HHsearch results for GI: 254780768 and protein with PDBid: 1kjq_A

>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A*
Probab=93.34  E-value=0.25  Score=27.87  Aligned_cols=71  Identities=18%  Similarity=0.140  Sum_probs=48.8

Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             7399997798038999999997899789999548667310388567873899999999998649540677024
Q gi|254780768|r    2 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGA   74 (281)
Q Consensus         2 ~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~~~~~~~ig~ig~li~~Lk~~~i~~ivmaG~   74 (281)
                      +||+|| |+|.|-+..+.+|++.|++++++.-...+....-...+...+..+...+.++-++++|+-+ ..|.
T Consensus        12 ~kvlIi-G~Gqlgr~~a~Aak~lG~~v~~~~~~~~~p~~~~ad~~~~~~~~D~e~l~~~a~~~~~d~v-~~~~   82 (391)
T 1kjq_A           12 TRVMLL-GSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYI-VPEI   82 (391)
T ss_dssp             CEEEEE-SCSHHHHHHHHHHHTTTCEEEEEESSTTCGGGGGSSEEEECCTTCHHHHHHHHHHHCCSEE-EECS
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHCCEEEEECCCCHHHHHHHHHHHCCCEE-EECC
T ss_conf             899998-9789999999999987998999979999836762663698368899999999998499999-9277