HHsearch results for GI: 254780768 and protein with PDBid: 2vpq_A

>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus}
Probab=92.62  E-value=0.13  Score=29.76  Aligned_cols=69  Identities=16%  Similarity=0.094  Sum_probs=47.0

Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCC--CEEEEE-------HHHHHHHHHHHHHCCCCEEE
Q ss_conf             97399997798038999999997899789999548667310388--567873-------89999999999864954067
Q gi|254780768|r    1 MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELP-------LGDFCVLRSILHQYNIGRIV   70 (281)
Q Consensus         1 M~kigIIAG~G~LP~~ia~~~~~~g~~~~ii~l~~~~~~~~~~~--~~~~~~-------ig~ig~li~~Lk~~~i~~iv   70 (281)
                      |+|| |||+.|.....++++|+..|++++.+.-....+......  ..+.+.       .-++..+++..++.+|+-|.
T Consensus         1 ikki-LIanrGeiA~riira~relGi~tVaV~s~~D~~a~~~~~ADe~~~i~~~~~~~syLd~~~Ii~ia~~~~~DaIh   78 (451)
T 2vpq_A            1 MKKV-LIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVH   78 (451)
T ss_dssp             -CEE-EECCCHHHHHHHHHHHHHTTCEEEEEEEGGGTTCHHHHHSSEEEEEECSSGGGTTTCHHHHHHHHHHTTCSEEE
T ss_pred             CCEE-EEECCCHHHHHHHHHHHHCCCEEEEECCCHHHCCCCHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCEEE
T ss_conf             9689-99897099999999999879959998483674688977889999818986423436899999999997829999