BLAST/PSIBLAST alignment of GI: 254780768 and GI: 86357545 at iteration 1
>gi|86357545|ref|YP_469437.1| hypothetical protein RHE_CH01924 [Rhizobium etli CFN 42] Length = 293
>gi|86281647|gb|ABC90710.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 293
 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/275 (50%), Positives = 189/275 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++  E    W+ ++   + +GDF  L  + +
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKEESDPRWEGYDHAVIGIGDFAALEGLFN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y +GR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGVGRVVMSGSVRRRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  + +RDI  A  +AE L  LDVGQ AVSIGGRVVA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGAAAPGEEDRRDISQAANAAETLGRLDVGQGAVSIGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG  T+ N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISPRRRGVLVKLCKPQQDIRADLPAIGVATILNAAKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAGIA+EAG+SLVL++  V   ADEAG+FVCGIDR
Sbjct: 251 LAGIAIEAGRSLVLDRAAVISAADEAGLFVCGIDR 285