---------HHHHHHHHH-H----------------------------HCCCC
Q ss_conf             0677--0242-3210001110260357---------899999987-5----------------------------10480
Q gi|254780768|r   68 RIVV--AGAI-DRRPNVQDLCFSIKDS---------LRISKMIWQ-L----------------------------VSGGN  106 (281)
Q Consensus        68 ~ivm--aG~V-~krP~~~~l~~D~~~~---------~~l~k~l~~-~----------------------------~~~gD  106 (281)
                      .+..  ++.. ...+.......+....         ....+.... .                            .+.+=
T Consensus        88 ~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~ii~~sS~~~~~~~~~~~~y~~sKaal  167 (261)
T 1ulu_A           88 DYLVHAIAFAPREAXEGRYIDTRRQDWLLALEVSAYSLVAVARRAEPLLREGGGIVTLTYYASEKVVPKYNVXAIAKAAL  167 (261)
T ss_dssp             EEEEECCCCCCHHHHSSCGGGCCHHHHHHHHHHHTHHHHHHHHHHTTTEEEEEEEEEEECGGGTSBCTTCHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCHHHCCCCCCCHHHHHHHHHH
T ss_conf             69996551245544332111100899999987679999999999999887489489954075376789843899999999


Q ss_pred             HHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHH--------------HHHHHHHHHHHHH-HHCCCCCEE
Q ss_conf             3589999999997697482112225242035433455465323--------------4788998999999-733267225
Q gi|254780768|r  107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRD--------------VKRDILAAMKSAE-ALSELDVGQ  171 (281)
Q Consensus       107 d~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~--------------~~~dI~~g~~i~~-~l~~~DiGQ  171 (281)
                      ..+.+.++.++...|+++-.   +.|.....+-......+.+.              .-+|+.-..-.+- .-+++=-||
T Consensus       168 ~~~~~~la~e~~~~gIrvN~---I~PG~v~T~~~~~~~~~~~~~~~~~~~~p~~r~~~peeva~~v~fL~s~~s~~itG~  244 (261)
T 1ulu_A          168 EASVRYLAYELGPKGVRVNA---ISAGPVRTVAARSIPGFTKXYDRVAQTAPLRRNITQEEVGNLGLFLLSPLASGITGE  244 (261)
T ss_dssp             HHHHHHHHHHHGGGTCEEEE---EEECCC----------CHHHHHHHHHHSTTSSCCCHHHHHHHHHHHHSGGGTTCCSC
T ss_pred             HHHHHHHHHHHCCCCEEEEE---EECCCEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCCC
T ss_conf             99999999984503908997---521305530223421357999999856998899599999999999828322791686


Q ss_pred             EEEEECCEEEEEECCCC
Q ss_conf             99981974889625342
Q gi|254780768|r  172 SAVSIGGRVVALEGIEG  188 (281)
Q Consensus       172 svVv~~g~ViaiEa~eG  188 (281)
                      .+.|.+|..+-=+++||
T Consensus       245 ~i~vDGG~~l~~~~~~~  261 (261)
T 1ulu_A          245 VVYVDAGYHIXGXELEG  261 (261)
T ss_dssp             EEEESTTGGGBC-----
T ss_pred             EEEECCCHHCCCCCCCC
T ss_conf             37878774613878889


No 179
>>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A (A:761-861)
Probab=26.50  E-value=13  Score=17.41  Aligned_cols=15  Identities=27%  Similarity=0.596  Sum_probs=9.4

Q ss_pred             CCCCHHHHHHHHHCC
Q ss_conf             662799999999849
Q gi|254780768|r  228 PSIGAKTVQNVIKAG  242 (281)
Q Consensus       228 P~IG~~Ti~~~~~ag  242 (281)
                      -+||++|++.++.||
T Consensus        40 ~aiG~~Ti~~iA~AG   54 (101)
T 2zuo_A           40 EALGPGTIRDLAVAG   54 (101)
T ss_dssp             HHSCTTHHHHTGGGC
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             976369999999866


No 180
>>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P)binding protein, rossmann fold; HET: NAP; 2.15A {Streptococcus pyogenes m1 gas} (A:1-167,A:240-259)
Probab=26.48  E-value=40  Score=14.09  Aligned_cols=39  Identities=23%  Similarity=0.229  Sum_probs=31.3

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             7399997798038999999997899789999548667310
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW   41 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~   41 (281)
                      .|||+| |.|+.=.-+++.+.++|+++++.....+....+
T Consensus         4 ~~IgiI-G~G~mG~ala~~L~~~G~~V~v~dr~~~~~~~l   42 (187)
T 2ahr_A            4 XKIGII-GVGKXASAIIKGLKQTPHELIISGSSLERSKEI   42 (187)
T ss_dssp             CEEEEE-CCSHHHHHHHHHHTTSSCEEEEECSSHHHHHHH
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHH
T ss_conf             899998-565999999999996998699978999999999


No 181
>>2p10_A MLL9387 protein; NP_085906.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti MAFF303099} (A:1-261)
Probab=26.47  E-value=38  Score=14.22  Aligned_cols=63  Identities=8%  Similarity=-0.079  Sum_probs=27.6

Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCE-----EEECCCCHHHHHH---HHHCCCEEEEEECCCEE
Q ss_conf             42179999999754312345667718999348887531-----2106627999999---99849909999739779
Q gi|254780768|r  187 EGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMR-----ADLPSIGAKTVQN---VIKAGLAGIALEAGKSL  254 (281)
Q Consensus       187 eGTD~mi~R~~~~~~~~~~~~~~~~ilvK~~K~~QD~r-----~DlP~IG~~Ti~~---~~~ag~~giaiea~~~l  254 (281)
                      .|.|+.++|+..+...|     -.++++-........+     ++.|+++..+-..   ........+.+..+..+
T Consensus       167 ~~~~eai~ra~a~~eAG-----Ad~i~~~~~~t~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ggp~  237 (261)
T 2p10_A          167 TPYVFSPEDAVAXAKAG-----ADILVCHXGLTTGGAIGARSGKSXDDCVSLINECIEAARTIRDDIIILSHGGPI  237 (261)
T ss_dssp             CCEECSHHHHHHHHHHT-----CSEEEEECSCC---------CCCHHHHHHHHHHHHHHHHHHCSCCEEEEESTTC
T ss_pred             CCCCCCHHHHHHHHHCC-----CCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             12248999999999719-----988996488666777466877898999999999999999729997799527887


No 182
>>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} (A:)
Probab=26.34  E-value=40  Score=14.07  Aligned_cols=74  Identities=14%  Similarity=0.152  Sum_probs=51.0

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC-------------------------------CCCEE----
Q ss_conf             3999977980389999999978997899995486673103-------------------------------88567----
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-------------------------------DFECR----   47 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-------------------------------~~~~~----   47 (281)
                      ||.|..|.|.+=..+++++.++|++++++...........                               .....    
T Consensus         6 ~IlVtGatG~iG~~i~~~Ll~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (308)
T 1qyc_A            6 RILLIGATGYIGRHVAKASLDLGHPTFLLVRESTASSNSEKAQLLESFKASGANIVHGSIDDHASLVEAVKNVDVVISTV   85 (308)
T ss_dssp             CEEEESTTSTTHHHHHHHHHHTTCCEEEECCCCCTTTTHHHHHHHHHHHTTTCEEECCCTTCHHHHHHHHHTCSEEEECC
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHHCCEEEEEC
T ss_conf             89998998289999999999787979999889755442667777776404880899722010266799875331222100


Q ss_pred             -EEEHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             -87389999999999864954067702423
Q gi|254780768|r   48 -ELPLGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus        48 -~~~ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                       .........+++..+..+++.+++.....
T Consensus        86 ~~~~~~~~~~~~~a~~~~~v~~~v~~s~~~  115 (308)
T 1qyc_A           86 GSLQIESQVNIIKAIKEVGTVKRFFPSEFG  115 (308)
T ss_dssp             CGGGSGGGHHHHHHHHHHCCCSEEECSCCS
T ss_pred             CCCCCCCCHHHHHHHHHHCCEEEEEEECCC
T ss_conf             012211112799999981980212320244


No 183
>>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: DNA; NMR {Homo sapiens} (A:)
Probab=26.29  E-value=31  Score=14.81  Aligned_cols=13  Identities=8%  Similarity=-0.164  Sum_probs=6.1

Q ss_pred             HHHHHHHHCCCCE
Q ss_conf             9999998649540
Q gi|254780768|r   56 VLRSILHQYNIGR   68 (281)
Q Consensus        56 ~li~~Lk~~~i~~   68 (281)
                      +....|+..|+..
T Consensus        36 ~~~~~L~~~Gi~T   48 (114)
T 1b22_A           36 NDVKKLEEAGFHT   48 (114)
T ss_dssp             HHHHHHHTTCCSS
T ss_pred             HHHHHHHHCCCCH
T ss_conf             9999999969853


No 184
>>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, disulphide bond, oxidoreductase; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus PY2} (A:193-312)
Probab=26.19  E-value=40  Score=14.06  Aligned_cols=56  Identities=4%  Similarity=-0.093  Sum_probs=39.8

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCC
Q ss_conf             9999779803899999999789978999954866731038856787389999999999864954
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~   67 (281)
                      =-+|.|+|..-.++|..+...|.+++++.....   .+..+..     .--..+.+.|++++|+
T Consensus        24 ~v~ViGgG~~g~E~A~~l~~~g~~Vtli~~~~~---~~~~~~~-----~~~~~~~~~l~~~gV~   79 (120)
T 1mo9_A           24 TVVVVGGSKTAVEYGCFFNATGRRTVMLVRTEP---LKLIKDN-----ETRAYVLDRMKEQGME   79 (120)
T ss_dssp             EEEEECCSHHHHHHHHHHHHTTCEEEEECSSCT---TTTCCSH-----HHHHHHHHHHHHTTCE
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCCHHHHH---HHHCCCC-----HHHHHHHHHHCCCCEE
T ss_conf             899988867677789876533753111012445---4320010-----0234443200012137


No 185
>>2opt_A Actii protein; helical protein, TETR family, APO-protein, transcriptional repressor; 2.05A {Streptomyces coelicolor} PDB: 3b6a_A* 3b6c_A* (A:1-67)
Probab=26.07  E-value=22  Score=15.90  Aligned_cols=49  Identities=24%  Similarity=0.325  Sum_probs=43.0

Q ss_pred             CCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             8035899999999976974821122252420354334554653234788
Q gi|254780768|r  105 GNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       105 gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      --+.|+.+-.+.|.++||.=++..++....=+++|.+...-|++++.-.
T Consensus         7 ~r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~~~Y~~F~~k~~L~~   55 (67)
T 2opt_A            7 TQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLD   55 (67)
T ss_dssp             CHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTCCHHHHHHHHCSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHH
T ss_conf             3999999999999972945257999999979298799998799999999


No 186
>>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* (A:1-40,A:148-221,A:327-383)
Probab=25.97  E-value=41  Score=14.03  Aligned_cols=34  Identities=21%  Similarity=0.201  Sum_probs=26.1

Q ss_pred             CCEE-EEEECCCCHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9739-999779803899999999789978999954
Q gi|254780768|r    1 MKRL-LIIAGSGMLPYYVAKAARLKNDEPVIASVL   34 (281)
Q Consensus         1 M~ki-gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~   34 (281)
                      |++- .+|-|+|.-=...|..|.++|+++.++.-.
T Consensus         1 m~~~~v~iiG~G~~g~~~a~~la~~g~~v~v~e~~   35 (171)
T 2qcu_A            1 METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQ   35 (171)
T ss_dssp             --CBSEEEECCSHHHHHHHHHHHHTTCCEEEECSS
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             98279899996799999999999789979999699


No 187
>>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} (A:)
Probab=25.82  E-value=41  Score=14.01  Aligned_cols=75  Identities=13%  Similarity=0.108  Sum_probs=50.5

Q ss_pred             CEEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCCCCC-----CCCCC--CE--EEE---EHHHHHHHHHHHHHC--CC
Q ss_conf             73999977980-389999999978997899995486673-----10388--56--787---389999999999864--95
Q gi|254780768|r    2 KRLLIIAGSGM-LPYYVAKAARLKNDEPVIASVLNECSF-----DWQDF--EC--REL---PLGDFCVLRSILHQY--NI   66 (281)
Q Consensus         2 ~kigIIAG~G~-LP~~ia~~~~~~g~~~~ii~l~~~~~~-----~~~~~--~~--~~~---~ig~ig~li~~Lk~~--~i   66 (281)
                      +|++||-|.+. +=..+++.+-+.|.+++++....+...     .....  ..  ...   +..++..++....++  .+
T Consensus         7 gkv~lVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~i~~l~~~~~~~~g~i   86 (261)
T 1gee_A            7 GKVVVITGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGEAIAVKGDVTVESDVINLVQSAIKEFGKL   86 (261)
T ss_dssp             TCEEEETTCSSHHHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHHHHHTTCEEEEEECCTTSHHHHHHHHHHHHHHHSCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             89899948872999999999998799899997975789999999987328833443153564788779999999966997


Q ss_pred             CEEEEECCCC
Q ss_conf             4067702423
Q gi|254780768|r   67 GRIVVAGAID   76 (281)
Q Consensus        67 ~~ivmaG~V~   76 (281)
                      +-+|..-.+.
T Consensus        87 d~lv~~ag~~   96 (261)
T 1gee_A           87 DVMINNAGLE   96 (261)
T ss_dssp             CEEEECCCCC
T ss_pred             CEEEECCCCC
T ss_conf             3999899777


No 188
>>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} (A:1-232)
Probab=25.63  E-value=41  Score=13.99  Aligned_cols=118  Identities=10%  Similarity=-0.039  Sum_probs=65.3

Q ss_pred             CCEEE-EEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCC---CCC------CCCEEEEEH-----HHHHHHHHHHHHCC
Q ss_conf             97399-9977980389999999978997899995486673---103------885678738-----99999999998649
Q gi|254780768|r    1 MKRLL-IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF---DWQ------DFECRELPL-----GDFCVLRSILHQYN   65 (281)
Q Consensus         1 M~kig-IIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~---~~~------~~~~~~~~i-----g~ig~li~~Lk~~~   65 (281)
                      |+|+. ++.|+|++-..+.+.+..++.++.++........   ...      +..+.....     ..-..+.+.|++.+
T Consensus        20 ~~~~~i~~~G~~~~~~~~l~~l~~~~~~~~~v~~~~~~~~~~~~~~~~a~~~~i~~~~~~~~~~~~~~~~~~~~~l~~~~   99 (232)
T 2bw0_A           20 FQSMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVVAKYQALG   99 (232)
T ss_dssp             -CCCEEEEECCHHHHHHHHHHHHHTTCEEEEEEECCCCSSCCCHHHHHHHHHTCCEEECSCCEETTEECHHHHHHHHTTC
T ss_pred             HHCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHCCCCEECCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             54328999889799999999999889978999928998989897999999839988764336870014899999998609


Q ss_pred             CCEEEEECCCCC--CCCHHHHC---CCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEE
Q ss_conf             540677024232--10001110---2603578999999875104803589999999997697482
Q gi|254780768|r   66 IGRIVVAGAIDR--RPNVQDLC---FSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV  125 (281)
Q Consensus        66 i~~ivmaG~V~k--rP~~~~l~---~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi  125 (281)
                      ++-++.++.-..  .+.++..+   +-+.+     .+|-  ..+|-+.+-.++.+--++-|.++.
T Consensus       100 ~D~~v~~~~~~ii~~~~l~~~~~~~iN~Hp-----slLP--~yRG~~p~~wai~nge~~~GvTiH  157 (232)
T 2bw0_A          100 AELNVLPFCSQFIPMEIISAPRHGSIIYHP-----SLLP--RHRGASAINWTLIHGDKKGGFSIF  157 (232)
T ss_dssp             CSEEEESSCSSCCCHHHHTCSTTCEEEEES-----SCTT--TTBSSCHHHHHHHTTCSEEEEEEE
T ss_pred             CCCCHHHHHHHCCCEEEECCCCCHHHHCCC-----CHHH--CCCCCCEEEEEEEEECCCCCCEEE
T ss_conf             973112332212331330001785876778-----7254--378864020010310145573455


No 189
>>1pbj_A Hypothetical protein; structural genomics, CBS domain, PSI, protein structure initiative; 1.40A {Methanothermobacterthermautotrophicus str} (A:68-125)
Probab=25.57  E-value=42  Score=13.98  Aligned_cols=34  Identities=15%  Similarity=0.101  Sum_probs=25.4

Q ss_pred             HHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHH
Q ss_conf             99997332672259998197488962534217999999
Q gi|254780768|r  159 KSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRI  196 (281)
Q Consensus       159 ~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~  196 (281)
                      ++++.+...+++.-.|+.+|+++++    =|..=+.|+
T Consensus        19 ea~~lm~~~~i~~lpVvd~~~lvGi----iT~~Di~~~   52 (58)
T 1pbj_A           19 EAAEKXVKNVVWRLLVEEDDEIIGV----ISATDILRA   52 (58)
T ss_dssp             HHHHHHHHHTCSEEEEEETTEEEEE----EEHHHHHHH
T ss_pred             HHHHHHHHCCCCEEEEEECCEEEEE----EEHHHHHHH
T ss_conf             9999999869929999989999999----999999873


No 190
>>2zb9_A Putative transcriptional regulator; transcription regulator, TETR family, helix-turn-helix, DNA- binding, transcription regulation; 2.25A {Streptomyces coelicolor} (A:1-85)
Probab=25.45  E-value=42  Score=13.97  Aligned_cols=50  Identities=18%  Similarity=0.060  Sum_probs=43.5

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             03589999999997697482112225242035433455465323478899
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDIL  155 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~  155 (281)
                      -+.|+.+....|.+.|+.-++..++....=++++-+...-+++++.-.-.
T Consensus        25 r~~i~~aa~~l~~~~G~~~~ti~~Ia~~agvs~~t~Y~~F~~K~~L~~~~   74 (85)
T 2zb9_A           25 RAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWWPSKGALALDG   74 (85)
T ss_dssp             HHHHHHHHHHHHHHHCGGGCCHHHHHHHHCCCHHHHHHHCSSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHHHCCHHHHHHHH
T ss_conf             99999999999998592406899999985636484127209899999999


No 191
>>2a9g_A Arginine deiminase; arginine degradation pathway, catalytic mechanism, hydrolase; HET: ARG; 2.30A {Pseudomonas aeruginosa} (A:219-400)
Probab=25.45  E-value=42  Score=13.97  Aligned_cols=39  Identities=21%  Similarity=0.218  Sum_probs=29.6

Q ss_pred             CCCEEEEEECCCEEEEC-HHHHHHHHHHCCCEEEEECHHH
Q ss_conf             49909999739779985-8999999998796899957754
Q gi|254780768|r  241 AGLAGIALEAGKSLVLE-KELVKKHADEAGIFVCGIDREF  279 (281)
Q Consensus       241 ag~~giaiea~~~lild-~~~~i~~a~~~~i~i~g~~~~~  279 (281)
                      .+++++++..+.+++.+ -+++.+..+++|+-++-++.++
T Consensus       139 ~~~N~l~i~p~~Vi~~~~~~~~~~~L~~~G~~vi~v~~~e  178 (182)
T 2a9g_A          139 DGNNVVCLEPGVVVGYDRNTYTNTLLRKAGVEVITISASE  178 (182)
T ss_dssp             CCCCCEEEETTEEEEETTCHHHHHHHHHTTCEEEEECHHH
T ss_pred             CCCEEEEECCCEEEEECCCHHHHHHHHHCCCEEEEECHHH
T ss_conf             6311899659989982898999999997899899947366


No 192
>>3bmj_A Pteridine reductase; PTR1, short chain dehydrogenase, inhibitor, oxidoreductase; HET: NAP DX7; 1.60A {Trypanosoma brucei brucei} PDB: 3bmc_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmd_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3jq6_A* 3jq7_A* 3jq8_A* 3jq9_A* 3jqa_A* 3jqb_A* ... (A:)
Probab=25.28  E-value=42  Score=13.95  Aligned_cols=81  Identities=5%  Similarity=-0.184  Sum_probs=47.7

Q ss_pred             CEEEEEECCC-CHHHHHHHHHHHCCCCEEEEEECCCCCCC----C-----CCCCEEEEEH---HHHHHHHHHHHHC--CC
Q ss_conf             7399997798-03899999999789978999954866731----0-----3885678738---9999999999864--95
Q gi|254780768|r    2 KRLLIIAGSG-MLPYYVAKAARLKNDEPVIASVLNECSFD----W-----QDFECRELPL---GDFCVLRSILHQY--NI   66 (281)
Q Consensus         2 ~kigIIAG~G-~LP~~ia~~~~~~g~~~~ii~l~~~~~~~----~-----~~~~~~~~~i---g~ig~li~~Lk~~--~i   66 (281)
                      +|.+||.|.+ -+=..+|+++-++|.+++++....+.-..    +     ........++   .++..++....++  .+
T Consensus        23 gKvalVTGas~GIG~aiA~~la~~Ga~V~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~g~i  102 (288)
T 3bmj_A           23 APAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFR  102 (288)
T ss_dssp             CCEEEETTCSSHHHHHHHHHHHHHTCEEEEEESSCHHHHHHHHHHHHHHSTTCEEEEECCCSCSTTHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             99899948788899999999998799899996980789999999999853984699983255456579999999999999


Q ss_pred             CEEEEECCCCCCCCHH
Q ss_conf             4067702423210001
Q gi|254780768|r   67 GRIVVAGAIDRRPNVQ   82 (281)
Q Consensus        67 ~~ivmaG~V~krP~~~   82 (281)
                      +-+|-...+.....+.
T Consensus       103 dilvnnAg~~~~~~~~  118 (288)
T 3bmj_A          103 AFGRCDVLVNNASAFY  118 (288)
T ss_dssp             HHSCCCEEEECCCCCC
T ss_pred             HHCCCCEEEECCCCCC
T ss_conf             8199749998885577


No 193
>>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} (A:1-277)
Probab=25.13  E-value=42  Score=13.93  Aligned_cols=56  Identities=20%  Similarity=0.214  Sum_probs=44.5

Q ss_pred             CCCCCEEEECCCCHHHHHHHHHCCCEEEEEECCCE---EEECHHHHHHHHHHCCCEEEE
Q ss_conf             88753121066279999999984990999973977---998589999999987968999
Q gi|254780768|r  219 SQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKS---LVLEKELVKKHADEAGIFVCG  274 (281)
Q Consensus       219 ~~QD~r~DlP~IG~~Ti~~~~~ag~~giaiea~~~---lild~~~~i~~a~~~~i~i~g  274 (281)
                      ..-+...|-..+-++.++.....+-+.|.++.-..   .+.|-+++.++|+++|+.++-
T Consensus       117 ~~~~~~~~~~~~d~~~l~~~i~~~t~~i~i~~~~~~~g~~~di~~i~~~a~~~g~~liv  175 (277)
T 2cb1_A          117 SLMGVTVRYVDPEPEAVREALSAKTRAVFVETVANPALLVPDLEALATLAEEAGVALVV  175 (277)
T ss_dssp             TTTTCEEEEECSSHHHHHHHCCTTEEEEEEESSCTTTCCCCCHHHHHHHHHHHTCEEEE
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             43343231148999999987544863999987886444444188887777760555145


No 194
>>1yx1_A Hypothetical protein PA2260; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.80A {Pseudomonas aeruginosa PAO1} (A:)
Probab=24.83  E-value=43  Score=13.89  Aligned_cols=208  Identities=12%  Similarity=-0.062  Sum_probs=94.9

Q ss_pred             CCEEEEEECC-CC-----HH-HHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             9739999779-80-----38-99999999789978999954866731038856787389999999999864954067702
Q gi|254780768|r    1 MKRLLIIAGS-GM-----LP-YYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAG   73 (281)
Q Consensus         1 M~kigIIAG~-G~-----LP-~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG   73 (281)
                      |.|+|+-... +.     +| ....+.++..|++.+=+......+..            ...++.+.+.+.|+.=..+.+
T Consensus         5 ~~k~gi~~~~~~~~~~~~~~~~~~~~~~~~~G~~~iEl~~~~~~~~~------------~~~~~~~~~~~~gl~~~~~~~   72 (264)
T 1yx1_A            5 LHPVSISLSSYGADLVRSRGQASFLPLLAXAGAQRVELREELFAGPP------------DTEALTAAIQLQGLECVFSSP   72 (264)
T ss_dssp             CCCEEEEGGGGCHHHHHHHCGGGGHHHHHHHTCSEEEEEGGGCSSCC------------CHHHHHHHHHHTTCEEEEEEE
T ss_pred             CCCEEEEEEECCCHHHHHCCHHHHHHHHHHHCCCEEEEECCCCCCCC------------HHHHHHHHHHHCCCEEEEECC
T ss_conf             79879982215632544347999999999829998999322377800------------199999999985995999635


Q ss_pred             CCCCCCCHHHHCCC-HHHHHHHHHHHHH------HHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCC
Q ss_conf             42321000111026-0357899999987------5104803589999999997697482112225242035433455465
Q gi|254780768|r   74 AIDRRPNVQDLCFS-IKDSLRISKMIWQ------LVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVP  146 (281)
Q Consensus        74 ~V~krP~~~~l~~D-~~~~~~l~k~l~~------~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p  146 (281)
                      ...  |....-..+ ++....+.+.+..      ........-|+.+.++.++.|+++.= +..             ...
T Consensus        73 ~~~--~~~~~~~~~~~~~~i~~a~~lg~~~i~~~~~~~~~~~~l~~l~~~a~~~Gv~l~i-E~~-------------~~~  136 (264)
T 1yx1_A           73 LEL--WREDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPDLAALGRRLARHGLQLLV-END-------------QTP  136 (264)
T ss_dssp             EEE--ECTTSSBCTTHHHHHHHHHHTTCSEEEEEEECCCSSCCHHHHHHHHTTSSCEEEE-ECC-------------SSH
T ss_pred             CCC--CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHCCCEEEE-EEC-------------CCC
T ss_conf             223--3577313799999999999749898998669741013289999999853988999-848-------------983


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCEEE
Q ss_conf             32347889989999997332672259998197488962534217999999975431234566771899934888753121
Q gi|254780768|r  147 NRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRAD  226 (281)
Q Consensus       147 ~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~~~~~~~~~~~~~ilvK~~K~~QD~r~D  226 (281)
                      .... .+-..-...+.....-.+|-+.=+.+-..    .-+--.+++++.+....         -+-+|-...+-+.+.=
T Consensus       137 ~~~~-~~~~~~~~~~~~~~~~~lg~~~D~~H~~~----~~~~~~~~~~~~~~~i~---------~vh~~d~~~~~~~~~~  202 (264)
T 1yx1_A          137 QGGR-IEVLERFFRLAERQQLDLAXTFDIGNWRW----QEQAADEAALRLGRYVG---------YVHCKAVIRNRDGKLV  202 (264)
T ss_dssp             HHHC-HHHHHHHHHHHHHTTCSEEEEEETTGGGG----GTCCHHHHHHHHGGGEE---------EEEECEEEECTTSCEE
T ss_pred             CCCC-HHHHHHHHHHHHCCCCCEEEEECCHHHHH----CCCCHHHHHHHHHCEEE---------EEEECCCCCCCCCCCC
T ss_conf             7688-88999999985368984699944522543----59999999998532088---------8774036767777503


Q ss_pred             ECCCC---H-HHHHHHHHCCCEEEE-EEC
Q ss_conf             06627---9-999999984990999-973
Q gi|254780768|r  227 LPSIG---A-KTVQNVIKAGLAGIA-LEA  250 (281)
Q Consensus       227 lP~IG---~-~Ti~~~~~ag~~gia-iea  250 (281)
                      .|--|   . .-++.+.+.|+.|-. +|-
T Consensus       203 ~~g~G~id~~~~~~~L~~~g~~g~~~~E~  231 (264)
T 1yx1_A          203 AVPPSAADLQYWQRLLQHFPEGVARAIEY  231 (264)
T ss_dssp             EECCCHHHHHHHHHHHTTSCTTCEEEECS
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCCEEEEEE
T ss_conf             78899889899999999579996089993


No 195
>>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} (A:)
Probab=24.43  E-value=44  Score=13.84  Aligned_cols=40  Identities=10%  Similarity=0.096  Sum_probs=31.7

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC
Q ss_conf             73999977980389999999978997899995486673103
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ   42 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~   42 (281)
                      .|||+| |.|..=..+|+.+.++|+++.+..........+.
T Consensus        20 ~kI~VI-G~G~mG~alA~~L~~~G~~V~v~~r~~~~~~~l~   59 (209)
T 2raf_A           20 XEITIF-GKGNXGQAIGHNFEIAGHEVTYYGSKDQATTLGE   59 (209)
T ss_dssp             CEEEEE-CCSHHHHHHHHHHHHTTCEEEEECTTCCCSSCCS
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHH
T ss_conf             889998-9729999999999986993798548747766531


No 196
>>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier- protein) reductase, NAD; HET: NAD; 1.80A {Anaplasma phagocytophilum HZ} PDB: 3k2e_A* (A:)
Probab=24.36  E-value=44  Score=13.83  Aligned_cols=36  Identities=19%  Similarity=0.207  Sum_probs=31.2

Q ss_pred             CEEEEEECCCC---HHHHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             73999977980---3899999999789978999954866
Q gi|254780768|r    2 KRLLIIAGSGM---LPYYVAKAARLKNDEPVIASVLNEC   37 (281)
Q Consensus         2 ~kigIIAG~G~---LP~~ia~~~~~~g~~~~ii~l~~~~   37 (281)
                      +|.++|.|.+.   +=..+++.+-++|.+++++......
T Consensus        30 gk~vlITGassG~~IG~aiA~~la~~Ga~V~i~~r~~~~   68 (296)
T 3k31_A           30 GKKGVIIGVANDKSLAWGIAKAVCAQGAEVALTYLSETF   68 (296)
T ss_dssp             TCEEEEECCCSTTSHHHHHHHHHHHTTCEEEEEESSGGG
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             998999899998669999999999869999999588789


No 197
>>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* (A:)
Probab=23.75  E-value=45  Score=13.76  Aligned_cols=71  Identities=14%  Similarity=-0.043  Sum_probs=37.8

Q ss_pred             CCEEEEEECCCCHHH----HHHHHHHHCCCCE-EEEEECCCCC-CCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             973999977980389----9999999789978-9999548667-310388567873899999999998649540677
Q gi|254780768|r    1 MKRLLIIAGSGMLPY----YVAKAARLKNDEP-VIASVLNECS-FDWQDFECRELPLGDFCVLRSILHQYNIGRIVV   71 (281)
Q Consensus         1 M~kigIIAG~G~LP~----~ia~~~~~~g~~~-~ii~l~~~~~-~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivm   71 (281)
                      |+|+|+..|+=+=|.    .+++.+.+...+. +.+....... +...+......++..+...++.+...++..+..
T Consensus         1 Mkki~v~~GsFdP~H~GH~~li~~a~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~~~v~~~~~   77 (189)
T 2h29_A            1 MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFGDICDDEI   77 (189)
T ss_dssp             CEEEEEEEECCTTCCHHHHHHHHHHHHHHCCSEEEEEECSBCTTSCCCSSCCCHHHHHHHHHHHHHHTCCEECCHHH
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEECHHH
T ss_conf             98699964276727799999999999982999699998336775223540148788778886410024320100211


No 198
>>2fq4_A Transcriptional regulator, TETR family; DNA-binding protein, structural genomics, PSI, protein structure initiative; 1.79A {Bacillus cereus atcc 14579} (A:1-73)
Probab=23.75  E-value=26  Score=15.37  Aligned_cols=48  Identities=27%  Similarity=0.292  Sum_probs=42.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      -+.||.+..+.|.++|+.=++..+++...=+++|-+...=+++++.-.
T Consensus        14 r~~Il~aa~~l~~~~G~~~~t~~~Ia~~agvs~~~~Y~~F~~ke~L~~   61 (73)
T 2fq4_A           14 QKAILSASYELLLESGFKAVTVDKIAERAKVSKATIYKWWPNKAAVVX   61 (73)
T ss_dssp             HHHHHHHHHHHHHHHCTTTCCHHHHHHHHTCCHHHHHHHCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHCCCCHHHHHH
T ss_conf             999999999999984924077999999969288775103799999999


No 199
>>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} (A:)
Probab=23.70  E-value=45  Score=13.75  Aligned_cols=164  Identities=10%  Similarity=0.081  Sum_probs=86.3

Q ss_pred             CEEEEEEC-CCCHHHHHHHHHHHCCCCEEEEEECCCCCCC----C--CCCCEEE--E---EHHHHHHHHHHHHHC--CCC
Q ss_conf             73999977-9803899999999789978999954866731----0--3885678--7---389999999999864--954
Q gi|254780768|r    2 KRLLIIAG-SGMLPYYVAKAARLKNDEPVIASVLNECSFD----W--QDFECRE--L---PLGDFCVLRSILHQY--NIG   67 (281)
Q Consensus         2 ~kigIIAG-~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~----~--~~~~~~~--~---~ig~ig~li~~Lk~~--~i~   67 (281)
                      +|.+||.| ++.+=..+++.+...|..+++++...+....    .  .......  .   +-.++..+++.+.++  .++
T Consensus        11 gK~vlITGas~GIG~aia~~l~~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~g~iD   90 (255)
T 1fmc_A           11 GKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVD   90 (255)
T ss_dssp             TCEEEETTTTSHHHHHHHHHHHTTTCEEEEEESCHHHHHHHHHHHHHTTCCEEEEECCTTCHHHHHHHHHHHHHHHSSCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCCCC
T ss_conf             99999938888899999999998799899997988999889999741588079998413335777778999999669987


Q ss_pred             EEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC-EEECHHHCCHHHCCCCCCCCCCCC
Q ss_conf             0677024232100011102603578999999875104803589999999997697-482112225242035433455465
Q gi|254780768|r   68 RIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV-SVVGAHEIVPELLVQVGSLGTCVP  146 (281)
Q Consensus        68 ~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~-~vi~~~~~l~~ll~~~G~l~~~~p  146 (281)
                      -+|-.-++. .|...+.  +..   ...+. +...-.+--.+.+.++..+.+++. .++......... ..++ ......
T Consensus        91 ~lv~naG~~-~~~~~~~--s~~---~~~~~-~~vNl~~~~~~~k~~~~~l~~~~~~~Ii~~ss~~~~~-~~~~-~~~y~~  161 (255)
T 1fmc_A           91 ILVNNAGGG-GPKPFDM--PMA---DFRRA-YELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAEN-KNIN-MTSYAS  161 (255)
T ss_dssp             EEEECCCCC-CCCCTTC--CHH---HHHHH-HHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTC-CCTT-CHHHHH
T ss_pred             EEEECCCCC-CCCCCCC--CHH---HHHHH-HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCC-CCCC-HHHHHH
T ss_conf             898767678-9985649--999---99999-9998599999999999999985998655201223214-5752-067799


Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
Q ss_conf             323478899899999973326722599981
Q gi|254780768|r  147 NRDVKRDILAAMKSAEALSELDVGQSAVSI  176 (281)
Q Consensus       147 ~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~  176 (281)
                      ++.  .-+.+...++.++++..|-=.+|.-
T Consensus       162 sK~--al~~l~k~lA~el~~~gI~vN~I~P  189 (255)
T 1fmc_A          162 SKA--AASHLVRNMAFDLGEKNIRVNGIAP  189 (255)
T ss_dssp             HHH--HHHHHHHHHHHHHHTTTEEEEEEEE
T ss_pred             HHH--HHHHHHHHHHHHHHHHCCEEEEECC
T ss_conf             999--9999999999995255848984277


No 200
>>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} (A:)
Probab=23.47  E-value=45  Score=13.72  Aligned_cols=37  Identities=14%  Similarity=0.119  Sum_probs=31.5

Q ss_pred             CEEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             73999977980-38999999997899789999548667
Q gi|254780768|r    2 KRLLIIAGSGM-LPYYVAKAARLKNDEPVIASVLNECS   38 (281)
Q Consensus         2 ~kigIIAG~G~-LP~~ia~~~~~~g~~~~ii~l~~~~~   38 (281)
                      +|.+||.|.+. +=..+|+.+...|.+++++....+..
T Consensus        27 gK~~lVTGas~GIG~aiA~~la~~Ga~Vi~~~r~~~~~   64 (260)
T 3gem_A           27 SAPILITGASQRVGLHCALRLLEHGHRVIISYRTEHAS   64 (260)
T ss_dssp             CCCEEESSTTSHHHHHHHHHHHHTTCCEEEEESSCCHH
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             99499977977899999999998899899997984899


No 201
>>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} (A:)
Probab=23.41  E-value=46  Score=13.71  Aligned_cols=81  Identities=10%  Similarity=0.045  Sum_probs=56.0

Q ss_pred             CEEEEEECCCC---HHHHHHHHHHHCCCCEEEEEECCCCCCCC-----C--CCCEEEE---EHHHHHHHHHHHHHC--CC
Q ss_conf             73999977980---38999999997899789999548667310-----3--8856787---389999999999864--95
Q gi|254780768|r    2 KRLLIIAGSGM---LPYYVAKAARLKNDEPVIASVLNECSFDW-----Q--DFECREL---PLGDFCVLRSILHQY--NI   66 (281)
Q Consensus         2 ~kigIIAG~G~---LP~~ia~~~~~~g~~~~ii~l~~~~~~~~-----~--~~~~~~~---~ig~ig~li~~Lk~~--~i   66 (281)
                      +|.+||-|.+.   +=..+|+.+.+.|..++++....+.....     .  +......   +-.++.++++...++  ++
T Consensus         9 gK~vlITGas~~~GIG~aiA~~la~~G~~Vv~~~r~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~v~~~~~~~~~~~g~i   88 (265)
T 1qsg_A            9 GKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKF   88 (265)
T ss_dssp             TCEEEECCCCSTTSHHHHHHHHHHHTTCEEEEEESSTTTHHHHHHHHHHTTCCCEEECCTTCHHHHHHHHHHHHTTCSSE
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99799989998501899999999986999999958878999999998626971799821322478999999998743777


Q ss_pred             CEEEEECCCCCCCCHH
Q ss_conf             4067702423210001
Q gi|254780768|r   67 GRIVVAGAIDRRPNVQ   82 (281)
Q Consensus        67 ~~ivmaG~V~krP~~~   82 (281)
                      +-+|-.-.+.....+.
T Consensus        89 D~lVnnAg~~~~~~~~  104 (265)
T 1qsg_A           89 DGFVHSIGFAPGDQLD  104 (265)
T ss_dssp             EEEEECCCCCCGGGGS
T ss_pred             CEEEEEEHHHCCCCCC
T ss_conf             6467730000122211


No 202
>>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genomics, NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus VF5} PDB: 2z95_A* (A:1-178)
Probab=23.27  E-value=46  Score=13.70  Aligned_cols=75  Identities=21%  Similarity=0.151  Sum_probs=56.5

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCC--------CCCEEEEEHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             73999977980389999999978997899995486673103--------8856787389999999999864954067702
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--------DFECRELPLGDFCVLRSILHQYNIGRIVVAG   73 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~--------~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG   73 (281)
                      +++-|..|+|-+=..+++.+.+.|++++++...........        ........+.+.......+...+...++..-
T Consensus         4 k~vlVTGatG~iG~~l~~~L~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~a   83 (178)
T 2z1m_A            4 KRALITGIRGQDGAYLAKLLLEKGYEVYGADRRSGEFASWRLKELGIENDVKIIHMDLLEFSNIIRTIEKVQPDEVYNLA   83 (178)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTTCEEEEECSCCSTTTTHHHHHTTCTTTEEECCCCTTCHHHHHHHHHHHCCSEEEECC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHCCCCCEEEECC
T ss_conf             98999788868999999999978398999979997643566887431589779991367857612334036983775224


Q ss_pred             CCC
Q ss_conf             423
Q gi|254780768|r   74 AID   76 (281)
Q Consensus        74 ~V~   76 (281)
                      ...
T Consensus        84 ~~~   86 (178)
T 2z1m_A           84 AQS   86 (178)
T ss_dssp             CCC
T ss_pred             CCC
T ss_conf             446


No 203
>>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii OT3} (A:127-274)
Probab=23.21  E-value=46  Score=13.69  Aligned_cols=111  Identities=14%  Similarity=0.075  Sum_probs=64.3

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCE-EEEEECCCCCCCCCCC----------CEE---EEEHHHHHHHHHHHHHCCCC
Q ss_conf             739999779803899999999789978-9999548667310388----------567---87389999999999864954
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEP-VIASVLNECSFDWQDF----------ECR---ELPLGDFCVLRSILHQYNIG   67 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~-~ii~l~~~~~~~~~~~----------~~~---~~~ig~ig~li~~Lk~~~i~   67 (281)
                      .++|||+-+|.+-..++..+..+|..+ +++..-++++..+.++          ...   .-.+++-.+.+...++...+
T Consensus        24 G~vaiiSqSG~~~~~i~~~~~~~g~g~s~~vs~Gn~~~~~~~D~l~~~~~Dp~t~~i~l~~E~~~~~~~~~~~a~~~~~~  103 (148)
T 2csu_A           24 GNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNXADVDFAELXEYLADTEEDKAIALYIEGVRNGKKFXEVAKRVTKK  103 (148)
T ss_dssp             CSEEEEESCHHHHHHHHHHHHHTTCEESEEEECTTCCSSCHHHHHHHHTTCSSCCEEEEEESCCSCHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             86799966744899999999862368518982488578888999999736787627999964775589999999988722


Q ss_pred             EEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEEC
Q ss_conf             06770242321000111026035789999998751048035899999999976974821
Q gi|254780768|r   68 RIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVG  126 (281)
Q Consensus        68 ~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~  126 (281)
                      +=|.+=+.-+.+.-...        .....  . .--|||....   ..|++.|+-+++
T Consensus       104 KPVv~~k~Grs~~~~~a--------a~sHt--g-alag~~~~~~---a~~r~aGv~~vd  148 (148)
T 2csu_A          104 KPIIALKAGKSESGARA--------ASSHT--G-SLAGSWKIYE---AAFKQSGVLVAN  148 (148)
T ss_dssp             SCEEEEECC-----------------------------CHHHHH---HHHHHTTCEEES
T ss_pred             CCEEEEEECCCCCCCCC--------CCCCC--C-CCCCCHHHHH---HHHHHHCCCEEC
T ss_conf             88289981365755332--------34555--6-6677089999---999851703513


No 204
>>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* (A:159-278)
Probab=23.12  E-value=46  Score=13.68  Aligned_cols=57  Identities=9%  Similarity=0.121  Sum_probs=39.8

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             9997798038999999997899789999548667310388567873899999999998649540
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      .+|-|+|..-..+|..+...|.++.++...+..-.  ..+.     -.-...+.+.|++++|+-
T Consensus        23 v~VvGgG~iG~e~A~~l~~~G~~Vtli~~~~~~~~--~~~~-----~~~~~~l~~~l~~~gV~~   79 (120)
T 1zmd_A           23 MVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGG--VGID-----MEISKNFQRILQKQGFKF   79 (120)
T ss_dssp             EEEECCSHHHHHHHHHHHHTTCEEEEECSSSSSSC--SSCC-----HHHHHHHHHHHHHTTCEE
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCHHEEEECCHHHC--CCCH-----HHHHHHHHHHHHHCCCCC
T ss_conf             99999689999999999863531010343321101--3336-----999999999999759964


No 205
>>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* (D:)
Probab=23.11  E-value=46  Score=13.68  Aligned_cols=75  Identities=7%  Similarity=-0.086  Sum_probs=46.8

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC----------CCCCEEEEEHHHHHHHHHHHHHCCCCEEE
Q ss_conf             97399997798038999999997899789999548667310----------38856787389999999999864954067
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----------QDFECRELPLGDFCVLRSILHQYNIGRIV   70 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----------~~~~~~~~~ig~ig~li~~Lk~~~i~~iv   70 (281)
                      |+++-|..|.|-+=..+++++.++|++++++..........          ........++.+...+.+.++.....-++
T Consensus         5 ~~~VLITGatGfiG~~lv~~Ll~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dl~d~~~l~~~~~~~~~~~vi   84 (337)
T 2c29_D            5 SETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTGVFHV   84 (337)
T ss_dssp             -CEEEETTTTSHHHHHHHHHHHHTTCEEEEEESCTTCHHHHHHHHTSTTHHHHEEEEECCTTSTTTTHHHHTTCSEEEEC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHCCCCCEEEEE
T ss_conf             98899978987899999999997839899997887527889988741255676599974054505568750477378630


Q ss_pred             EECCC
Q ss_conf             70242
Q gi|254780768|r   71 VAGAI   75 (281)
Q Consensus        71 maG~V   75 (281)
                      -+...
T Consensus        85 ~~a~~   89 (337)
T 2c29_D           85 ATPMD   89 (337)
T ss_dssp             CCCCC
T ss_pred             CCCCC
T ss_conf             11234


No 206
>>1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} (A:1-66)
Probab=22.55  E-value=45  Score=13.72  Aligned_cols=14  Identities=7%  Similarity=0.261  Sum_probs=5.1

Q ss_pred             HHHHHHHHHCCCCH
Q ss_conf             99999875104803
Q gi|254780768|r   94 ISKMIWQLVSGGNA  107 (281)
Q Consensus        94 l~k~l~~~~~~gDd  107 (281)
                      +.|+.+-+.+..++
T Consensus        25 A~Rla~~lL~~~~~   38 (66)
T 1vdd_A           25 AQRLAFHLFEQPRE   38 (66)
T ss_dssp             HHHHHHHHSSSCHH
T ss_pred             HHHHHHHHHCCCHH
T ss_conf             99999999729999


No 207
>>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} (A:1-227)
Probab=22.47  E-value=47  Score=13.59  Aligned_cols=162  Identities=10%  Similarity=-0.054  Sum_probs=79.2

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCC--CCEEEEEECCCCCCC----CCCC-CEEEEEHHHHHHHHHHH------------
Q ss_conf             9739999779803899999999789--978999954866731----0388-56787389999999999------------
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKN--DEPVIASVLNECSFD----WQDF-ECRELPLGDFCVLRSIL------------   61 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g--~~~~ii~l~~~~~~~----~~~~-~~~~~~ig~ig~li~~L------------   61 (281)
                      |.||++| |.|..=..+|-.+-.+|  +++.++....+....    +.+. ......-..........            
T Consensus        18 ~~kIaVi-GaG~vG~~~A~~~a~~G~~~~V~l~D~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~   96 (227)
T 3g79_A           18 IKKIGVL-GMGYVGIPAAVLFADAPCFEKVLGFQRNSKSSGYKIEMLNRGESPLKGEEPGLEELIGKVVKAGKFECTPDF   96 (227)
T ss_dssp             CCEEEEE-CCSTTHHHHHHHHHHSTTCCEEEEECCCCTTTTTHHHHHTTTCCCSSCCGGGHHHHHHHHHHTTCEEEESCG
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCEEEECCH
T ss_conf             7769998-777778999999983899985999988974327899998689998567899989999999864986997888


Q ss_pred             -HHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCC-------------CHHHHHHHHHHHHHCCCEEECH
Q ss_conf             -86495406770242321000111026035789999998751048-------------0358999999999769748211
Q gi|254780768|r   62 -HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG-------------NAAILKASIDLLESYGVSVVGA  127 (281)
Q Consensus        62 -k~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~g-------------Dd~iL~~i~~~fe~~G~~vi~~  127 (281)
                       .-.+++-++.+-... +..-.+...|+.......+.+.+....+             ...........-...+..++..
T Consensus        97 ~~~~~~d~v~~~v~~~-~~~~~~~~~~l~~~~~~~~~i~~~~~~~~~i~~~st~~~~t~~~~~~~~l~~~~~~~~~~~~~  175 (227)
T 3g79_A           97 SRISELDAVTLAIQTP-FANPKDLEPDFSALIDGIRNVGKYLKPGMLVVLESTITPGTTEGMAKQILEEESGLKAGEDFA  175 (227)
T ss_dssp             GGGGGCSEEEECCCCC-CCSSCCSSCCCHHHHHHHHHHHHHCCTTCEEEECSCCCTTTTTTHHHHHHHHHHCCCBTTTBE
T ss_pred             HHHHCCCEEEEEECCC-CCCCCCCCCCCEEHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHEEEHHHCCCCCCCCCCCC
T ss_conf             9983699899990799-889999886311199999999985589968998515799623654532311156676787777


Q ss_pred             HHCCHHHCCCCC-CCCCCCCC----HHHHHHHHHHHHHHHHH
Q ss_conf             222524203543-34554653----23478899899999973
Q gi|254780768|r  128 HEIVPELLVQVG-SLGTCVPN----RDVKRDILAAMKSAEAL  164 (281)
Q Consensus       128 ~~~l~~ll~~~G-~l~~~~p~----~~~~~dI~~g~~i~~~l  164 (281)
                      +-+.|+++++-- +.....++    ......+....+++..+
T Consensus       176 ~~~~p~~i~~~~~v~~~~~~~~vig~~~~~~~~~~~~l~~~i  217 (227)
T 3g79_A          176 LAHAPERVMVGRLLKNIREHDRIVGGIDEASTKRAVELYSPV  217 (227)
T ss_dssp             EEECCCCCCTTSHHHHHHHSCEEEEESSHHHHHHHHHHHGGG
T ss_pred             EEECCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             646876105765001145899799967889999999997566


No 208
>>1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} (A:304-438)
Probab=22.45  E-value=47  Score=13.59  Aligned_cols=103  Identities=8%  Similarity=0.007  Sum_probs=42.7

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEE----EECCCCCC
Q ss_conf             39999779803899999999789978999954866731038856787389999999999864954067----70242321
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIV----VAGAIDRR   78 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~iv----maG~V~kr   78 (281)
                      ++.|+--.-.+.-...+.+...|.+-+|+.-.|.-+..     .      .+-..++.+.+++|-=|+    .-|.+. .
T Consensus         3 ~V~ii~~~pG~~~~~l~~~~~~~~~GiVl~~~G~Gn~p-----~------~~~~~l~~a~~~gi~VV~~Sqc~~G~v~-~   70 (135)
T 1zq1_A            3 KVALVKVYPGISSEIIDFLVDKGYKGIVIEGTGLGHTP-----N------DIIPSIERAVEEGVAVCXTSQCIYGRVN-L   70 (135)
T ss_dssp             CEEEEECCTTCCTHHHHHHHHTTCSEEEEEEBTTTBCC-----G------GGHHHHHHHHHTTCEEEEEESSSBSCCC-C
T ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCEEEEEEECCCCCC-----H------HHHHHHHHHHHCCCEEEEECCCCCCCCC-C
T ss_conf             38999975777999999997366867999867788898-----8------9999999999779779994578978827-7


Q ss_pred             CCHHH----------HCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC
Q ss_conf             00011----------1026035789999998751048035899999999976
Q gi|254780768|r   79 PNVQD----------LCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY  120 (281)
Q Consensus        79 P~~~~----------l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~  120 (281)
                      ..+..          .--|+.+-....|+.+.+ .++.|  ...|.++|+.+
T Consensus        71 ~~y~~g~~l~~~G~I~~g~lt~ekArikL~~~L-~~~~d--~~~i~~~f~~~  119 (135)
T 1zq1_A           71 NVYSTGRKLLKAGVIPCEDXLPETAYVKLXWVL-GHTQN--LEEVRKXXLTN  119 (135)
T ss_dssp             SSSHHHHHHHHTTCEECTTCCHHHHHHHHHHHH-TTCCC--HHHHHHHHHSC
T ss_pred             CCCCCHHHHHHCCEEECCCCCHHHHHHHHHHHH-CCCCC--HHHHHHHHCCC
T ss_conf             765444778869988889989999999999998-49999--99999996336


No 209
>>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* (A:1-169)
Probab=22.43  E-value=48  Score=13.59  Aligned_cols=28  Identities=18%  Similarity=0.243  Sum_probs=15.2

Q ss_pred             EEECCCCHHHHHHHHHHH---------CCCCEEEEEE
Q ss_conf             997798038999999997---------8997899995
Q gi|254780768|r    6 IIAGSGMLPYYVAKAARL---------KNDEPVIASV   33 (281)
Q Consensus         6 IIAG~G~LP~~ia~~~~~---------~g~~~~ii~l   33 (281)
                      |||-.|.-...+.+.+++         .|.+.+++.-
T Consensus        60 LIANRGeiA~Ri~rt~r~~~~~~~g~elgi~tvavyt   96 (169)
T 3jrx_A           60 LIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT   96 (169)
T ss_dssp             EECCCHHHHHHHHHHHHHHHHHHHSCTTSSEEEEEEC
T ss_pred             EEECCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEC
T ss_conf             9977819999999997775322342015960899985


No 210
>>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} (A:)
Probab=22.40  E-value=48  Score=13.58  Aligned_cols=71  Identities=18%  Similarity=0.076  Sum_probs=43.3

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC----------CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             399997798038999999997899789999548667310----------3885678738999999999986495406770
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----------QDFECRELPLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~----------~~~~~~~~~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      |+-|..|+|.+=..+++++.++|++++++..........          .........+........  ...++..++-.
T Consensus         6 ~IlVtGatG~iG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~--~~~~~~~v~~~   83 (313)
T 1qyd_A            6 RVLIVGGTGYIGKRIVNASISLGHPTYVLFRPEVVSNIDKVQMLLYFKQLGAKLIEASLDDHQRLVD--ALKQVDVVISA   83 (313)
T ss_dssp             CEEEESTTSTTHHHHHHHHHHTTCCEEEECCSCCSSCHHHHHHHHHHHTTTCEEECCCSSCHHHHHH--HHTTCSEEEEC
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCHHHHH--HHHHHHEEEEE
T ss_conf             8999899978999999999968897999989974356567777765204896899953023134666--65320024675


Q ss_pred             CCC
Q ss_conf             242
Q gi|254780768|r   73 GAI   75 (281)
Q Consensus        73 G~V   75 (281)
                      ...
T Consensus        84 ~~~   86 (313)
T 1qyd_A           84 LAG   86 (313)
T ss_dssp             CCC
T ss_pred             ECC
T ss_conf             203


No 211
>>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314} (A:)
Probab=22.40  E-value=48  Score=13.58  Aligned_cols=46  Identities=24%  Similarity=0.340  Sum_probs=31.7

Q ss_pred             HHHHHHHHHCCCE--EEEEEC--C-CEEEECHHHHHHHHHHCCCEEEEECH
Q ss_conf             9999999984990--999973--9-77998589999999987968999577
Q gi|254780768|r  232 AKTVQNVIKAGLA--GIALEA--G-KSLVLEKELVKKHADEAGIFVCGIDR  277 (281)
Q Consensus       232 ~~Ti~~~~~ag~~--giaiea--~-~~lild~~~~i~~a~~~~i~i~g~~~  277 (281)
                      .-++.++.-||+.  ++..|-  + .--..+.++..++|++|+|.++.++.
T Consensus       147 EaavdL~~lAgl~P~avi~eil~d~dG~~~~~~~~~~fA~~h~l~~i~i~d  197 (204)
T 1tks_A          147 EAAVQLSTLAGLQPAGVICELVRDEDGLMMRLDDCIQFGKKHGIKIININQ  197 (204)
T ss_dssp             HHHHHHHHHTTSCSBEEEEEBBCTTTCCBCBHHHHHHHHHHHTCCEEEHHH
T ss_pred             HHHHHHHHHCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEHHH
T ss_conf             999999982799870799999888998764899999999983996998999


No 212
>>3him_A Probable transcriptional regulator; TETR, bacterial, RHA1, PSI-2, MCSG, structural genomics, midwest center for structural genomics; 2.20A {Rhodococcus jostii} (A:)
Probab=22.36  E-value=48  Score=13.58  Aligned_cols=48  Identities=19%  Similarity=0.214  Sum_probs=32.1

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      -..||.+-.+.|.++||+=++..++....=++.|.+...=+++++.-.
T Consensus        18 r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~tiY~~F~sK~~L~~   65 (211)
T 3him_A           18 AARIRAAAIEVFAAKGYGATTTREIAASLDMSPGAVYPHYKTKESLLY   65 (211)
T ss_dssp             HHHHHHHHHHHHHHHCSTTCCHHHHHHHTTCCTTSSTTTCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHCCCCCHHHHHH
T ss_conf             999999999999984925077999999968996522223898999999


No 213
>>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesis; HET: FAD; 2.0A {Klebsiella pneumoniae} (A:1-38,A:209-240,A:336-384)
Probab=22.32  E-value=48  Score=13.57  Aligned_cols=76  Identities=14%  Similarity=0.122  Sum_probs=47.9

Q ss_pred             CCE-EEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCC-------C----CCCCCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             973-99997798038999999997899789999548667-------3----10388567873899999999998649540
Q gi|254780768|r    1 MKR-LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS-------F----DWQDFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         1 M~k-igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~-------~----~~~~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      |++ =.+|.|+|--=..+|..+.++|.++.++--.+..+       +    ........+....+        ..+++.+
T Consensus         1 Mk~~DviIVGAG~aG~~~A~~La~~G~kVlVIEkr~~i~~~~~~~~~~~~~~~~~~~~~~~~Y~~--------~~~~~~~   72 (119)
T 2bi7_A            1 MKSKKILIVGAGFSGAVIGRQLAEKGHQVHIIDQRDHIENIKVDLQREFIVEERTHYDHVFYSGP--------LDAFYTN   72 (119)
T ss_dssp             -CCCEEEEECCSHHHHHHHHHHHTTTCEEEEEESSSSSTTEEEEESCCCCGGGGGGSSEEEECSC--------HHHHTSS
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEEEECEEEECCCCCCCCEEECCC--------CHHHHCC
T ss_conf             99687999896099999999998689968999779926673465410023111245553011167--------3055599


Q ss_pred             EEEECCCCCCCCHHHHCCC
Q ss_conf             6770242321000111026
Q gi|254780768|r   69 IVVAGAIDRRPNVQDLCFS   87 (281)
Q Consensus        69 ivmaG~V~krP~~~~l~~D   87 (281)
                      ++|+|...   .++=..+|
T Consensus        73 v~f~GRLa---~YkYydMd   88 (119)
T 2bi7_A           73 ITFVGRLG---TYRYLDMD   88 (119)
T ss_dssp             EEECHHHH---TTCCCCHH
T ss_pred             EEECCCCE---EEEECCHH
T ss_conf             79813586---33888899


No 214
>>2d6y_A Putative TETR family regulatory protein; helix-turn-helix, gene regulation; HET: TLA; 2.30A {Streptomyces coelicolor A3} (A:1-74)
Probab=22.31  E-value=48  Score=13.57  Aligned_cols=51  Identities=14%  Similarity=0.095  Sum_probs=43.8

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788998
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILA  156 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~dI~~  156 (281)
                      -..|+.+....|.++|+.=++..+++...=++.|.+...-|++++......
T Consensus        10 r~~Il~aa~~l~~~~G~~~~ti~~Ia~~~gvs~~t~Y~yF~~Ke~l~~~~~   60 (74)
T 2d6y_A           10 KARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVL   60 (74)
T ss_dssp             HHHHHHHHHHHHHHHTTTSCCHHHHHHHHTCCHHHHHHHHSSHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHCCCHHHHHHHHH
T ss_conf             999999999999974914077999999859198899678779999999999


No 215
>>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} (A:)
Probab=22.19  E-value=48  Score=13.56  Aligned_cols=168  Identities=14%  Similarity=0.009  Sum_probs=86.0

Q ss_pred             CEEEEEECCCC---HHHHHHHHHHHCCCCEEEEEECCCCCCCCC-----CCCEEE--E---EHHHHHHHHHHHHHC--CC
Q ss_conf             73999977980---389999999978997899995486673103-----885678--7---389999999999864--95
Q gi|254780768|r    2 KRLLIIAGSGM---LPYYVAKAARLKNDEPVIASVLNECSFDWQ-----DFECRE--L---PLGDFCVLRSILHQY--NI   66 (281)
Q Consensus         2 ~kigIIAG~G~---LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~-----~~~~~~--~---~ig~ig~li~~Lk~~--~i   66 (281)
                      +|++||.|.+.   +=..+++.+.+.|.++++.....+......     ...+..  .   +-.++..+++...++  .+
T Consensus        31 gKv~lITGassG~gIG~aia~~la~~Ga~Vvl~~r~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~i  110 (293)
T 3grk_A           31 GKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELGAFVAGHCDVADAASIDAVFETLEKKWGKL  110 (293)
T ss_dssp             TCEEEEECCCSSSSHHHHHHHHHHHTTCEEEEEECSHHHHHHHHHHHHHHTCEEEEECCTTCHHHHHHHHHHHHHHTSCC
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             98799989999965999999999986999999838779999999987406863776313488899999999999971996


Q ss_pred             CEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC---CCEEECHHHCCHHHCC-CCCCCC
Q ss_conf             406770242321000111026035789999998751048035899999999976---9748211222524203-543345
Q gi|254780768|r   67 GRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY---GVSVVGAHEIVPELLV-QVGSLG  142 (281)
Q Consensus        67 ~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~---G~~vi~~~~~l~~ll~-~~G~l~  142 (281)
                      +-+|-.=.+.....+.+...|..  ....    .....+---..+..+..+.+.   +..++.........-. ....|+
T Consensus       111 DiLVnnAg~~~~~~~~~~~~~~~--~~~~----~~n~~~~~~~~~~~~~~~~~~~~~~~~ii~~ss~~~~~~~~~~~~Y~  184 (293)
T 3grk_A          111 DFLVHAIGFSDKDELTGRYIDTS--EANF----TNTMLISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMG  184 (293)
T ss_dssp             SEEEECCCCCCHHHHTSCGGGCC--HHHH----HHHHHHHTHHHHHHHHHHHHHTTTCEEEEEEECGGGTSBCTTTTHHH
T ss_pred             EEEEECCCCCCCCCCCCCHHHHH--HHHH----HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
T ss_conf             19996066565212232046667--8888----77776799999999999999846994899981656547789837899


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCEE
Q ss_conf             54653234788998999999733267225999819748
Q gi|254780768|r  143 TCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV  180 (281)
Q Consensus       143 ~~~p~~~~~~dI~~g~~i~~~l~~~DiGQsvVv~~g~V  180 (281)
                      .   ++.  .-..+...++..+....|-=.+|.-...-
T Consensus       185 a---sK~--al~~~~~~~a~e~~~~~Irvn~i~Pg~~~  217 (293)
T 3grk_A          185 V---AKA--ALEASVKYLAVDLGPQNIRVNAISAGPIK  217 (293)
T ss_dssp             H---HHH--HHHHHHHHHHHHHGGGTEEEEEEEECCCC
T ss_pred             H---HHH--HHHHHHHHHHHHHHHHCEEEEEEECCCCC
T ss_conf             9---999--99999999999960519489997347340


No 216
>>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate- methylating enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* (A:1-14,A:250-383)
Probab=22.11  E-value=48  Score=13.55  Aligned_cols=34  Identities=9%  Similarity=0.101  Sum_probs=28.0

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             9997798038999999997899789999548667
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS   38 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~   38 (281)
                      .+|.|+|..-..+|..+...|.++.++.......
T Consensus        52 v~VvG~G~ig~e~A~~l~~~G~~Vtv~~~~~~~~   85 (148)
T 2gag_A           52 IAVATTNDSAYELVRELAATGGVVAVIDARSSIS   85 (148)
T ss_dssp             EEEEESSTTHHHHHHHHGGGTCCSEEEESCSSCC
T ss_pred             EEEEECCCHHHHHHHHHHHCCCCEEEECCCCCHH
T ss_conf             4787055338999999974467355421243034


No 217
>>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A substrate tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} (A:1-218)
Probab=22.09  E-value=48  Score=13.54  Aligned_cols=36  Identities=11%  Similarity=-0.038  Sum_probs=30.6

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             973999977980389999999978997899995486
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      |.||++|.=...+-..++++++..|.++.++.....
T Consensus         4 ~~~I~vid~~~~~~~~~~~~l~~~g~~~~vv~~~~~   39 (218)
T 1jvn_A            4 MPVVHVIDVESGNLQSLTNAIEHLGYEVQLVKSPKD   39 (218)
T ss_dssp             SCEEEEECCSCSCCHHHHHHHHHTTCEEEEESSGGG
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             998999979987799999999986997699968786


No 218
>>3fio_A A cystathionine beta-synthase domain protein fused to A Zn-ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} PDB: 3ghd_A (A:)
Probab=21.77  E-value=49  Score=13.50  Aligned_cols=38  Identities=21%  Similarity=0.240  Sum_probs=31.8

Q ss_pred             HHHHHHHCCCCCEEEEEEECCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             999997332672259998197488962534217999999975
Q gi|254780768|r  158 MKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC  199 (281)
Q Consensus       158 ~~i~~~l~~~DiGQsvVv~~g~ViaiEa~eGTD~mi~R~~~~  199 (281)
                      .++++.+...++|+-.|+.+|+++++    =|+.-|.|+...
T Consensus        12 ~ea~~~M~~~~i~~lpV~~~~~lvGI----iT~~Di~~~~~~   49 (70)
T 3fio_A           12 DRVAKILSRNKAGSAVVXEGDEILGV----VTERDILDKVVA   49 (70)
T ss_dssp             HHHHHHHHHTTCSEEEEEETTEEEEE----EEHHHHHHHTTT
T ss_pred             HHHHHHHHHCCCCEEEEEECCEEEEE----EEHHHHHHHHHH
T ss_conf             99999999749998999989999999----859999999996


No 219
>>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, class I; coenzyme A, flavin adenine dinucleotide, selenomethionine, FAD, flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* (A:159-278)
Probab=21.75  E-value=49  Score=13.50  Aligned_cols=25  Identities=12%  Similarity=0.230  Sum_probs=11.5

Q ss_pred             EHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             3899999999998649540677024
Q gi|254780768|r   50 PLGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus        50 ~ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      ++.+..++.+.+....-++++.+|.
T Consensus        12 ~~~d~~~~~~~~~~~~~k~vvVvGg   36 (120)
T 3cgb_A           12 TIPDAERILKTLETNKVEDVTIIGG   36 (120)
T ss_dssp             SHHHHHHHHHHHHSSCCCEEEEECC
T ss_pred             CHHHHHHCCCCCCCCCCCEEEEEEE
T ss_conf             0011110232223456640677630


No 220
>>1j2r_A Hypothetical isochorismatase family protein YECD; parallel beta-sheet 3-2-1-4-5-6, alpha-beta-alpha motif, tetramere, structural genomics; 1.30A {Escherichia coli} (A:)
Probab=21.57  E-value=9.6  Score=18.27  Aligned_cols=112  Identities=17%  Similarity=0.043  Sum_probs=61.0

Q ss_pred             HHHHHHHHCCCCEEEEEECCCCC-CCC-------------------------CCC-CEEEEE-----HHHHHHHHHHHHH
Q ss_conf             99999997899789999548667-310-------------------------388-567873-----8999999999986
Q gi|254780768|r   16 YVAKAARLKNDEPVIASVLNECS-FDW-------------------------QDF-ECRELP-----LGDFCVLRSILHQ   63 (281)
Q Consensus        16 ~ia~~~~~~g~~~~ii~l~~~~~-~~~-------------------------~~~-~~~~~~-----ig~ig~li~~Lk~   63 (281)
                      .+++.++.+|.+++........+ ...                         ... ....+.     -..=..+..+|+.
T Consensus        50 ~l~~~ar~~~~~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vi~K~~~~~f~~t~l~~~L~~  129 (199)
T 1j2r_A           50 KLAAKFRASGQPVFLVRVGWSADYAEALKQPVDAPSPAKVLPENWWQHPAALGTTDSDIEIIKRQWGAFYGTDLELQLRR  129 (199)
T ss_dssp             HHHHHHHHTTCCEEEEEECCCTTCTTSCCCCCSSCCCCCCCCTTTTCCCGGGCCCTTSEEEEESSSSSSTTSSHHHHHHH
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCHHHHCCCCCCCCCCCCCCCCHHHCCHHHCCCCCCEEEECCCCCCCCCCHHHHHHHH
T ss_conf             99999998499689886502888524302776788532005883421657447889977998586687778629999985


Q ss_pred             CCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHH------HHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHH
Q ss_conf             4954067702423210001110260357899999------9875104803589999999997697482112225242
Q gi|254780768|r   64 YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKM------IWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPEL  134 (281)
Q Consensus        64 ~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~------l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~l  134 (281)
                      +++++++++|-.+- --..      .+..-+...      +..+..--|...-......+...|-.|++..+++.+|
T Consensus       130 ~gi~~ivi~G~~t~-~CV~------~ta~~a~~~G~~v~vv~Da~~~~~~~~h~~al~~l~~~~~~v~~~~~~l~~L  199 (199)
T 1j2r_A          130 RGIDTIVLCGISTN-IGVE------STARNAWELGFNLVIAEDACSAASAEQHNNSINHIYPRIARVRSVEEILNAL  199 (199)
T ss_dssp             TTCCEEEEEEECTT-THHH------HHHHHHHHTTCEEEEEEEEEEBSSHHHHHHHHHHTHHHHSEEECHHHHHHHC
T ss_pred             CCCCEEEEECCCCC-CHHH------HHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEHHHHHHHC
T ss_conf             59764898525757-2899------9999999879879997712479999999999999995882994899998409


No 221
>>3hu5_A Isochorismatase family protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.50A {Desulfovibrio vulgaris str} (A:)
Probab=21.49  E-value=20  Score=16.17  Aligned_cols=77  Identities=12%  Similarity=0.209  Sum_probs=48.1

Q ss_pred             HHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHH------HHHHHCCCCHHHHHHHHHHHHHCCCEEECHHH
Q ss_conf             999999864954067702423210001110260357899999------98751048035899999999976974821122
Q gi|254780768|r   56 VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKM------IWQLVSGGNAAILKASIDLLESYGVSVVGAHE  129 (281)
Q Consensus        56 ~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~------l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~  129 (281)
                      .+..+|+++++++|+++|-.+- --...      +..-+...      +.....--|...-....+.+...|.+|++..+
T Consensus       116 ~l~~~L~~~gv~~iii~G~~t~-~CV~~------Ta~~a~~~G~~V~v~~Da~a~~~~~~h~~al~~l~~~~~~vv~~~~  188 (204)
T 3hu5_A          116 ECDXLLRRRGVDTLLVSGTQYP-NCIRG------TAVDAFALDYDVVVVTDACSARTPGVAESNINDXRAXGITCVPLTA  188 (204)
T ss_dssp             SHHHHHHHTTCCEEEEEEECTT-THHHH------HHHHHHHTTCEEEEEEEEEECSSHHHHHHHHHHHHHHTCEEECGGG
T ss_pred             HHHHHHHHCCCCEEEEEEECCC-CHHHH------HHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCEEEEHHH
T ss_conf             7999998559950899996976-18999------9999997899899965134899999999999999983999987999


Q ss_pred             CCHHHCCCCC
Q ss_conf             2524203543
Q gi|254780768|r  130 IVPELLVQVG  139 (281)
Q Consensus       130 ~l~~ll~~~G  139 (281)
                      ++..|.-...
T Consensus       189 ~l~~l~~~~~  198 (204)
T 3hu5_A          189 LDDVLARREG  198 (204)
T ss_dssp             HHHHHHC---
T ss_pred             HHHHHHHHCC
T ss_conf             9999998328


No 222
>>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} (A:1-108)
Probab=21.30  E-value=50  Score=13.44  Aligned_cols=33  Identities=15%  Similarity=0.097  Sum_probs=28.0

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             399997798038999999997899789999548
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLN   35 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~   35 (281)
                      +--+|.|.|..-...++.+...|.++.++....
T Consensus        13 k~vlViG~G~iG~~~a~~L~~~G~~v~vi~~~~   45 (108)
T 1pjq_A           13 RDCLIVGGGDVAERKARLLLEAGARLTVNALTF   45 (108)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHTTBEEEEEESSC
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             839998898999999999986898799993899


No 223
>>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} (B:)
Probab=21.21  E-value=50  Score=13.43  Aligned_cols=44  Identities=11%  Similarity=-0.093  Sum_probs=32.9

Q ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCE
Q ss_conf             39999779803899999999789978999954866731038856
Q gi|254780768|r    3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC   46 (281)
Q Consensus         3 kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~   46 (281)
                      ||++|.-.+.+...+.+.++..|.++.++.........+.+++-
T Consensus         2 rI~vid~~~~~~~~~~~~l~~~g~~~~v~~~~~~~~~~l~~~D~   45 (201)
T 1gpw_B            2 RIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDL   45 (201)
T ss_dssp             EEEEECCSSSCCHHHHHHHHHHSTTBSSCEEEEECSCCSSCCSE
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCCEECEEECCHHHHHHCCE
T ss_conf             89999489858999999999847625520126458778510585


No 224
>>2qko_A Possible transcriptional regulator, TETR family protein; structural genomics, PSI-2, protein structure initiative; 2.35A {Rhodococcus SP} (A:)
Probab=21.14  E-value=49  Score=13.52  Aligned_cols=49  Identities=27%  Similarity=0.314  Sum_probs=42.3

Q ss_pred             CCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             8035899999999976974821122252420354334554653234788
Q gi|254780768|r  105 GNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       105 gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      --+.||.+-.+.|.++||.=++..++....=++.|-+...=+++++.-.
T Consensus        29 ~r~~Il~aA~~l~~~~G~~~~ti~~Ia~~agvs~~tlY~~F~sK~~L~~   77 (215)
T 2qko_A           29 RRAALVNAAIEVLAREGARGLTFRAVDVEANVPKGTASNYFPSRDDLFD   77 (215)
T ss_dssp             HHHHHHHHHHHHHHHTCTTTCCHHHHHHHSSSTTTCHHHHCSCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCEECCCCCCHHHHHH
T ss_conf             9999999999999983923078999999968996840113899899999


No 225
>>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesis, isomerase; HET: DGL; 1.75A {Bacillus subtilis} (A:97-208)
Probab=21.11  E-value=50  Score=13.41  Aligned_cols=81  Identities=7%  Similarity=-0.002  Sum_probs=51.7

Q ss_pred             CCEEEEEECCCCHHH-HHHHHHHHCCCCEEEEEECCCCCCCC--CCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             973999977980389-99999997899789999548667310--388567873899999999998649540677024232
Q gi|254780768|r    1 MKRLLIIAGSGMLPY-YVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDR   77 (281)
Q Consensus         1 M~kigIIAG~G~LP~-~ia~~~~~~g~~~~ii~l~~~~~~~~--~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V~k   77 (281)
                      ++|+|++|=.|..-- ..-+.+.+.|.++.+.......-...  .+.......-.-+...+..+..++++.+|++=-  .
T Consensus        14 ~k~igvlaT~~T~~s~~y~~~i~~~g~~~~v~~~~~~~lv~~i~~~~~~~~~~~~~l~~~l~~l~~~~~d~iVLgCT--e   91 (112)
T 1zuw_A           14 NQHIGVIGTENTIKSNAYEEALLALNPDLKVENLACPLLVPFVESGKFLDQTADEIVKTSLYPLKDTSIDSLILGCT--H   91 (112)
T ss_dssp             SSEEEEEECHHHHHTTHHHHHHHHHCTTCEEEEEECTTHHHHHTSCCCCHHHHHHHHHHHHHHHHHSCCSEEEEEST--T
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEECCC--C
T ss_conf             31114776899986788886677528861699368833888987066574999999999962655058758996687--7


Q ss_pred             CCCHHH
Q ss_conf             100011
Q gi|254780768|r   78 RPNVQD   83 (281)
Q Consensus        78 rP~~~~   83 (281)
                      -|.+.+
T Consensus        92 lpl~~~   97 (112)
T 1zuw_A           92 YPILKE   97 (112)
T ss_dssp             GGGGHH
T ss_pred             CCHHHH
T ss_conf             302157


No 226
>>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus HB8} PDB: 1x1e_A* 2ekq_A (A:)
Probab=20.99  E-value=51  Score=13.40  Aligned_cols=166  Identities=14%  Similarity=0.003  Sum_probs=86.7

Q ss_pred             CCEEEEEECC-CCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEE---HHHHHHHHHHHHHC--CCCEEEEECC
Q ss_conf             9739999779-8038999999997899789999548667310388567873---89999999999864--9540677024
Q gi|254780768|r    1 MKRLLIIAGS-GMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP---LGDFCVLRSILHQY--NIGRIVVAGA   74 (281)
Q Consensus         1 M~kigIIAG~-G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~---ig~ig~li~~Lk~~--~i~~ivmaG~   74 (281)
                      |+|.++|-|. +.+=..+|+++-+.|.+++++........... ..+...+   ..++..+++...++  .++-++-.-.
T Consensus         1 M~Kv~lITGas~GIG~aia~~la~~Ga~Vi~~~r~~~~~~~~~-~~~~~~dv~~~~~v~~~~~~~~~~~g~iDilinnAg   79 (239)
T 2ekp_A            1 MERKALVTGGSRGIGRAIAEALVARGYRVAIASRNPEEAAQSL-GAVPLPTDLEKDDPKGLVKRALEALGGLHVLVHAAA   79 (239)
T ss_dssp             -CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSCHHHHHHH-TCEEEECCTTTSCHHHHHHHHHHHHTSCCEEEECCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHC-CCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEECCC
T ss_conf             9988999678758999999999987998999979999999866-987998435889999999999998199989998998


Q ss_pred             CCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC-EEECHHHCCHHH-CCCCCCCCCCCCCHHHHH
Q ss_conf             232100011102603578999999875104803589999999997697-482112225242-035433455465323478
Q gi|254780768|r   75 IDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV-SVVGAHEIVPEL-LVQVGSLGTCVPNRDVKR  152 (281)
Q Consensus        75 V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~-~vi~~~~~l~~l-l~~~G~l~~~~p~~~~~~  152 (281)
                      +.....+.+...+     ...+. +...-.|--.+.++.+..+.+++. +++-......-. ...++.+..   ++.-..
T Consensus        80 ~~~~~~~~~~~~~-----~~~~~-~~iN~~g~~~~~~~~~p~m~~~~~g~ii~isS~s~~~~~~~~~~~~y---s~~Kaa  150 (239)
T 2ekp_A           80 VNVRKPALELSYE-----EWRRV-LYLHLDVAFLLAQAAAPHMAEAGWGRVLFIGSVTTFTAGGPVPIPAY---TTAKTA  150 (239)
T ss_dssp             CCCCCCTTTCCHH-----HHHHH-HHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGTSCCTTSCCHHH---HHHHHH
T ss_pred             CCCCCCHHHCCHH-----HHHHH-HHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHCCCCCCCCHHH---HHHHHH
T ss_conf             8999990459999-----99999-99750489999999998520122343443133455235543210277---899999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEEE
Q ss_conf             899899999973326722599981
Q gi|254780768|r  153 DILAAMKSAEALSELDVGQSAVSI  176 (281)
Q Consensus       153 dI~~g~~i~~~l~~~DiGQsvVv~  176 (281)
                      -..+...++.++++..|-=.+|.-
T Consensus       151 ~~~~~~~la~e~~~~~I~vn~i~P  174 (239)
T 2ekp_A          151 LLGLTRALAKEWARLGIRVNLLCP  174 (239)
T ss_dssp             HHHHHHHHHHHHGGGTEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             999999999997151871011234


No 227
>>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} (A:)
Probab=20.96  E-value=51  Score=13.39  Aligned_cols=35  Identities=9%  Similarity=0.090  Sum_probs=30.9

Q ss_pred             CEEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             73999977980-389999999978997899995486
Q gi|254780768|r    2 KRLLIIAGSGM-LPYYVAKAARLKNDEPVIASVLNE   36 (281)
Q Consensus         2 ~kigIIAG~G~-LP~~ia~~~~~~g~~~~ii~l~~~   36 (281)
                      +|.+||.|.+. +=..+|+.+-+.|.++++.....+
T Consensus         9 gkvalVTGas~GIG~aiA~~la~~Ga~Vvl~~~~~~   44 (291)
T 1e7w_A            9 VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSA   44 (291)
T ss_dssp             CCEEEETTCSSHHHHHHHHHHHHTTCEEEEEESSCH
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCH
T ss_conf             988999477988999999999987998999958877


No 228
>>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} (A:1-133)
Probab=20.93  E-value=51  Score=13.39  Aligned_cols=40  Identities=15%  Similarity=0.247  Sum_probs=34.1

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             9739999779803899999999789978999954866731
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD   40 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~   40 (281)
                      |+||+|+.-.|+.=....+-+++...++-++++....+.+
T Consensus         9 mk~i~ILGSTGSIG~qtL~Vi~~~~d~f~vv~lsa~~n~~   48 (133)
T 1q0q_A            9 MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVT   48 (133)
T ss_dssp             CEEEEEETTTSHHHHHHHHHHHHCTTTEEEEEEEESSCHH
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEECCCHH
T ss_conf             9689997548798999999998394774899999489799


No 229
>>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* (A:120-235)
Probab=20.92  E-value=51  Score=13.39  Aligned_cols=57  Identities=14%  Similarity=0.089  Sum_probs=39.5

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             9997798038999999997899789999548667310388567873899999999998649540
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      ..|.|+|..-.++|..+...|.++.++...+..-+.  .+     +-.--..+.+.|+++||+-
T Consensus        29 v~IiGgG~~GiE~A~~l~~~g~~v~li~~~~~~l~~--~~-----~~~~~~~~~~~l~~~GV~~   85 (116)
T 2gqw_A           29 LLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSR--AA-----PATLADFVARYHAAQGVDL   85 (116)
T ss_dssp             EEEECCSHHHHHHHHHHHHTTCEEEEEESSSSSSTT--TS-----CHHHHHHHHHHHHHTTCEE
T ss_pred             EEEECCCCCCCCCCCCCCCCEEEEEEECCCCCCCCC--CC-----CHHHHHHHHHHHHHCCEEE
T ss_conf             089724111111122212210357764255500122--46-----5778999999865211034


No 230
>>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.62A {Jannaschia SP} (A:1-195)
Probab=20.84  E-value=51  Score=13.38  Aligned_cols=66  Identities=11%  Similarity=0.005  Sum_probs=40.9

Q ss_pred             CCEEEEEECCCC-HHHHHHHHHHHCCCCEEEEEECCCCCCC--------------CCCCCEE--EEEHHHHHHHHHHHHH
Q ss_conf             973999977980-3899999999789978999954866731--------------0388567--8738999999999986
Q gi|254780768|r    1 MKRLLIIAGSGM-LPYYVAKAARLKNDEPVIASVLNECSFD--------------WQDFECR--ELPLGDFCVLRSILHQ   63 (281)
Q Consensus         1 M~kigIIAG~G~-LP~~ia~~~~~~g~~~~ii~l~~~~~~~--------------~~~~~~~--~~~ig~ig~li~~Lk~   63 (281)
                      |+|+|+| |.|. .=..+|+.++..|+++++..........              .++-+..  .++......+.+.+..
T Consensus        11 ~~~I~ii-G~G~m~G~~lA~~l~~~G~~V~~~dr~~~~~~~~~~~g~~~~~~~e~~~~adiIi~~vp~~~~~~v~~~~~~   89 (195)
T 3c24_A           11 PKTVAIL-GAGGKXGARITRKIHDSAHHLAAIEIAPEGRDRLQGXGIPLTDGDGWIDEADVVVLALPDNIIEKVAEDIVP   89 (195)
T ss_dssp             CCEEEEE-TTTSHHHHHHHHHHHHSSSEEEEECCSHHHHHHHHHTTCCCCCSSGGGGTCSEEEECSCHHHHHHHHHHHGG
T ss_pred             CCEEEEE-CCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCCHHHHHHHCHHCCCCCCHHHHHHHHHHHHH
T ss_conf             9999999-989789999999999789959999488899999997699358899999734130345877789999999983


Q ss_pred             CCCC
Q ss_conf             4954
Q gi|254780768|r   64 YNIG   67 (281)
Q Consensus        64 ~~i~   67 (281)
                      .--.
T Consensus        90 ~l~~   93 (195)
T 3c24_A           90 RVRP   93 (195)
T ss_dssp             GSCT
T ss_pred             CCCC
T ss_conf             0899


No 231
>>3ccy_A Putative TETR-family transcriptional regulator; APC88698, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.01A {Bordetella parapertussis 12822} (A:)
Probab=20.77  E-value=51  Score=13.37  Aligned_cols=48  Identities=10%  Similarity=0.094  Sum_probs=34.3

Q ss_pred             CHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             035899999999976974821122252420354334554653234788
Q gi|254780768|r  106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       106 Dd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      -+.||.+-.+.|.++||.=++..++....=++.|-+...=+++++.-.
T Consensus        16 r~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~tiY~~F~sKe~L~~   63 (203)
T 3ccy_A           16 RDTIIERAAAXFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLR   63 (203)
T ss_dssp             HHHHHHHHHHHHHHTCTTTSCHHHHHHHTTCCGGGGTTTCSCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHCCCCHHHHHH
T ss_conf             999999999999972955187999999858294304441899999999


No 232
>>2dgd_A 223AA long hypothetical arylmalonate decarboxylase; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} (A:108-202)
Probab=20.75  E-value=51  Score=13.36  Aligned_cols=20  Identities=15%  Similarity=0.298  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHCCCEEECHHH
Q ss_conf             99999999976974821122
Q gi|254780768|r  110 LKASIDLLESYGVSVVGAHE  129 (281)
Q Consensus       110 L~~i~~~fe~~G~~vi~~~~  129 (281)
                      -..+.++|++.||+|++...
T Consensus        15 ~~~~~~~~~~~G~eV~~~~~   34 (95)
T 2dgd_A           15 TLEEVEWWRNKGFEIVGYDG   34 (95)
T ss_dssp             HHHHHHHHHTTTCEEEEEEE
T ss_pred             HHHHHHHHHHCCEEEEEECC
T ss_conf             79999999967905853002


No 233
>>1yac_A Ycacgp, YCAC gene product; unknown bacterial hydrolase, three layer alpha-beta-alpha sandwich topology, ENTB homolog, cshase homolog; 1.80A {Escherichia coli} (A:)
Probab=20.74  E-value=31  Score=14.85  Aligned_cols=138  Identities=10%  Similarity=0.040  Sum_probs=75.2

Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCC---------CCCCEE----EEEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHH
Q ss_conf             99999997899789999548667310---------388567----87389999999999864954067702423210001
Q gi|254780768|r   16 YVAKAARLKNDEPVIASVLNECSFDW---------QDFECR----ELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQ   82 (281)
Q Consensus        16 ~ia~~~~~~g~~~~ii~l~~~~~~~~---------~~~~~~----~~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~   82 (281)
                      .+.+.++..|.+++...-........         ......    .++-..-..+...|+.+++++++++|--+- --..
T Consensus        42 ~li~~ar~~~~~vi~~~~~~~~~~~~~~~~~~~~~~~~~~v~~K~~~saf~~t~l~~~L~~~gi~~ivi~G~~T~-~CV~  120 (208)
T 1yac_A           42 ALGDLAKYFNLPTILTTSAETGPNGPLVPELKAQFPDAPYIARPGNINAWDNEDFVKAVKATGKKQLIIAGVVTE-VCVA  120 (208)
T ss_dssp             HHHHHHHHTTCCEEEEEESTTTTTCCBCHHHHHHCTTSCEEEESSCSSGGGSHHHHHHHHHTTCSEEEEEEBSCC-CCCH
T ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCHHHHHHHCCCCEEEEEECCCC-HHHH
T ss_conf             999999973998389996257887752112202489998887579567887960999987579878999720021-3889


Q ss_pred             HHCCCHHHHHHHHH------HHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCC-----CCCCCCCHHHH
Q ss_conf             11026035789999------99875104803589999999997697482112225242035433-----45546532347
Q gi|254780768|r   83 DLCFSIKDSLRISK------MIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGS-----LGTCVPNRDVK  151 (281)
Q Consensus        83 ~l~~D~~~~~~l~k------~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~-----l~~~~p~~~~~  151 (281)
                      .      +.+-+..      ++.....-.|...-..-...++..|..+++..+++.++.-....     .+-.+-...+.
T Consensus       121 ~------Ta~~a~~~G~~V~V~~Da~~s~~~~~h~~al~~l~~~~~~v~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~  194 (208)
T 1yac_A          121 F------PALSAIEEGFDVFVVTDASGTFNEITRHSAWDRMSQAGAQLMTWFGVACELHRDWRNDIAGLATLFSNHIPDY  194 (208)
T ss_dssp             H------HHHHHHHTTCEEEEETTSCBCSSHHHHHHHHHHHHHHTCEEECHHHHHHHHHCCGGGCHHHHHHHHHHHCHHH
T ss_pred             H------HHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECHHHHHHHHHHHCCCCHHHHHHHHHHCCCCH
T ss_conf             9------9999998699799956140788759999999999976989974999999998431665788999998759817


Q ss_pred             HHHHHHHHH
Q ss_conf             889989999
Q gi|254780768|r  152 RDILAAMKS  160 (281)
Q Consensus       152 ~dI~~g~~i  160 (281)
                      .-+..|..-
T Consensus       195 ~~~~~~~~~  203 (208)
T 1yac_A          195 RNLMTSYDT  203 (208)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             889999987


No 234
>>1xp3_A Endonuclease IV; NFO, DNA replication, DNA recombination, DNA repair, spine, structural genomics, structural proteomics in europe, hydrolase; 2.57A {Bacillus anthracis} (A:)
Probab=20.68  E-value=51  Score=13.35  Aligned_cols=69  Identities=7%  Similarity=-0.038  Sum_probs=34.9

Q ss_pred             CEEEEEECC--CCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             739999779--80389999999978997899995486673103885678738999999999986495406770242
Q gi|254780768|r    2 KRLLIIAGS--GMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI   75 (281)
Q Consensus         2 ~kigIIAG~--G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~V   75 (281)
                      -|+|+-.-.  +.=+...++.+...|++.+=+.....-....     ....-..+.++.+.+++++++-..+....
T Consensus        11 ~~lg~~~~~~~~~~~~~~~~~~~~~G~~~iEl~~~~~~~~~~-----~~~~~~~~~~~~~~l~~~gl~i~~~~~~~   81 (307)
T 1xp3_A           11 LKIGSHVSMSGKKMLLAASEEAVSYGATTFMIYTGAPQNTRR-----KPIEELNIEAGRKHMEQNGIEEIIIHAPY   81 (307)
T ss_dssp             CCEEEBCCCCSSSTHHHHHHHHHTTTCSSEEECSSCTTCCCC-----CCGGGGCHHHHHHHHHHTTCCCEEEECCT
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-----CCCCHHHHHHHHHHHHHCCCCCEECCCCE
T ss_conf             858341570787478999999997699899997999888999-----99999999999999998499751215842


No 235
>>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus HB8} PDB: 2eq8_A* 2eq9_A* (A:149-267)
Probab=20.62  E-value=52  Score=13.35  Aligned_cols=56  Identities=18%  Similarity=0.182  Sum_probs=39.2

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCE
Q ss_conf             9997798038999999997899789999548667310388567873899999999998649540
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGR   68 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~   68 (281)
                      -+|.|+|..-.++|..+...|.++.++...+..-+   .+..   .  --..+.+.|++++|+-
T Consensus        24 v~ViGgG~~g~E~A~~l~~~g~~Vtli~~~~~~~~---~~d~---~--~~~~~~~~l~~~gV~~   79 (119)
T 2eq6_A           24 LLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILP---QGDP---E--TAALLRRALEKEGIRV   79 (119)
T ss_dssp             EEEECCSHHHHHHHHHHHHTTCEEEEECSSSSSST---TSCH---H--HHHHHHHHHHHTTCEE
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCHH---CCCH---H--HHHHHHHHHHHCCCCC
T ss_conf             99989789999999999977991899985771101---1587---8--9999999986311200


No 236
>>2g7l_A TETR-family transcriptional regulator; APC6062, protein structure initiative, PSI, midwest center for structural genomics, MCSG; 2.10A {Streptomyces coelicolor} (A:)
Probab=20.60  E-value=52  Score=13.34  Aligned_cols=50  Identities=20%  Similarity=0.168  Sum_probs=37.8

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             48035899999999976974821122252420354334554653234788
Q gi|254780768|r  104 GGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       104 ~gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      ..-+.||.+-.+.|.++||.=++..++....=++.|.+...=+|+++.-.
T Consensus        19 ~~r~~Il~aA~~l~~~~G~~~~ti~~IA~~agvs~~t~Y~~F~sK~~L~~   68 (243)
T 2g7l_A           19 LSRRWIVDTAVALXRAEGLEKVTXRRLAQELDTGPASLYVYVANTAELHA   68 (243)
T ss_dssp             CCHHHHHHHHHHHHHHHCSSSCCHHHHHHHTTSCHHHHTTTCCSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCHHHHHH
T ss_conf             59999999999999972952078999998708786651210899999999


No 237
>>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A (A:336-560,A:607-618)
Probab=20.58  E-value=52  Score=13.34  Aligned_cols=26  Identities=12%  Similarity=-0.152  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             89999999999864954067702423
Q gi|254780768|r   51 LGDFCVLRSILHQYNIGRIVVAGAID   76 (281)
Q Consensus        51 ig~ig~li~~Lk~~~i~~ivmaG~V~   76 (281)
                      -....+-++.+|+.|+.-|=..+..+
T Consensus        36 ~~~~~~dl~l~k~~G~N~iR~~~~~~   61 (237)
T 3bga_A           36 KELXEQDIRLXKQHNINXVRNSHYPT   61 (237)
T ss_dssp             HHHHHHHHHHHHHTTCCEEEETTSCC
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99999999999852065799448999


No 238
>>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreductase, porphyrin biosynthesis; 2.30A {Bacillus megaterium} (A:1-126)
Probab=20.55  E-value=52  Score=13.34  Aligned_cols=31  Identities=10%  Similarity=0.140  Sum_probs=24.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             9999779803899999999789978999954
Q gi|254780768|r    4 LLIIAGSGMLPYYVAKAARLKNDEPVIASVL   34 (281)
Q Consensus         4 igIIAG~G~LP~~ia~~~~~~g~~~~ii~l~   34 (281)
                      =.+|.|.|..-..+++.+...|.+++++.-.
T Consensus        33 ~vlIiG~G~~G~~~a~~L~~~g~~v~~i~~~   63 (126)
T 3dfz_A           33 SVLVVGGGTIATRRIKGFLQEGAAITVVAPT   63 (126)
T ss_dssp             CEEEECCSHHHHHHHHHHGGGCCCEEEECSS
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             5999899899999999996389989999288


No 239
>>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* (A:)
Probab=20.53  E-value=52  Score=13.33  Aligned_cols=69  Identities=13%  Similarity=0.150  Sum_probs=44.4

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCC------CCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             739999779803899999999789978999954866731------03885678738999999999986495406770
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD------WQDFECRELPLGDFCVLRSILHQYNIGRIVVA   72 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~------~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivma   72 (281)
                      .|+-|..|+|.+=..+++.+.++|++++++.........      ..........+.....+...+..  ++.++..
T Consensus        12 ~~IlVtGatG~iG~~l~~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~--~d~~~~~   86 (318)
T 2r6j_A           12 SKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLGAIIVKGELDEHEKLVELMKK--VDVVISA   86 (318)
T ss_dssp             CCEEEETTTSTTHHHHHHHHHHTTCCEEEEECTTCSCHHHHHHHHHTTCEEEECCTTCHHHHHHHHTT--CSEEEEC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCCCEEEEEECCCCHHHHHHCCC--CCEEEEE
T ss_conf             81999899958999999999978697999978974236678763128948999102220224554055--5079995


No 240
>>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} (A:)
Probab=20.49  E-value=52  Score=13.33  Aligned_cols=33  Identities=12%  Similarity=-0.073  Sum_probs=24.9

Q ss_pred             EEECCCCHHHHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             997798038999999997899789999548667
Q gi|254780768|r    6 IIAGSGMLPYYVAKAARLKNDEPVIASVLNECS   38 (281)
Q Consensus         6 IIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~   38 (281)
                      ++++...=|..+++.+...|.+.+-+.......
T Consensus        11 i~~~d~~~~~e~~~~~~~~G~~~i~l~~~~~~~   43 (230)
T 1tqj_A           11 ILSADFSRLGEEIKAVDEAGADWIHVDVMDGRF   43 (230)
T ss_dssp             GGGSCGGGHHHHHHHHHHTTCSEEEEEEEBSSS
T ss_pred             HHHCCHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             431698999999999997599989996778964


No 241
>>1zk8_A Transcriptional regulator, TETR family; TETR member,transcriptional regulator, structural genomics, PSI, protein structure initiative; 2.15A {Bacillus cereus atcc 14579} (A:)
Probab=20.46  E-value=52  Score=13.32  Aligned_cols=49  Identities=20%  Similarity=0.186  Sum_probs=41.0

Q ss_pred             CCHHHHHHHHHHHHHCCCEEECHHHCCHHHCCCCCCCCCCCCCHHHHHH
Q ss_conf             8035899999999976974821122252420354334554653234788
Q gi|254780768|r  105 GNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD  153 (281)
Q Consensus       105 gDd~iL~~i~~~fe~~G~~vi~~~~~l~~ll~~~G~l~~~~p~~~~~~d  153 (281)
                      --..||.+-.+.|.++||.=++..++....=++.|-+...=+++++.-.
T Consensus         9 tr~~Il~aa~~l~~~~G~~~~ti~~Ia~~agvs~~tiY~~F~sK~~L~~   57 (183)
T 1zk8_A            9 TLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRK   57 (183)
T ss_dssp             CHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHTTTCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHCCCCHHHHHH
T ss_conf             8999999999999970944057999999858894303322898788999


No 242
>>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} (A:)
Probab=20.13  E-value=53  Score=13.28  Aligned_cols=166  Identities=10%  Similarity=-0.005  Sum_probs=88.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCC---------------------------------CCEEE
Q ss_conf             739999779803899999999789978999954866731038---------------------------------85678
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD---------------------------------FECRE   48 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~---------------------------------~~~~~   48 (281)
                      .|+-|..|.|.+=..+++.+.++|++++.+.-..........                                 .....
T Consensus         1 ~kIlItGatG~iG~~lv~~L~~~g~~v~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (219)
T 3dqp_A            1 XKIFIVGSTGRVGKSLLKSLSTTDYQIYAGARKVEQVPQYNNVKAVHFDVDWTPEEXAKQLHGXDAIINVSGSGGKSLLK   80 (219)
T ss_dssp             CEEEEESTTSHHHHHHHHHHTTSSCEEEEEESSGGGSCCCTTEEEEECCTTSCHHHHHTTTTTCSEEEECCCCTTSSCCC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCC
T ss_conf             95999999988999999999978398999989878804430453111222222111111136862267630232222222


Q ss_pred             EEHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECH-
Q ss_conf             7389999999999864954067702423210001110260357899999987510480358999999999769748211-
Q gi|254780768|r   49 LPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGA-  127 (281)
Q Consensus        49 ~~ig~ig~li~~Lk~~~i~~ivmaG~V~krP~~~~l~~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~-  127 (281)
                      ..+.....+++.+++.+++++++.+...-......   ......  +.....      ..-......+.+..|+...-. 
T Consensus        81 ~~~~~~~~~~~a~~~~~~~~~v~~s~~~~~~~~~~---~~~~~~--~~~~~~------~~~~~~~~~~~~~~~~~~~i~R  149 (219)
T 3dqp_A           81 VDLYGAVKLXQAAEKAEVKRFILLSTIFSLQPEKW---IGAGFD--ALKDYY------IAKHFADLYLTKETNLDYTIIQ  149 (219)
T ss_dssp             CCCHHHHHHHHHHHHTTCCEEEEECCTTTTCGGGC---CSHHHH--HTHHHH------HHHHHHHHHHHHSCCCEEEEEE
T ss_pred             CCHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCC---CCCCCC--CCCHHH------HHHHHHHHHHHHCCCCCEEEEE
T ss_conf             20145788998765221134324664364587444---676545--666145------5579999999763499879997


Q ss_pred             --HHCCHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC-CEEEEEEECCEEE
Q ss_conf             --22252420354334554653234788998999999733267-2259998197488
Q gi|254780768|r  128 --HEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELD-VGQSAVSIGGRVV  181 (281)
Q Consensus       128 --~~~l~~ll~~~G~l~~~~p~~~~~~dI~~g~~i~~~l~~~D-iGQsvVv~~g~Vi  181 (281)
                        .-+-++...-.+.-....+ --...|+.  .-++..+..-+ .||...+.++.+=
T Consensus       150 p~~~~g~~~~~~~~~~~~~~~-~i~v~D~a--~~~~~~l~~~~~~g~~~~~~~~~~s  203 (219)
T 3dqp_A          150 PGALTEEEATGLIDINDEVSA-SNTIGDVA--DTIKELVXTDHSIGKVISXHNGKTA  203 (219)
T ss_dssp             ECSEECSCCCSEEEESSSCCC-CEEHHHHH--HHHHHHHTCGGGTTEEEEEEEEEEE
T ss_pred             CCEECCCCCCCCCCCCCCCCC-CCCHHHHH--HHHHHHHCCCCCCCCEEEECCCCCC
T ss_conf             874038877675234765678-88899999--9999996795759938997589864


No 243
>>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} (A:1-204)
Probab=20.10  E-value=53  Score=13.27  Aligned_cols=118  Identities=10%  Similarity=-0.035  Sum_probs=67.2

Q ss_pred             EEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCC---------------CCCCEEEEEHHHHHHHHHHHHHCCCCEE
Q ss_conf             9997798038999999997899789999548667310---------------3885678738999999999986495406
Q gi|254780768|r    5 LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW---------------QDFECRELPLGDFCVLRSILHQYNIGRI   69 (281)
Q Consensus         5 gIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~---------------~~~~~~~~~ig~ig~li~~Lk~~~i~~i   69 (281)
                      -++.|+|.+-..+.+.+...+.++..+.-........               .+.++....-..-..+.+.|++.+++-+
T Consensus         6 i~~~g~~~~~~~~l~~L~~~~~~i~~Vit~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~l~~~~~Dli   85 (204)
T 1fmt_A            6 IIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVM   85 (204)
T ss_dssp             EEEEECSHHHHHHHHHHHHTTCEEEEEECCCCBC------CBCCHHHHHHHHTTCCEECCSCSCSHHHHHHHHHTTCSEE
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCCEECCCCCCCHHHHHHHHHHCCCEE
T ss_conf             99986788999999999978996799995999745578758889899999985996874676898999999986498999


Q ss_pred             EEECCCCC-CCC-HHHHC---CCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEECHHH
Q ss_conf             77024232-100-01110---26035789999998751048035899999999976974821122
Q gi|254780768|r   70 VVAGAIDR-RPN-VQDLC---FSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHE  129 (281)
Q Consensus        70 vmaG~V~k-rP~-~~~l~---~D~~~~~~l~k~l~~~~~~gDd~iL~~i~~~fe~~G~~vi~~~~  129 (281)
                      +.+|.-.. ++. ++..+   +-+.+     .+|-  ..+|-+.+..++.+--++-|.++.-.++
T Consensus        86 v~~~~~~ii~~~il~~~~~~~iN~Hp-----slLP--~yRG~~p~~wai~ng~~~~G~TiH~~~~  143 (204)
T 1fmt_A           86 VVVAYGLILPKAVLEMPRLGCINVHG-----SLLP--RWRGAAPIQRSLWAGDAETGVTIMQMDV  143 (204)
T ss_dssp             EEESCCSCCCHHHHHSSTTCEEEEES-----SSTT--TTBSSCHHHHHHHHTCSEEEEEEEECCS
T ss_pred             EEECCHHHCCHHHHHHCCCCEEEEEC-----CCCC--CCCCCCHHHHHHHCCCCEEEEEEEEECC
T ss_conf             99460123899999427799999817-----7466--7789898999998599748898798516


Done!