BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780768|ref|YP_003065181.1| hypothetical protein
CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040445|gb|ACT57241.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 281

 Score =  563 bits (1452), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI
Sbjct: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY
Sbjct: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV
Sbjct: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK
Sbjct: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
Sbjct: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281


>gi|315121985|ref|YP_004062474.1| hypothetical protein CKC_01175 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495387|gb|ADR51986.1| hypothetical protein CKC_01175 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 281

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/281 (82%), Positives = 257/281 (91%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           MKRLLIIAGSG+LPYYVAKAARL NDEPVIASVLNECSFDW+DFE + LPLGD CVLRSI
Sbjct: 1   MKRLLIIAGSGILPYYVAKAARLNNDEPVIASVLNECSFDWKDFESQALPLGDLCVLRSI 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L+QYNIGRIVVAGAI RRP++QDLCFSIKDS +I K+IWQLVSGG+AAILKA ID LE Y
Sbjct: 61  LNQYNIGRIVVAGAISRRPSIQDLCFSIKDSFKIPKLIWQLVSGGDAAILKAVIDFLEGY 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GVSVVGAHE+VP+LL Q GSLG+C+P + +KRDI +AMKSAEALS+LD+GQSAVS+GGRV
Sbjct: 121 GVSVVGAHEVVPDLLTQKGSLGSCIPTKGIKRDIFSAMKSAEALSDLDIGQSAVSVGGRV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEGIEGTDSMLQRIVDCR NG+IL GKSGVLVKM KSQQDMRADLPSIG  TVQNVIK
Sbjct: 181 VALEGIEGTDSMLQRIVDCRKNGKILVGKSGVLVKMFKSQQDMRADLPSIGLMTVQNVIK 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGL+GIALE GKSL+LEK+LVKK ADEAGIF+ GIDREF I
Sbjct: 241 AGLSGIALEYGKSLILEKDLVKKSADEAGIFIYGIDREFKI 281


>gi|116251988|ref|YP_767826.1| hypothetical protein RL2232 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256636|emb|CAK07724.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 293

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/275 (51%), Positives = 195/275 (70%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGFLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAVIGIGDFAALEGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y IGR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRTLMKMPATIRTLLSGGDDRVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LGT +P  + +RDI  A ++AE L  LDVGQ AV+IGGR+VA
Sbjct: 131 RVVGAHEIAPDLLAAVGPLGTAIPGEEDRRDISRAAEAAEMLGRLDVGQGAVAIGGRIVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML+R+ D R  GRI   + G LVK+CK QQD+RADLP+IG  TV N  KAG
Sbjct: 191 LEGLEGTDEMLERVADLRAAGRISPRRRGALVKLCKPQQDIRADLPAIGVSTVLNARKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAG+A+EAG+SLVL++  V K ADEAG+FVCGIDR
Sbjct: 251 LAGVAVEAGRSLVLDRAAVIKAADEAGLFVCGIDR 285


>gi|190891618|ref|YP_001978160.1| hypothetical protein RHECIAT_CH0002021 [Rhizobium etli CIAT 652]
 gi|190696897|gb|ACE90982.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 293

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 194/277 (70%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRPWEGYDHAIIGIGDFAALDGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y IGR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  D +RDI  A ++AE L  LDVGQ AVSIGGR+VA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGAVAPGEDDRRDINRAAEAAETLGRLDVGQGAVSIGGRIVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI A + GVLVK+CK QQD+RADLP+IG  TV N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISARRRGVLVKLCKPQQDVRADLPAIGLSTVLNAGKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAGIA+EAG+SLVL++  V + AD AG+FVCG+DR+ 
Sbjct: 251 LAGIAVEAGRSLVLDRAAVIRAADGAGLFVCGLDRDL 287


>gi|241204515|ref|YP_002975611.1| hypothetical protein Rleg_1787 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858405|gb|ACS56072.1| protein of unknown function DUF1009 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 293

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 140/275 (50%), Positives = 193/275 (70%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAVIGVGDFAALEGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y IGR+V++G++ RRP  +++  +++  +++  +I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRTLMKMPAVIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  + +RDI  A  +AE L  LDVGQ AV+IGGR+VA
Sbjct: 131 RVVGAHEIAPDLLAYVGPLGAAAPGEEDRRDIRRAADAAEMLGRLDVGQGAVAIGGRIVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML+R+   R  GRI   + G LVK+CK QQD+RADLP+IG  TV N  KAG
Sbjct: 191 LEGLEGTDEMLERVAGLRAAGRISPRRRGALVKLCKPQQDIRADLPAIGVSTVLNARKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAG+A+EAG+SLVL++  V K ADEAG+FVCGIDR
Sbjct: 251 LAGVAVEAGRSLVLDRAAVIKAADEAGLFVCGIDR 285


>gi|222085868|ref|YP_002544399.1| hypothetical protein Arad_2233 [Agrobacterium radiobacter K84]
 gi|221723316|gb|ACM26472.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 293

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 191/275 (69%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAGSG LP YVA+AAR   ++PVI ++ NE   DW  F+   L +G+F  L ++  
Sbjct: 11  RLAIIAGSGFLPAYVAEAARQAGEDPVILALTNEADRDWSAFDHATLGVGNFAGLEAVFR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y I R+V++G + RRP  +++  + +    +   I  L+SGG+ A+L+  I L+E+ GV
Sbjct: 71  RYGIDRVVMSGGVARRPAWREIHPTWRVIKELPSTIRTLLSGGDNAVLQMVIRLIEAGGV 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL   G LG   P+++  RDI    K+A+AL  LDVGQ AVS+GGRVVA
Sbjct: 131 RVVGAHEIAPDLLATTGPLGKLSPSKEDLRDIAQGAKAADALGLLDVGQGAVSVGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD M++R+   R  GRI   + GVLVK+CK QQD+RADLPSIG  TV N  KAG
Sbjct: 191 LEGAEGTDQMIERVAGLRAEGRISTRRRGVLVKLCKPQQDVRADLPSIGVSTVLNAKKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAG+A+EAG++LVLE++ V   ADEAG+F+CGIDR
Sbjct: 251 LAGVAVEAGRALVLERDAVIAAADEAGLFICGIDR 285


>gi|86357545|ref|YP_469437.1| hypothetical protein RHE_CH01924 [Rhizobium etli CFN 42]
 gi|86281647|gb|ABC90710.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 293

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/275 (50%), Positives = 189/275 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++  E    W+ ++   + +GDF  L  + +
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKEESDPRWEGYDHAVIGIGDFAALEGLFN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y +GR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGVGRVVMSGSVRRRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  + +RDI  A  +AE L  LDVGQ AVSIGGRVVA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGAAAPGEEDRRDISQAANAAETLGRLDVGQGAVSIGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG  T+ N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISPRRRGVLVKLCKPQQDIRADLPAIGVATILNAAKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAGIA+EAG+SLVL++  V   ADEAG+FVCGIDR
Sbjct: 251 LAGIAIEAGRSLVLDRAAVISAADEAGLFVCGIDR 285


>gi|209549193|ref|YP_002281110.1| hypothetical protein Rleg2_1594 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534949|gb|ACI54884.1| protein of unknown function DUF1009 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 293

 Score =  279 bits (713), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/275 (50%), Positives = 192/275 (69%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+D++   + +GDF  L  +L 
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEDYDHAVIGIGDFAALDGLLS 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y +GR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGVGRVVMSGSVARRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P+ + +RDI  A ++A+ L  LDVGQ A+SIGGRVVA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGATTPSEEDRRDIRRAAEAADMLGRLDVGQGAISIGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI   + G LVK+CK QQD+RADLP+IG  T+ N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISPRRRGALVKLCKPQQDIRADLPAIGVSTILNAKKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           L GIA+EAG+SLVL++  V K ADEAG+FVCGIDR
Sbjct: 251 LGGIAVEAGRSLVLDRPAVIKAADEAGLFVCGIDR 285


>gi|222148851|ref|YP_002549808.1| hypothetical protein Avi_2512 [Agrobacterium vitis S4]
 gi|221735837|gb|ACM36800.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 290

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 136/274 (49%), Positives = 199/274 (72%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAGSGMLP YVA+AAR   ++P I  + NE    W  F+   + +GD   L S++ 
Sbjct: 7   RLAIIAGSGMLPVYVAEAARAAGEDPFILPLKNEADQRWDGFQSAVIGVGDMAGLSSLIK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           ++ I R+V++G + +RPN +++  +++  +++   +  L+SGG+ A+LK  I L+ES G 
Sbjct: 67  RHGIKRVVMSGGVKKRPNFKEIHVNLRFLVKLPFAVKTLLSGGDDAVLKMVIQLIESQGC 126

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL ++G LG+  P  D +RDI AA K+A+AL  LDVGQ AVS+GGR+VA
Sbjct: 127 RVVGAHEIAPQLLAELGPLGSSRPTDDDRRDIAAAAKAADALGRLDVGQGAVSVGGRIVA 186

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD MLQR+ + R+ GRI + +SGVLVK+CK QQD+RADLP+IG  T++N  +AG
Sbjct: 187 LEGVEGTDRMLQRVAELRSEGRISSRRSGVLVKLCKPQQDIRADLPTIGQSTIENAARAG 246

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           L+GIA++AG++L+L+++   + AD AGIF+ GI+
Sbjct: 247 LSGIAVQAGRALLLQRQETLRQADAAGIFISGIE 280


>gi|150396361|ref|YP_001326828.1| hypothetical protein Smed_1142 [Sinorhizobium medicae WSM419]
 gi|150027876|gb|ABR59993.1| protein of unknown function DUF1009 [Sinorhizobium medicae WSM419]
          Length = 295

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 186/277 (67%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AAR + + P I ++  E   DW  F+     +GDF  +     
Sbjct: 14  RLAIIAGAGALPHHVAEAARRQGENPFIIALSREADADWTGFDHTVCAIGDFAAISHTFE 73

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP  +D+  ++K   ++ ++   L+SGG+ A+L+  I+L+E+ G 
Sbjct: 74  AEKIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLMSGGDDAVLRMVIELIEASGA 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL  VG LG   P  + +RDI A + +A AL  LDVGQ AV++GGRVVA
Sbjct: 134 HVIGAHEVVPGLLADVGPLGRHAPTDEDQRDIRAGIAAANALGALDVGQGAVAVGGRVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ D R +GRI   + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 194 LEGAEGTDAMLARVSDLRKDGRISVRRRGVLVKLCKPQQDERADLPSIGPSTVAEAHAAG 253

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAGIA+EAG++LVLE+  + + AD +G+FV GI+R  
Sbjct: 254 LAGIAIEAGRALVLERTRLVEAADRSGMFVLGIERNL 290


>gi|325292748|ref|YP_004278612.1| hypothetical protein AGROH133_05895 [Agrobacterium sp. H13-3]
 gi|325060601|gb|ADY64292.1| hypothetical protein AGROH133_05895 [Agrobacterium sp. H13-3]
          Length = 293

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 186/274 (67%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL I+AGSG LP +VA AAR   + P I  + ++  FDW  F+   + +GD   L  +L 
Sbjct: 6   RLAIVAGSGQLPLHVAAAAREMGENPFIVQLRDDSQFDWSGFDNAVISVGDVAGLGRLLR 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  + R+V++GA+ RRP  +++  +I   L++  ++  L+S G+ A+L+  I ++ + G 
Sbjct: 66  ENQVDRVVLSGAVARRPEWREIRPTIGILLKLPSIVRTLLSSGDDAVLQMVIKVIGTLGA 125

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHEI P LL   G  G   P  D  RDI  A ++A AL  LDVGQ AV++GGR+VA
Sbjct: 126 KVIGAHEIAPGLLATTGPFGAHKPAEDDLRDIRKAAQAALALGTLDVGQGAVAVGGRIVA 185

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD+ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG +TV+N  KAG
Sbjct: 186 LEGVEGTDAMLARVAALRAEGRISTRRKGVLVKLCKPQQDIRADLPTIGVETVENAHKAG 245

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           LAGIA+EAG++LVL+++ + K AD+AGIFVCGID
Sbjct: 246 LAGIAVEAGRALVLDRDEMLKAADQAGIFVCGID 279


>gi|307317024|ref|ZP_07596465.1| protein of unknown function DUF1009 [Sinorhizobium meliloti AK83]
 gi|306897112|gb|EFN27857.1| protein of unknown function DUF1009 [Sinorhizobium meliloti AK83]
          Length = 295

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 188/276 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AARL+ ++P I ++  E   DW  F+     +GDF  +     
Sbjct: 14  RLAIIAGAGTLPHHVAEAARLQGEDPFIIALSREADTDWTGFDHAVCAIGDFAAISRTFE 73

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP  +D+  ++K   ++ ++   L+SGG+ A+L+  I+L+E+ G 
Sbjct: 74  TEGIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLISGGDDAVLRMVIELIEASGA 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL   G LG   P  + +RDI A + +A AL  LDVGQ AV++GGRVVA
Sbjct: 134 HVIGAHEVVPGLLADTGPLGAHAPTDEDRRDIEAGIAAANALGALDVGQGAVAVGGRVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ D R +GRI   + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 194 LEGAEGTDAMLARVADLRKDGRISIRRRGVLVKLCKPQQDERADLPSIGPSTVAGAHAAG 253

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAGIA+EAG++LVLE+  + + AD +G+F+ GI+R+
Sbjct: 254 LAGIAVEAGRALVLERARLVQEADRSGLFILGIERD 289


>gi|15965259|ref|NP_385612.1| hypothetical protein SMc02090 [Sinorhizobium meliloti 1021]
 gi|307309282|ref|ZP_07588950.1| protein of unknown function DUF1009 [Sinorhizobium meliloti BL225C]
 gi|15074439|emb|CAC46085.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306900283|gb|EFN30900.1| protein of unknown function DUF1009 [Sinorhizobium meliloti BL225C]
          Length = 295

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/276 (48%), Positives = 188/276 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AARL+ ++P I ++  E   DW  F+     +GDF  +     
Sbjct: 14  RLAIIAGAGTLPHHVAEAARLQGEDPFIIALSREADTDWTGFDHAVCAIGDFAAISRTFE 73

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP  +D+  ++K   ++ ++   L+SGG+ A+L+  I+L+E+ G 
Sbjct: 74  TEGIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLISGGDDAVLRMVIELIEASGA 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL   G LG   P  + +RDI A + +A AL  LDVGQ AV++GGRVVA
Sbjct: 134 HVIGAHEVVPGLLADTGRLGAHAPTDEDRRDIEAGIAAANALGALDVGQGAVAVGGRVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ D R +GRI   + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 194 LEGAEGTDAMLARVADLRKDGRISIRRRGVLVKLCKPQQDERADLPSIGPSTVAGAHAAG 253

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAGIA+EAG++LVLE+  + + AD +G+F+ GI+R+
Sbjct: 254 LAGIAVEAGRALVLERARLVEEADRSGLFILGIERD 289


>gi|227821908|ref|YP_002825878.1| hypothetical protein NGR_c13450 [Sinorhizobium fredii NGR234]
 gi|227340907|gb|ACP25125.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 293

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 189/275 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AAR + ++P I ++  E   DW  F+   L +GDF  +     
Sbjct: 12  RLAIIAGAGALPHHVAEAARRQGEDPFIIALSREADADWSGFDHATLAIGDFAAISKAFA 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP+ +D+  ++K   ++  ++  LVSGG+ A+L+ ++DL+E+ G 
Sbjct: 72  AEGIDRVVLSGAVRRRPDWRDIRPTLKTLAKVPSVLRTLVSGGDDAVLRMAMDLIEASGA 131

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL  +G +G      D  RDI A + +A AL  LDVGQ AV+IGGRVVA
Sbjct: 132 RVIGAHEVVPGLLADIGPIGEHTSTDDDLRDIEAGIAAANALGTLDVGQGAVAIGGRVVA 191

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ + + +GR+ + + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 192 LEGAEGTDAMLARVAELKADGRVSSRRRGVLVKLCKPQQDERADLPSIGPSTVAGAEAAG 251

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAGIA+EAG++LVLE+  V + A+ +G+FV GI+R
Sbjct: 252 LAGIAVEAGRALVLERPAVIETANRSGLFVLGIER 286


>gi|159184741|ref|NP_354392.2| hypothetical protein Atu1385 [Agrobacterium tumefaciens str. C58]
 gi|159140029|gb|AAK87177.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 267

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 172/256 (67%)

Query: 25  NDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDL 84
            + P I  + ++  +DW  F+   + +GD   L  +L +  + R+V++GA+ RRP  +++
Sbjct: 2   GENPFIVRLRDDSRYDWSGFDNAVISVGDVAGLGRLLRENQVDRVVLSGAVARRPEWREI 61

Query: 85  CFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTC 144
             +    +++  ++  L+SGG+ A+L+  I ++ + G  V+GAHEI P LL   G LG  
Sbjct: 62  RPTAGILIKLPSIVKTLLSGGDDAVLQMVIKIISTLGAKVIGAHEIAPGLLATTGPLGGQ 121

Query: 145 VPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGR 204
            P  +  +DI  A ++A AL +LDVGQ AVS+GGR+VALEGIEGTD+ML R+   R  GR
Sbjct: 122 KPAEEDLKDIRGAAEAALALGKLDVGQGAVSVGGRIVALEGIEGTDAMLARVAALRAEGR 181

Query: 205 ILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKH 264
           I   + GVLVK+CK QQD+RADLP+IG +TV+N  KAGLAGIA+EAG++LVL++E + K 
Sbjct: 182 ISPRRKGVLVKLCKPQQDIRADLPTIGIETVENAKKAGLAGIAVEAGRALVLDREAMLKA 241

Query: 265 ADEAGIFVCGIDREFA 280
           ADEAGIFVCGID    
Sbjct: 242 ADEAGIFVCGIDTSLG 257


>gi|170785432|gb|ACB37712.1| phosphatidate cytidyltransferase [Candidatus Liberibacter
           asiaticus]
          Length = 122

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 115/116 (99%), Positives = 115/116 (99%)

Query: 86  FSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCV 145
           FSIKDSLRISKMIWQLVSGGNAAILKASID LESYGVSVVGAHEIVPELLVQVGSLGTCV
Sbjct: 7   FSIKDSLRISKMIWQLVSGGNAAILKASIDFLESYGVSVVGAHEIVPELLVQVGSLGTCV 66

Query: 146 PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN 201
           PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN
Sbjct: 67  PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN 122


>gi|163760894|ref|ZP_02167973.1| hypothetical protein HPDFL43_07107 [Hoeflea phototrophica DFL-43]
 gi|162281938|gb|EDQ32230.1| hypothetical protein HPDFL43_07107 [Hoeflea phototrophica DFL-43]
          Length = 299

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 119/274 (43%), Positives = 174/274 (63%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL I+AG G  P  VA +AR     P + ++  E   DW  ++   L +G+      I  
Sbjct: 13  RLGILAGRGSFPQVVAASARALEHNPFVFTIDGEADQDWSGYDTASLNIGNLSAFMDIAR 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           + +IG +V+AG I RRP ++D+  +          +  L+SGG+  IL+A+I +LE++G+
Sbjct: 73  RESIGTVVLAGGIARRPGLRDIRPTWAALKSAPSALKALLSGGDDKILRAAIHVLETHGM 132

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+ A EI P+LL + G LG   P +  + +I AA ++A AL  LD+GQ AV++ GRV+A
Sbjct: 133 CVLAAQEIAPDLLGEAGPLGDHRPGKSDQANIAAATQAALALGHLDIGQGAVAVSGRVIA 192

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML+R+   R NGR+ AG  GVLVK+CK  Q+ RADLP+IG  TV N   +G
Sbjct: 193 LEGLEGTDGMLRRVAGLRANGRLRAGSRGVLVKLCKPGQEQRADLPAIGPDTVLNAHASG 252

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           LAG+A+EAG+SLVLE++ V   A+  G+FV G++
Sbjct: 253 LAGVAIEAGRSLVLERDRVIAEANRLGLFVTGLE 286


>gi|239832037|ref|ZP_04680366.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824304|gb|EEQ95872.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 315

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 171/278 (61%), Gaps = 4/278 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAG+G+LP  VA+A     + P +  +  E       +E +E+ + +F  L   + 
Sbjct: 34  RVAIIAGNGLLPINVAEALATAGNSPFLVPLRGEADPILYKYEHQEISIVEFAKLVRSMK 93

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V DL      +LR    + + +  G+ A+L+A I LLES+G 
Sbjct: 94  AAGVDRVVLAGGVTSRPHVSDLKLDWP-TLRAVPYVLRALGQGDDALLRAFIGLLESFGF 152

Query: 123 SVVGAHEIVPELLVQVGS--LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
            VVGAHE+VP+LL    +  L   VP+   + ++  AM+SA  L +LDVGQ A+++GGRV
Sbjct: 153 KVVGAHEVVPDLLSPSPAQILTRAVPDSRERHNLELAMESALRLGDLDVGQGAIAVGGRV 212

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEG EGTD M++R+ + R   RI   + GVLVKM K QQD RADLP+IG  TV+N  K
Sbjct: 213 VALEGAEGTDQMIERVRELRAARRI-PRRGGVLVKMAKPQQDERADLPTIGISTVENAAK 271

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AGL+GIA+EAG++ +L        A++ G+F+  + RE
Sbjct: 272 AGLSGIAVEAGRTFILGFGETIAAANDEGLFIETVSRE 309


>gi|153009370|ref|YP_001370585.1| hypothetical protein Oant_2040 [Ochrobactrum anthropi ATCC 49188]
 gi|151561258|gb|ABS14756.1| protein of unknown function DUF1009 [Ochrobactrum anthropi ATCC
           49188]
          Length = 299

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 170/278 (61%), Gaps = 4/278 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAG+G+LP  VA+A      +P +  +  E       +E +E+ + +F  L   + 
Sbjct: 18  RVAIIAGNGLLPISVAEALEAAEKKPFLVPLRGEADPVLYKYEHQEISIVEFAKLVRSMK 77

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V DL F    +LR    + + +  G+ A+L+A I LLES+G 
Sbjct: 78  AAGVDRVVLAGGVTSRPHVSDLKFDWP-TLRAVPYVLRALGQGDDALLRAFIGLLESFGF 136

Query: 123 SVVGAHEIVPELLVQVGS--LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
            VVGAH++VP LL    +  L    P+   + ++  AM+SA  L +LDVGQ AV++GGRV
Sbjct: 137 KVVGAHDVVPNLLSPSPAQILTRNAPDARERHNLELAMESALRLGDLDVGQGAVAVGGRV 196

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEG EGTD M++R+ + R  GRI   + GVLVKM K +QD RADLP+IG  T+ N +K
Sbjct: 197 VALEGAEGTDQMIERVRELRAAGRI-PRRGGVLVKMAKPRQDERADLPTIGISTIDNAVK 255

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AGL+GIA+EAG++ +L        A+  G+F+  + RE
Sbjct: 256 AGLSGIAVEAGRTFILGFGETIAAANAEGLFIETVSRE 293


>gi|265984208|ref|ZP_06096943.1| phosphatidate cytidyltransferase [Brucella sp. 83/13]
 gi|264662800|gb|EEZ33061.1| phosphatidate cytidyltransferase [Brucella sp. 83/13]
          Length = 308

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 173/277 (62%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 28  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 87

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 88  AAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 146

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL  + + L    P+   +R+I  AM++A  L +LDVGQ A++ GGRVV
Sbjct: 147 KVVGAHEVVPDLLSPLPACLTRITPDARERRNIALAMEAALKLGDLDVGQGAIAAGGRVV 206

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 207 ALEGAEGTDLMIERVCELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 265

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 266 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 302


>gi|254719213|ref|ZP_05181024.1| hypothetical protein Bru83_06676 [Brucella sp. 83/13]
 gi|306837961|ref|ZP_07470819.1| phosphatidate cytidyltransferase [Brucella sp. NF 2653]
 gi|306406885|gb|EFM63106.1| phosphatidate cytidyltransferase [Brucella sp. NF 2653]
          Length = 300

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 173/277 (62%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  AAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL  + + L    P+   +R+I  AM++A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPLPACLTRITPDARERRNIALAMEAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVCELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|148559345|ref|YP_001259069.1| hypothetical protein BOV_1108 [Brucella ovis ATCC 25840]
 gi|148370602|gb|ABQ60581.1| conserved hypothetical protein TIGR00148 [Brucella ovis ATCC 25840]
          Length = 300

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  R     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLRNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+E G++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEVGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|225627618|ref|ZP_03785655.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260883904|ref|ZP_05895518.1| phosphatidate cytidyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261219498|ref|ZP_05933779.1| phosphatidate cytidyltransferase [Brucella ceti M13/05/1]
 gi|261222317|ref|ZP_05936598.1| phosphatidate cytidyltransferase [Brucella ceti B1/94]
 gi|261317784|ref|ZP_05956981.1| phosphatidate cytidyltransferase [Brucella pinnipedialis B2/94]
 gi|261321993|ref|ZP_05961190.1| phosphatidate cytidyltransferase [Brucella ceti M644/93/1]
 gi|261325240|ref|ZP_05964437.1| phosphatidate cytidyltransferase [Brucella neotomae 5K33]
 gi|261752455|ref|ZP_05996164.1| phosphatidate cytidyltransferase [Brucella suis bv. 5 str. 513]
 gi|261758340|ref|ZP_06002049.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988815|ref|ZP_06101372.1| phosphatidate cytidyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265991230|ref|ZP_06103787.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995066|ref|ZP_06107623.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265999443|ref|ZP_05466390.2| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|225617623|gb|EEH14668.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260873432|gb|EEX80501.1| phosphatidate cytidyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260920901|gb|EEX87554.1| phosphatidate cytidyltransferase [Brucella ceti B1/94]
 gi|260924587|gb|EEX91155.1| phosphatidate cytidyltransferase [Brucella ceti M13/05/1]
 gi|261294683|gb|EEX98179.1| phosphatidate cytidyltransferase [Brucella ceti M644/93/1]
 gi|261297007|gb|EEY00504.1| phosphatidate cytidyltransferase [Brucella pinnipedialis B2/94]
 gi|261301220|gb|EEY04717.1| phosphatidate cytidyltransferase [Brucella neotomae 5K33]
 gi|261738324|gb|EEY26320.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261742208|gb|EEY30134.1| phosphatidate cytidyltransferase [Brucella suis bv. 5 str. 513]
 gi|262766179|gb|EEZ11968.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002014|gb|EEZ14589.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093989|gb|EEZ17923.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661012|gb|EEZ31273.1| phosphatidate cytidyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 308

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 171/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 28  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 87

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 88  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 146

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 147 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 206

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 207 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 265

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 266 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 302


>gi|17987117|ref|NP_539751.1| hypothetical protein BMEI0834 [Brucella melitensis bv. 1 str. 16M]
 gi|62290063|ref|YP_221856.1| hypothetical protein BruAb1_1156 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699989|ref|YP_414563.1| hypothetical protein BAB1_1172 [Brucella melitensis biovar Abortus
           2308]
 gi|189024303|ref|YP_001935071.1| hypothetical protein BAbS19_I10900 [Brucella abortus S19]
 gi|225852648|ref|YP_002732881.1| hypothetical protein BMEA_A1194 [Brucella melitensis ATCC 23457]
 gi|254689374|ref|ZP_05152628.1| hypothetical protein Babob68_04212 [Brucella abortus bv. 6 str.
           870]
 gi|254693858|ref|ZP_05155686.1| hypothetical protein Babob3T_04207 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697507|ref|ZP_05159335.1| hypothetical protein Babob28_07326 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701891|ref|ZP_05163719.1| hypothetical protein Bsuib55_13692 [Brucella suis bv. 5 str. 513]
 gi|254706667|ref|ZP_05168495.1| hypothetical protein BpinM_06689 [Brucella pinnipedialis
           M163/99/10]
 gi|254710225|ref|ZP_05172036.1| hypothetical protein BpinB_08122 [Brucella pinnipedialis B2/94]
 gi|254714221|ref|ZP_05176032.1| hypothetical protein BcetM6_12896 [Brucella ceti M644/93/1]
 gi|254717657|ref|ZP_05179468.1| hypothetical protein BcetM_14895 [Brucella ceti M13/05/1]
 gi|254730404|ref|ZP_05188982.1| hypothetical protein Babob42_04232 [Brucella abortus bv. 4 str.
           292]
 gi|256031719|ref|ZP_05445333.1| hypothetical protein BpinM2_13894 [Brucella pinnipedialis
           M292/94/1]
 gi|256044806|ref|ZP_05447710.1| hypothetical protein Bmelb1R_09954 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061232|ref|ZP_05451383.1| hypothetical protein Bneo5_12823 [Brucella neotomae 5K33]
 gi|256113711|ref|ZP_05454515.1| hypothetical protein Bmelb3E_13133 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159882|ref|ZP_05457606.1| hypothetical protein BcetM4_12889 [Brucella ceti M490/95/1]
 gi|256255119|ref|ZP_05460655.1| hypothetical protein BcetB_12676 [Brucella ceti B1/94]
 gi|256257620|ref|ZP_05463156.1| hypothetical protein Babob9C_09789 [Brucella abortus bv. 9 str.
           C68]
 gi|256369575|ref|YP_003107085.1| hypothetical protein BMI_I1161 [Brucella microti CCM 4915]
 gi|260168852|ref|ZP_05755663.1| hypothetical protein BruF5_10896 [Brucella sp. F5/99]
 gi|260546614|ref|ZP_05822353.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565594|ref|ZP_05836078.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754892|ref|ZP_05867240.1| phosphatidate cytidyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758109|ref|ZP_05870457.1| phosphatidate cytidyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260761933|ref|ZP_05874276.1| phosphatidate cytidyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214144|ref|ZP_05928425.1| phosphatidate cytidyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|294852490|ref|ZP_06793163.1| hypothetical protein BAZG_01417 [Brucella sp. NVSL 07-0026]
 gi|297248462|ref|ZP_06932180.1| hypothetical protein BAYG_01418 [Brucella abortus bv. 5 str. B3196]
 gi|17982779|gb|AAL52015.1| hypothetical protein BMEI0834 [Brucella melitensis bv. 1 str. 16M]
 gi|62196195|gb|AAX74495.1| conserved hypothetical protein TIGR00148 [Brucella abortus bv. 1
           str. 9-941]
 gi|82616090|emb|CAJ11128.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019875|gb|ACD72597.1| hypothetical protein BAbS19_I10900 [Brucella abortus S19]
 gi|225641013|gb|ACO00927.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999737|gb|ACU48136.1| hypothetical protein BMI_I1161 [Brucella microti CCM 4915]
 gi|260095664|gb|EEW79541.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151662|gb|EEW86756.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668427|gb|EEX55367.1| phosphatidate cytidyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672365|gb|EEX59186.1| phosphatidate cytidyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675000|gb|EEX61821.1| phosphatidate cytidyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260915751|gb|EEX82612.1| phosphatidate cytidyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|294821079|gb|EFG38078.1| hypothetical protein BAZG_01417 [Brucella sp. NVSL 07-0026]
 gi|297175631|gb|EFH34978.1| hypothetical protein BAYG_01418 [Brucella abortus bv. 5 str. B3196]
 gi|326409169|gb|ADZ66234.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538879|gb|ADZ87094.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 300

 Score =  199 bits (505), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 171/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|237815571|ref|ZP_04594568.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|261314127|ref|ZP_05953324.1| phosphatidate cytidyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|265998280|ref|ZP_06110837.1| phosphatidate cytidyltransferase [Brucella ceti M490/95/1]
 gi|237788869|gb|EEP63080.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|261303153|gb|EEY06650.1| phosphatidate cytidyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|262552748|gb|EEZ08738.1| phosphatidate cytidyltransferase [Brucella ceti M490/95/1]
          Length = 305

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 171/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 25  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 84

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 85  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 143

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 144 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 203

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 204 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 262

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 263 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 299


>gi|306844014|ref|ZP_07476609.1| phosphatidate cytidyltransferase [Brucella sp. BO1]
 gi|306275769|gb|EFM57493.1| phosphatidate cytidyltransferase [Brucella sp. BO1]
          Length = 300

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 114/277 (41%), Positives = 171/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ I+ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAIVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  AAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALRLGDLDVGQGAIATGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRMAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|23502028|ref|NP_698155.1| hypothetical protein BR1150 [Brucella suis 1330]
 gi|23347982|gb|AAN30070.1| conserved hypothetical protein TIGR00148 [Brucella suis 1330]
          Length = 300

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNTGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|161619102|ref|YP_001592989.1| hypothetical protein BCAN_A1169 [Brucella canis ATCC 23365]
 gi|163843415|ref|YP_001627819.1| hypothetical protein BSUIS_A1198 [Brucella suis ATCC 23445]
 gi|260566316|ref|ZP_05836786.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335913|gb|ABX62218.1| Hypothetical protein BCAN_A1169 [Brucella canis ATCC 23365]
 gi|163674138|gb|ABY38249.1| Hypothetical protein BSUIS_A1198 [Brucella suis ATCC 23445]
 gi|260155834|gb|EEW90914.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 300

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|254704437|ref|ZP_05166265.1| hypothetical protein Bsuib36_11015 [Brucella suis bv. 3 str. 686]
          Length = 300

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM ++  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDASLKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|261755115|ref|ZP_05998824.1| phosphatidate cytidyltransferase [Brucella suis bv. 3 str. 686]
 gi|261744868|gb|EEY32794.1| phosphatidate cytidyltransferase [Brucella suis bv. 3 str. 686]
          Length = 305

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 25  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 84

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 85  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 143

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM ++  L +LDVGQ A++ GGRVV
Sbjct: 144 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDASLKLGDLDVGQGAIAAGGRVV 203

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 204 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 262

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 263 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 299


>gi|218662215|ref|ZP_03518145.1| hypothetical protein RetlI_23447 [Rhizobium etli IE4771]
          Length = 165

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 100/157 (63%), Positives = 118/157 (75%)

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVGAHEI P+LL  VG LG  VP  + +RD   A ++AE L  LDVGQ AVSIGGRV
Sbjct: 1   GRRVVGAHEIAPDLLAAVGPLGAVVPGEEDRRDTNRAAEAAETLGRLDVGQGAVSIGGRV 60

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEG+EGTD ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG  TV N +K
Sbjct: 61  VALEGLEGTDDMLDRVAGLRAAGRISPRRRGVLVKLCKPQQDIRADLPAIGVSTVLNAVK 120

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AGLAGIA+EAG+SLVL++  V + ADEAG+FVCGIDR
Sbjct: 121 AGLAGIAVEAGRSLVLDRAAVIRAADEAGLFVCGIDR 157


>gi|118589999|ref|ZP_01547403.1| hypothetical protein SIAM614_15080 [Stappia aggregata IAM 12614]
 gi|118437496|gb|EAV44133.1| hypothetical protein SIAM614_15080 [Stappia aggregata IAM 12614]
          Length = 301

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 164/280 (58%), Gaps = 2/280 (0%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL +IAG+G LP  +A A      E  I ++  E     +     EL  G+   L   L 
Sbjct: 11  RLALIAGNGSLPCQIADALSNAGREFKIIAIKGEADERTRAQADTELGWGEIGRLYKFLK 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     +++ G + +RP+   +   I    R+  +I  L +GG+ ++L   I L E  G 
Sbjct: 71  KTGCRDVLLIGGVSKRPDFTSILGDIGTLKRLPTIIRAL-AGGDDSLLTKVIRLFEVEGY 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVG  ++ P+LL   G LG   P++   RD   A+++ E L ELD+GQ+AV++GGRVVA
Sbjct: 130 RVVGIKDVAPQLLASSGVLGKVQPSQTDWRDAELALRACEKLGELDIGQAAVAVGGRVVA 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           LEG EGTD+MLQR  D + NGRI A   +GVLVK  K  QD+R DLP++G KT+   + A
Sbjct: 190 LEGAEGTDAMLQRCADLKRNGRIRAKSHTGVLVKTAKPNQDLRVDLPTVGPKTIDLAVAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           GLAGIA+EA  +L+ EK++  K AD+AG+FV GI+   +I
Sbjct: 250 GLAGIAVEASGALIAEKDVTLKKADDAGLFVIGIEHGSSI 289


>gi|307942154|ref|ZP_07657505.1| phosphatidate cytidyltransferase [Roseibium sp. TrichSKD4]
 gi|307774440|gb|EFO33650.1| phosphatidate cytidyltransferase [Roseibium sp. TrichSKD4]
          Length = 291

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 162/275 (58%), Gaps = 2/275 (0%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ +IAG+G LP  V    + +  +  I ++  E S   +     EL  G+   L   L 
Sbjct: 13  RIAVIAGNGALPEQVVSVLQSRGRDHRIVAIKGEASETTRQAAAVELGWGEIGRLYRFLE 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     I++ G I +RP+++          R+ K++  L+ GG+ ++LK  I L E+ G 
Sbjct: 73  RSGCDEILLIGGISQRPDLRSFVGDFGTLRRLPKILKALI-GGDDSLLKKVIGLFETEGY 131

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           SVVG  ++  ELL + G++G   P+    RD+  A+ + + L ELD+GQ+AV+IGGRVVA
Sbjct: 132 SVVGIKDVASELLAEAGTMGRHQPSDSNLRDLRLALAATQKLGELDIGQAAVAIGGRVVA 191

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           LEG EGTD+ML+R    R+ GR+     +GVLVK  K  QD+R DLP+IG +TV    KA
Sbjct: 192 LEGAEGTDAMLERCQQLRDTGRVKGRTPAGVLVKSAKPTQDLRVDLPAIGPRTVDLAHKA 251

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           GLAG+A+ AG +LV E++L    A+E G+F+ G D
Sbjct: 252 GLAGVAVHAGNALVSERDLTLSKANELGLFIYGFD 286


>gi|306841874|ref|ZP_07474554.1| phosphatidate cytidyltransferase [Brucella sp. BO2]
 gi|306288004|gb|EFM59406.1| phosphatidate cytidyltransferase [Brucella sp. BO2]
          Length = 267

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 157/252 (62%), Gaps = 3/252 (1%)

Query: 28  PVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFS 87
           P +  +  E      D+E +E+ + +F  L   +    + R+V+AG +  RP+V+DL F 
Sbjct: 12  PFLVPLRGEADPVLYDYEHQEISVVEFAKLVRSMKAAGVSRVVLAGGVRNRPHVRDLKFD 71

Query: 88  IKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGS-LGTCVP 146
              +LR    +   +  G+ A+L+A I LLES+G  VVGAHE+VP+LL    + L    P
Sbjct: 72  WP-TLRAVPHVLGALGKGDDALLRAFIGLLESFGFKVVGAHEVVPDLLSPPPACLTRITP 130

Query: 147 NRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRIL 206
           +   +R+I  AM +A  L +LDVGQ A++ GGRVVALEG EGTD M++R+ + R  GRI 
Sbjct: 131 DARERRNIALAMDAALRLGDLDVGQGAIAAGGRVVALEGAEGTDLMIERVRELRMAGRI- 189

Query: 207 AGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHAD 266
           + + GVLVKM K +QD RADLP+IG  TV+N  +AGLAGIA+EAG++ +L        A+
Sbjct: 190 SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERAGLAGIAIEAGRTFILGFGETLAAAN 249

Query: 267 EAGIFVCGIDRE 278
           + G+F+  I R+
Sbjct: 250 KKGLFIETISRD 261


>gi|170785431|gb|ACB37711.1| lipid A biosynthesis
           acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
           O-acyltransferase [Candidatus Liberibacter asiaticus]
          Length = 363

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/86 (98%), Positives = 86/86 (100%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           +KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI
Sbjct: 276 VKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 335

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCF 86
           LHQYNIGRIVVAGAIDRRPNVQDLCF
Sbjct: 336 LHQYNIGRIVVAGAIDRRPNVQDLCF 361


>gi|254502036|ref|ZP_05114187.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222438107|gb|EEE44786.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 294

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 159/273 (58%), Gaps = 2/273 (0%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           +IAG+G +P  VA A      E  + ++  E     +     EL  G+   L + L++  
Sbjct: 14  LIAGNGRIPLQVATALAAAGRECKVVAIRGEADAATRSLASAELGWGEIGRLYAFLNKSG 73

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
              +++ G + +RP+   +   +  +LR    I + ++GG+ ++L   I L E  G  VV
Sbjct: 74  CRDVMLIGGVSKRPDFASILGDLG-TLRRLPTIIRALTGGDDSLLTKVIGLFEVEGFRVV 132

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
           G  ++ P LL   G LG   P     +DI  A+ +   L ELD+GQ+AV++GGRVVALEG
Sbjct: 133 GIKDVAPGLLAASGVLGKTQPRDTDWQDIQLALTATRKLGELDIGQAAVAVGGRVVALEG 192

Query: 186 IEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            EGTD+ML+R  D R +GRI A  K+GVLVK  K  QD+R DLP+IG +T++    AGLA
Sbjct: 193 AEGTDAMLERCADLRGSGRIRAKNKTGVLVKTAKPNQDLRVDLPTIGPRTIERADAAGLA 252

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GIA+EAG +L+ ++E     AD AG+FV GID+
Sbjct: 253 GIAIEAGGALISDREETLAQADRAGLFVIGIDQ 285


>gi|13470831|ref|NP_102400.1| hypothetical protein mll0631 [Mesorhizobium loti MAFF303099]
 gi|14021574|dbj|BAB48186.1| mll0631 [Mesorhizobium loti MAFF303099]
          Length = 304

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 160/277 (57%), Gaps = 7/277 (2%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ----DFECRELPLGDFCVLR 58
           R+ IIAG G LP  VA  +  +   P I  VL E   D       +E   L L     L 
Sbjct: 23  RVGIIAGGGSLPVEVAAGSAGQGYPPFI--VLMEGEADRLTELCQYEHETLALEAIGSLV 80

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +L ++ I  +V+AG I RRP +  L  S+   L +  ++   ++ G+  +LK     LE
Sbjct: 81  PLLKRHRITHLVLAGEIKRRPRLTHLRPSL-SLLAVIPIVVMALARGDDGLLKVVARGLE 139

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + G+ ++GAHEIVP L+   G L   VP +   RDI A   +A+A+  LD+GQ+A+++GG
Sbjct: 140 ARGIKIMGAHEIVPNLVAAEGVLTKAVPQKSDWRDIEAGFAAAKAIGALDIGQAAIAVGG 199

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
           R +ALEGIEGT  +L R    R +GRI     GVLVK  K  Q++RADLPS+G +TV+  
Sbjct: 200 RAIALEGIEGTAGLLDRAKLLRGHGRIAGKTRGVLVKCAKPGQELRADLPSMGPQTVEAA 259

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             AGLAGIA+EAG+SL+LE       A+E G+F+ G+
Sbjct: 260 HAAGLAGIAVEAGRSLILEGPATLSRANELGLFIVGL 296


>gi|260459225|ref|ZP_05807480.1| protein of unknown function DUF1009 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034779|gb|EEW36035.1| protein of unknown function DUF1009 [Mesorhizobium opportunistum
           WSM2075]
          Length = 305

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/278 (43%), Positives = 166/278 (59%), Gaps = 9/278 (3%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD----FECRELPLGDFCVLR 58
           R+ IIAG G LP  VA         P+I  +L +   D Q     +E   L L D   L 
Sbjct: 23  RVGIIAGGGSLPVEVAAGLAEAGHPPII--ILVDGQADRQSDLIIYEHESLALEDIGSLA 80

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           ++L +  I  +V+AG I RRP + DL  S+   L +   +   ++ G+  +LK     LE
Sbjct: 81  ALLRRQRITHLVLAGEIRRRPRLVDLRPSL-GLLGLIPSVAMALARGDDGLLKILTRGLE 139

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + GV VVGAHE+VP L+   G L   VP +   RDI AA  +A+A+  LD+GQ+A++IGG
Sbjct: 140 ARGVKVVGAHEVVPRLVATEGPLTKAVPRKSDWRDIEAARAAAKAIGALDIGQAAIAIGG 199

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQN 237
           R +ALEG+EGT  +L+R    R +GR LAGK+ GVLVK  K  Q++RADLPSIG +TV+ 
Sbjct: 200 RAIALEGVEGTHGLLERTQQLRGHGR-LAGKTRGVLVKCAKPGQELRADLPSIGPRTVEA 258

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
              AGLAGIA+EAG SL+LE   V   A+  G+FV G+
Sbjct: 259 AHAAGLAGIAVEAGHSLILEGPHVLARANALGLFVFGL 296


>gi|319408405|emb|CBI82060.1| phosphatidate cytidyltransferase [Bartonella schoenbuchensis R1]
          Length = 290

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 109/276 (39%), Positives = 166/276 (60%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAG+G+LP  VA+A   +  +P +  + +E      ++E  EL +G+   L   L 
Sbjct: 13  RVAIIAGNGILPVAVARALEERGQKPFLVLLRDEADAALYNYEHCELSIGELARLFKTLK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  I  +++AG + +RP +  L       L + K+   L SG ++ +LKA I ++E++G 
Sbjct: 73  KAAICNVILAGGVKKRPTLLQLRPDWTTLLALPKLFKALGSGDDS-LLKACIRVIEAHGF 131

Query: 123 SVVGAHEIVPELLVQVG-SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHE++P+LL  +  +L +    +    DI  A K+   L +LDVGQ+AV+I GRVV
Sbjct: 132 QVIGAHEVLPDLLAPIEFNLTSRRATQKENVDIQLAAKATRLLGQLDVGQAAVAINGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD ML+R+ + R   +I   K GVLVK  K QQD R DLPSIG  TV NV K+
Sbjct: 192 ALEGAEGTDDMLRRVHEMRERKQI-PLKGGVLVKSAKPQQDHRVDLPSIGPTTVINVAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL GIA+EA +SL+L  +   + A++  +F+   ++
Sbjct: 251 GLVGIAVEANRSLILSLKETIEEANKHSLFIETFEK 286


>gi|319404361|emb|CBI77961.1| phosphatidate cytidyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 290

 Score =  178 bits (451), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 110/271 (40%), Positives = 160/271 (59%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+    +   P +  +  E      D+E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPTVVAQELEKRGQNPFLVLLRGEADMALYDYEHCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  I++AG + +RP++  L         +SK+   L SG +  +L+A I +LE YG 
Sbjct: 73  AAEIHNIILAGGVKKRPSLLQLRPDWTTLSVLSKLFKALRSGDDT-LLRAFIRILEDYGF 131

Query: 123 SVVGAHEIVPELLVQVG-SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHE+VP+LL  +  +L     N     DIL A ++A +L  LD+GQ+AV+I GRVV
Sbjct: 132 CVIGAHEVVPDLLAPIEFNLTVQRANSKQNADILLAAEAARSLGRLDIGQAAVAIDGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  +GTD+ML+R+ + R   +I+  + GVLVK  K QQD R DLPSIG  TV N  K+
Sbjct: 192 AVEDSKGTDNMLKRVQEMRERQKIVP-QGGVLVKCVKPQQDHRVDLPSIGPTTVINAAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 251 GLSGIAVEAKKSLILSLEKTIEEANKRSLFI 281


>gi|319783660|ref|YP_004143136.1| hypothetical protein Mesci_3971 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169548|gb|ADV13086.1| protein of unknown function DUF1009 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 305

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 159/277 (57%), Gaps = 7/277 (2%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD----WQDFECRELPLGDFCVLR 58
           R+ IIAG G LP  VA  +  +   P +  +L E   D       ++   L L     L 
Sbjct: 23  RVGIIAGGGSLPVEVAAGSAEQGYPPFV--ILMEGEVDRIAELSRYDHESLALEGIGSLV 80

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +L ++ I  +V+AG I RRP +  L  S+   L +  ++   ++ G+  +LK     LE
Sbjct: 81  PLLRRHRITHLVLAGEIKRRPRLLALRPSL-SLLAVIPLVVMALARGDDGLLKVLARGLE 139

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + G+ VVGAHE+VP L+   G L    P +   RDI A + +A+A+  LD+GQ+A++IGG
Sbjct: 140 ARGIKVVGAHEVVPSLVAAEGVLTNAAPQKSDWRDIEAGLDAAKAIGALDIGQAAIAIGG 199

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
           R +ALEGIEGT  +L+R    R +GRI     GVLVK  K  Q++RADLPSIG +TV+  
Sbjct: 200 RTIALEGIEGTAGLLERAKLLRGHGRIAGKTRGVLVKCAKPGQELRADLPSIGLQTVEAA 259

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             A LAGIA+EAG+SLVLE       A+  G+FV G+
Sbjct: 260 HAAELAGIAVEAGRSLVLEGPETIARANALGLFVIGL 296


>gi|1262295|gb|AAA96792.1| ORF9; hypothetical protein [Brucella abortus]
          Length = 323

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 153/258 (59%), Gaps = 3/258 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDWP-TLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL    + L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N    
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENPSVR 257

Query: 242 GLAGIALEAGKSLVLEKE 259
           G  G+    G+ L L  E
Sbjct: 258 GWRGLPSRPGEPLFLVSE 275


>gi|49475420|ref|YP_033461.1| phosphatidate cytidyltransferase [Bartonella henselae str.
           Houston-1]
 gi|49238226|emb|CAF27436.1| Phosphatidate cytidyltransferase [Bartonella henselae str.
           Houston-1]
          Length = 290

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 111/271 (40%), Positives = 162/271 (59%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  +A+        P +  + +E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPITIAQELEKNGQNPFLVLLRDEADALLYRYEHCELSIVELARLVKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  IV+AG + RRP ++ L F     L + K+I  L  GG+  +LKA + ++E++G 
Sbjct: 73  AAEICNIVLAGGVKRRPLLKQLQFDWTTFLALPKLIGAL-KGGDDVLLKAFVRIIEAHGF 131

Query: 123 SVVGAHEIVPELLV-QVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            ++GAHEIVP LL  +   L      R  K+DIL A ++A+ L  LD+GQ+AV I GRV+
Sbjct: 132 CIIGAHEIVPNLLAPREFDLTLRRATRKEKKDILLAAEAAKLLGRLDIGQAAVVINGRVI 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD+ML R+ + R  G+I   K GVLVK  K QQD R DLPSIG  T+ N+ K+
Sbjct: 192 AVEGAEGTDNMLWRVCEMRERGQI-PPKGGVLVKCAKPQQDHRVDLPSIGPMTIMNIAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA +SL+L  +   + A++  +F+
Sbjct: 251 GLSGIAVEANRSLILSVKTTIEKANKYSLFI 281


>gi|110633745|ref|YP_673953.1| hypothetical protein Meso_1392 [Mesorhizobium sp. BNC1]
 gi|110284729|gb|ABG62788.1| protein of unknown function DUF1009 [Chelativorans sp. BNC1]
          Length = 297

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 102/257 (39%), Positives = 157/257 (61%), Gaps = 3/257 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSI 60
           R+ ++AGSG+LP  VA         P++ ++  E   + +   ++   +   +   L SI
Sbjct: 18  RIAVVAGSGLLPREVANGLVRAGHRPLVVAITGEADLEDEPARYDFMRVTHEELGKLLSI 77

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  +  +V+AG + RRP +  L +S K  L + ++      G +  +L+A I  +ESY
Sbjct: 78  LKRRGVTHLVLAGGVARRPPLSTLRYSPKILLYLPRLAAGYARGDDG-LLRAIIGFIESY 136

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+  VGAHE+VPELL   G L    P    ++DI AA+ +A A+  LD+GQ+AV++GGRV
Sbjct: 137 GIKPVGAHEVVPELLAPAGLLTGTAPTSSDEKDISAAIAAARAIGRLDIGQAAVAVGGRV 196

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +ALE IEGTD +L+R    R +GR+     GVLVK  K  Q++R DLP+IG +TV++  +
Sbjct: 197 IALEDIEGTDGLLRRAKALRTHGRLAGKTRGVLVKCAKPAQELRVDLPTIGPQTVKDAHE 256

Query: 241 AGLAGIALEAGKSLVLE 257
           AGLAGIA+E+ +SL+LE
Sbjct: 257 AGLAGIAVESERSLILE 273


>gi|319407365|emb|CBI81012.1| phosphatidate cytidyltransferase [Bartonella sp. 1-1C]
          Length = 290

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/272 (38%), Positives = 161/272 (59%), Gaps = 5/272 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+    +   P +  +  E      D+E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPTVVAQELEKRGQNPFLVLLRGEADMTLYDYEHCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  +++AG + +RP++  L         +SK+   L SG +  +L+A I +LE YG 
Sbjct: 73  AAEIHNVILAGGVKKRPSLLQLRPDWTTLSALSKLFKALRSGDDT-LLRAFIRILEDYGF 131

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKR--DILAAMKSAEALSELDVGQSAVSIGGRV 180
            V+GAHE+VP+LL  +      V   + K+  DI+ A ++A +L  LD+GQ+AV++ G+V
Sbjct: 132 CVIGAHEVVPDLLAPI-EFNVTVQRANSKQNADIILAAEAARSLGRLDIGQAAVAVDGQV 190

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VA+E  +GTD+ML+R+ + R   +I+  + GVLVK  K QQD R DLPSIG  TV N  K
Sbjct: 191 VAVEDSKGTDNMLRRVQEMRERQKIVP-QGGVLVKCVKPQQDYRVDLPSIGPTTVINAAK 249

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           +GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 250 SGLSGIAVEAKKSLILSLEKTIEEANKRSLFI 281


>gi|254469396|ref|ZP_05082801.1| phosphatidate cytidyltransferase [Pseudovibrio sp. JE062]
 gi|211961231|gb|EEA96426.1| phosphatidate cytidyltransferase [Pseudovibrio sp. JE062]
          Length = 286

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 157/275 (57%), Gaps = 2/275 (0%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +IAG G LP  V ++A  +  E V  ++  E       F   EL  G    L S L  
Sbjct: 7   IAVIAGGGDLPGLVIRSAMAQGREVVTIAIKGEADASLSAFNPVELGWGQIGKLFSTLKS 66

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +V+ G + RRP+   +        R+ ++I  +V G +  ++K +  + E  G+ 
Sbjct: 67  KGVRDVVLIGGVQRRPDFTSILGDFGTMWRLPRIIAAVVGGDDHLLVKVA-GIFEREGLH 125

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVGAHE+ PEL+   G +    P++    D+  A+++ +AL  LD+GQ A+++  RVVA+
Sbjct: 126 VVGAHEVAPELVASPGHVAGPKPSKKALSDMTLAIEAVDALGRLDIGQGAIAVNARVVAV 185

Query: 184 EGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           EG EGTD+ML+R+   R NGR+ + G +GVLVK  K QQD+R D+P IG +T++   +A 
Sbjct: 186 EGAEGTDAMLERVAVLRENGRVRSKGAAGVLVKCSKPQQDLRLDMPGIGPQTIRKAAEAQ 245

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           L G+ +EAG+ LV  ++ V++  DE G+F+ G  R
Sbjct: 246 LQGVCVEAGRVLVAHRDEVERLCDELGVFLYGCTR 280


>gi|328543723|ref|YP_004303832.1| phosphatidate cytidyltransferase [polymorphum gilvum SL003B-26A1]
 gi|326413467|gb|ADZ70530.1| Phosphatidate cytidyltransferase [Polymorphum gilvum SL003B-26A1]
          Length = 282

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 159/272 (58%), Gaps = 2/272 (0%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           IIAG G LP  +    R + +  ++ ++ +E + +       EL  G    L   L +  
Sbjct: 7   IIAGGGALPVQIVADLRARGEPVLVVAIRDEAAPELAATADAELGWGQIGQLFKTLKRGG 66

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
             R+++ GA+ RRP+   +   +    R+  ++  L+ GG+ ++L   I L E+ G+ VV
Sbjct: 67  CDRVLLIGAVSRRPDFASVVGDLGTMRRLPTILKALI-GGDDSLLTRVIGLFEADGLRVV 125

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
           G  ++ P LL   G +    P     RD+  A K+   L ELD+GQ+AV++GGRV+ALEG
Sbjct: 126 GVPDVAPSLLAPAGRICGREPADGALRDLRLAHKAVARLGELDIGQAAVALGGRVIALEG 185

Query: 186 IEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            EGTD+ML+R    R +GR+ A G++GVLVK  K  QD+R DLP+IG +T+   + A LA
Sbjct: 186 AEGTDAMLERCAGLRASGRVRAKGRAGVLVKAAKPGQDLRVDLPTIGPRTIDLAVAAQLA 245

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           GIA+EAG+SL+ +++     A+ AG+F+ G++
Sbjct: 246 GIAIEAGRSLIAQQDETVARAEAAGLFLYGLN 277


>gi|319405833|emb|CBI79465.1| phosphatidate cytidyltransferase [Bartonella sp. AR 15-3]
          Length = 290

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 160/273 (58%), Gaps = 7/273 (2%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAGSG+LP  VA+    +   P +  +  E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGSGVLPRVVAQELEKRGQNPFLVLLRGEADVALYSYEYCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  +++AG + +RP++  L         +SK+   L SG +  +L++ I +LE  G 
Sbjct: 73  ATEIRNVILAGGVKKRPSLLQLRADWATLSALSKLFKALRSGDDT-LLRSFIRILEDRGF 131

Query: 123 SVVGAHEIVPELLVQVG---SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            V+GAHEIVP+LL  +    ++    P ++   DIL A+++A  L  LD+GQ+AV+I GR
Sbjct: 132 CVIGAHEIVPDLLAPIEFDLTVQRATPKQNA--DILLAVEAARMLGRLDIGQAAVAIDGR 189

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E  EGTD+ML+R+ + R   +I+  + GVLVK  K QQD R DLPSIG  TV N  
Sbjct: 190 VVAVEDAEGTDNMLKRVQEMREKQQIVP-QGGVLVKCVKPQQDYRVDLPSIGPTTVINAA 248

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           K+GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 249 KSGLSGIAVEAKKSLILSLEKTIEEANKRSLFI 281


>gi|319899033|ref|YP_004159126.1| phosphatidate cytidyltransferase [Bartonella clarridgeiae 73]
 gi|319402997|emb|CBI76552.1| phosphatidate cytidyltransferase [Bartonella clarridgeiae 73]
          Length = 285

 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 159/273 (58%), Gaps = 8/273 (2%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+    +   P I  +  E       ++  EL + +   L  +L 
Sbjct: 9   RTAIIAGNGVLPIVVAQELEKRGQNPFIVLLRGEADVALYSYQHCELSIVELARLFKVLK 68

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  +++AG + +RP++  L         +SK+   L SG +  +LKA I ++E  G 
Sbjct: 69  ATEIHNVILAGGVKKRPSLLQLRPDWTTLSALSKLFKALRSGDDT-LLKAFIRVVEDRGF 127

Query: 123 SVVGAHEIVPELLVQVG---SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            VVGAHE+VP+LL  +    +L +  P +    DIL A+++A  L  LD+GQ+AV+I GR
Sbjct: 128 CVVGAHEVVPDLLAPIECNLTLQSATPKQSA--DILLAIEAARLLGRLDIGQAAVAIDGR 185

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E  +GTD+ML+R+ + R    +  G  GVLVK  K QQD R DLPSIG  TV NV 
Sbjct: 186 VVAVEDSKGTDNMLKRVQEIRERQHLPQG--GVLVKCAKPQQDYRVDLPSIGPTTVINVA 243

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           K+GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 244 KSGLSGIAVEAKKSLILSLEKTIEEANKHSLFI 276


>gi|121602728|ref|YP_988901.1| hypothetical protein BARBAKC583_0593 [Bartonella bacilliformis
           KC583]
 gi|120614905|gb|ABM45506.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 290

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 163/271 (60%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+A      +P +  +  E      ++E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPIAVAQALEECGQKPFLILLHGEAESALYNYEHCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  I  I++AG I +RP+   L F     L + K++ +++  G+  +LK+ I L+E+ G 
Sbjct: 73  EKEICNIILAGGIRKRPDFFKLHFDWTTLLALPKLL-KILGSGDDILLKSFIQLIEARGF 131

Query: 123 SVVGAHEIVPELLVQVG-SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL  +  SL +   ++  K  IL A K+A+ L  LD+GQ+ V I  RVV
Sbjct: 132 CVVGAHEVVPDLLAPMDFSLTSRRASQKEKNSILLAAKAAKLLGHLDIGQAVVVINNRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD ML+R+ + R   +I   K GVLVK  K QQD RADLPSIG  T+ N  K+
Sbjct: 192 AVEGAEGTDDMLKRVQEMRKKKQI-PSKGGVLVKCAKPQQDHRADLPSIGPTTIVNAAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL G+A+EAGKSL+L  +   + A++  +FV
Sbjct: 251 GLVGVAVEAGKSLILSCKRTIEEANKHSLFV 281


>gi|49474286|ref|YP_032328.1| phosphatidate cytidyltransferase [Bartonella quintana str.
           Toulouse]
 gi|49239790|emb|CAF26180.1| Phosphatidate cytidyltransferase [Bartonella quintana str.
           Toulouse]
          Length = 290

 Score =  167 bits (422), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 159/271 (58%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+A       P +  + +E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGILPITVAQALEKHGQNPFLVLLRDEADPVLYRYEHCELSIVELARLVKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  IV+AG + +RP +  L       L + K++     GG+ A+LKA I ++E++G 
Sbjct: 73  AAAICNIVLAGGVKKRPLLTQLRPDWTTFLALPKLLGAF-KGGDDALLKAFIQVIEAHGF 131

Query: 123 SVVGAHEIVPELLV-QVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+G HEI+P+LL  +   L      R  K DIL A ++A+ L  LD+GQ+AV++ GRV+
Sbjct: 132 CVIGVHEILPDLLAPKEFDLTLRRATRKEKNDILLAAEAAKLLGRLDIGQAAVAVNGRVI 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD ML R+ + R   +I   K GVLVK  K QQD RADLPSIG  T+ N+ K+
Sbjct: 192 AVEGAEGTDKMLWRVCEMREKKQI-PPKGGVLVKCAKPQQDHRADLPSIGPTTIMNIAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
            L+G+A+EA KSL+L  +   + A++  +F+
Sbjct: 251 ELSGVAVEANKSLILSVKATIEKANKHSLFI 281


>gi|304391657|ref|ZP_07373599.1| phosphatidate cytidyltransferase [Ahrensia sp. R2A130]
 gi|303295886|gb|EFL90244.1| phosphatidate cytidyltransferase [Ahrensia sp. R2A130]
          Length = 281

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 157/275 (57%), Gaps = 6/275 (2%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ I+AGSG LP  +A        +P I  +       +++ + ++L       +  +  
Sbjct: 9   RVAILAGSGALPIQLATQLTTVGLQPYILRLPGVTEKPFENLDGQDLRWEQVGQIFPLCK 68

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKD--SLRISKMIWQLVSGGNAAILKASIDLLESY 120
           +++IG IV+AG +D RP   DL FS  D  +LR    I   +  G+ A+L + I ++E  
Sbjct: 69  EHSIGHIVLAGGVDGRP---DLKFSQMDWPTLRTLPTILGQLLKGDDAVLGSVITVIEKR 125

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ V+GA +I P L+V  G        +D  R I    +  +A+S  D+GQ+ V IGGR 
Sbjct: 126 GLKVLGAADIAPSLVVDEGRFSGAPGTKDRNR-IDLGFQLLDAMSPFDMGQACVVIGGRP 184

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VA+EG EGTD+ML+RI+D R+NGR+   + GV+VK  K+ QD R D+P+IG +TV   + 
Sbjct: 185 VAVEGAEGTDAMLRRIMDLRDNGRLPLQRGGVMVKAPKAGQDHRVDMPTIGPETVSRAVA 244

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AGL GIA+ AG +L+LE+E     A    +F+ GI
Sbjct: 245 AGLDGIAVRAGATLILERETCIDIAQRGDLFLTGI 279


>gi|240850314|ref|YP_002971707.1| phosphatidate cytidyltransferase [Bartonella grahamii as4aup]
 gi|240267437|gb|ACS51025.1| phosphatidate cytidyltransferase [Bartonella grahamii as4aup]
          Length = 290

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 164/276 (59%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+A     + P +  +  E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPITVAQALEKNGENPFLVLLRGEADSVLYRYEHCELSIVELARLVKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  +  +V+AG + +RP ++ L       L + K+I  L  G +A +LKA I ++E+YG 
Sbjct: 73  EAGVYNVVLAGGVKKRPLLKQLRLDWTTFLALPKLIGALKRGDDA-LLKAFIRIIEAYGF 131

Query: 123 SVVGAHEIVPELLVQVG-SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHEIV +LL  V   L      R  K+DI  A ++A+ L +LD+GQ+ V + GRVV
Sbjct: 132 RVVGAHEIVADLLAPVEFDLTVRRATRKEKKDIFLAAEAAKLLGQLDIGQAVVVVQGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD+ML R+ + R  G+I   K GVLVK  K QQD R DLPSIG  T+ N+ K+
Sbjct: 192 ALEGAEGTDNMLWRVCEMRERGQI-PLKGGVLVKCAKPQQDNRVDLPSIGPATIMNIAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL+G+A+EA +SL+L  +   + A++  +F+   ++
Sbjct: 251 GLSGVAVEANRSLILSVKTTIEKANKYSLFIETFEK 286


>gi|163868111|ref|YP_001609315.1| phosphatidate cytidyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017762|emb|CAK01320.1| phosphatidate cytidyltransferase [Bartonella tribocorum CIP 105476]
          Length = 290

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 160/271 (59%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAGSG+LP  VA+A     + P +  +  E       +E  EL + +   L  +L 
Sbjct: 13  RTAIIAGSGVLPITVAQALEKNGENPFLVLLQGEADSVLYRYEHCELSIVELARLIKVLK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  +  +V+AG + +RP +  L       L + K+I  L  G +A +LKA I  +E +G 
Sbjct: 73  EAGVYNVVLAGGVKKRPLLTQLRLDWTTFLALPKLIGALRKGDDA-LLKAFIRFIEEHGF 131

Query: 123 SVVGAHEIVPELLVQVG-SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHEIVP+LL  +  +L      +  K+DI  A ++A+ L +LD+GQ+ V + GRVV
Sbjct: 132 CVIGAHEIVPDLLAPIEFNLTVRRATQKEKKDIFLAARAAKILGQLDIGQAVVVVQGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD+ML R+ + R  G+I   K GVLVK  K QQD R DLPSIG  T+ N  K+
Sbjct: 192 ALEGAEGTDNMLWRVCEMRERGQI-PPKGGVLVKCAKPQQDNRVDLPSIGPVTIMNTAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA +S++L  +   + A++  +F+
Sbjct: 251 GLSGIAVEANRSIILSLKKTIEKANKHSLFI 281


>gi|298291811|ref|YP_003693750.1| hypothetical protein Snov_1827 [Starkeya novella DSM 506]
 gi|296928322|gb|ADH89131.1| protein of unknown function DUF1009 [Starkeya novella DSM 506]
          Length = 297

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 99/271 (36%), Positives = 147/271 (54%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL II G G  P  VA+AAR    E V+  V        + +    +P+G F +L+  + 
Sbjct: 18  RLAIICGGGAFPLAVAEAARRAGREVVLFPVRGFADMAVESWPHVWIPIGRFGLLKREMR 77

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           ++    +V  G    RP ++D+      +L +   + +++ GG+  +L +   L E  G 
Sbjct: 78  RHGCTEVVFIGTA-LRPRIRDIRLDWT-TLTLLPRVLRMLRGGDDHLLTSLGRLFEESGF 135

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +VGAHE+ PE+L+  G LG   P+ +   D+     +      LD+GQ  V +   VVA
Sbjct: 136 RLVGAHEVAPEILIPAGQLGGVAPSAEEMDDVAVGRHALGVTGPLDIGQGLVVMNRHVVA 195

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           LE  EGTD ML R+ + R NGRI A  + GVLVK  K  QD R DLPS+G +TV+   +A
Sbjct: 196 LEAAEGTDLMLARVAELRGNGRIKAPARCGVLVKRPKEGQDRRLDLPSLGTRTVEGAARA 255

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GLAGIA+EAG  +V +   + + AD AG+F+
Sbjct: 256 GLAGIAVEAGGVIVTDVAALVRAADRAGLFI 286


>gi|218680512|ref|ZP_03528409.1| hypothetical protein RetlC8_17140 [Rhizobium etli CIAT 894]
          Length = 142

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (75%)

Query: 146 PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRI 205
           P  + +RDI  A ++AE L  LD+GQ AVSIGGRVVALEG+EGTD ML+R+   R  GRI
Sbjct: 3   PGEEDRRDIARAAEAAETLGRLDIGQGAVSIGGRVVALEGLEGTDEMLERVAGLRAAGRI 62

Query: 206 LAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHA 265
              + G LVK+CK QQD+RADLP+IG  T+ N  +AGL GIA+EAG+SLVL++  V K A
Sbjct: 63  SPRRRGALVKLCKPQQDIRADLPAIGVSTILNAKRAGLGGIAVEAGRSLVLDRAAVIKVA 122

Query: 266 DEAGIFVCGIDR 277
           DEAG+FVCGIDR
Sbjct: 123 DEAGLFVCGIDR 134


>gi|158423329|ref|YP_001524621.1| hypothetical protein AZC_1705 [Azorhizobium caulinodans ORS 571]
 gi|158330218|dbj|BAF87703.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 294

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 144/276 (52%), Gaps = 3/276 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           I+AG G  P  VA+A R +  E  +  +        + +      +G      + L    
Sbjct: 20  IVAGGGAFPAAVAEAVRAQGREVYLGLLQGFADPSLERYPHFWFKVGSLGTATTRLKAQG 79

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
           +  +V+ G + R P V+DL       LR+   I  L  GG+  +L   ++L+ + G ++ 
Sbjct: 80  VKELVMVGTLTR-PRVRDLGLDWT-MLRLLPRIAALFRGGDNHLLSGVVELVAAQGFAMR 137

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
           GAHE+ P LL+  G LG   P      DI   +    +L   DVGQ+ + + G VVA+E 
Sbjct: 138 GAHEVAPSLLLPEGVLGAIAPRPVDLDDIRLGLSLIASLGAFDVGQAVIVVNGFVVAVEA 197

Query: 186 IEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            EGTD ML R    R  GR+  GK  GVLVK  K QQD R DLPS+G +TVQ   +AGLA
Sbjct: 198 AEGTDEMLTRYKTMREKGRLRFGKGQGVLVKAPKPQQDRRVDLPSLGPRTVQRAAEAGLA 257

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           GIA EAG ++V + E +   AD+AG+FV G+  + A
Sbjct: 258 GIAFEAGGAIVPDAEHLVAEADKAGLFVVGVRPQVA 293


>gi|90419603|ref|ZP_01227513.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336540|gb|EAS50281.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 299

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 142/253 (56%), Gaps = 1/253 (0%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L ++AG G LP  VA+AAR      V+  + +  + DW  +E    P G      + +  
Sbjct: 13  LGLVAGGGSLPRLVAEAARASGWRVVVVRIGDGMADDWSGYEGGAYPWGRTGDAIAYMKS 72

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+V  G +  RP+ + L  S +  +R+   + ++V GG+  +L+A    +E  G  
Sbjct: 73  CGVQRMVFCGTVSHRPDFRSLIPSFQTLIRLPAAL-KIVRGGDDRLLRALSRYMERQGFE 131

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           ++   +IVP+LL   G+L   +P+ D ++ ++ A ++A  L ELD+GQ+ V+   RV+AL
Sbjct: 132 MLAVQDIVPQLLTPGGTLTRRMPDADEEQALVLAARAAGRLGELDIGQAVVASRDRVIAL 191

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EGIEGT  MLQR+ D ++ GRI   +  VLVK  K  QD R DLPSIG  T++    AG+
Sbjct: 192 EGIEGTREMLQRVADLKSRGRIGRSERCVLVKSVKPTQDERFDLPSIGGATIEEAAVAGI 251

Query: 244 AGIALEAGKSLVL 256
             I   AG+SLVL
Sbjct: 252 TVIGATAGRSLVL 264


>gi|312114745|ref|YP_004012341.1| hypothetical protein Rvan_2007 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219874|gb|ADP71242.1| protein of unknown function DUF1009 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 299

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 149/276 (53%), Gaps = 4/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ I+AG G LP  VA+AA  + + P I  +    S   + F      +G    +   L 
Sbjct: 22  RIGIVAGGGTLPLAVAEAAAARGERPYIVGLQGNASSTIESFPHSYAGIGQIGRILGALR 81

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +    R+V  G++ RRPN+  +         + +++ +++ GG+ ++L+A     E+ G 
Sbjct: 82  REGCERVVFVGSL-RRPNLLRVRIDTGFVRHMPELL-RILRGGDDSVLRAVARFFEARGF 139

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+ AHE+ P LL   G      P+ +   DI  A   A AL E D+GQ AV   G V+A
Sbjct: 140 EVLAAHEVAPRLLAPAGVFSGAAPDAEALADIRLAFNVARALGEYDIGQGAVVARGYVLA 199

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E  EGTD+ML R  D    G     + GVLVKM K  QD+R D+P+IG +TV+   +AG
Sbjct: 200 VEAAEGTDAMLSRCRDLNRWG--FKNRQGVLVKMPKPGQDLRLDMPAIGPRTVELAAEAG 257

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAGIA+ AG  L+ E++ + + AD  G+F+ G+D E
Sbjct: 258 LAGIAVAAGGVLLAEQQAIVEKADALGLFLYGVDGE 293


>gi|288958455|ref|YP_003448796.1| hypothetical protein AZL_016140 [Azospirillum sp. B510]
 gi|288910763|dbj|BAI72252.1| hypothetical protein AZL_016140 [Azospirillum sp. B510]
          Length = 283

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 158/287 (55%), Gaps = 31/287 (10%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLK------------NDEPVIASVLNECSFDWQDFECREL 49
            +L I+AG G LP  +A+A R +             D P +A +       W  F     
Sbjct: 13  PKLGILAGGGTLPARIAEAVRGQGRDVFIVAFDGHTDPPTVAGL----PHIWSRFGAAG- 67

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAI 109
                 +LR  LH+  +  +V+AG + RRP+  +L    + +  ++++  + +  G+  +
Sbjct: 68  -----TILRR-LHEEGVSEVVLAGPV-RRPSFTELMPDWRTARFLARVGSRAL--GDDGL 118

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           L+A +  +E  G  VVG H+++ +L+   G +G  VP+ D +RDI  A++ A A+  LDV
Sbjct: 119 LRAVVREVEEDGFRVVGLHDLLKDLMTVTGPVGRLVPDSDAERDISRAIEVARAMGTLDV 178

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           GQ AV   G V+A+E IEGTD+ML R   C    R   G  GVLVK+ K +QD R DLP+
Sbjct: 179 GQGAVVQQGIVLAVEAIEGTDAMLGR---CAGLAR--PGPGGVLVKVKKPKQDRRIDLPT 233

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +G  TV+    AGL G+A+EAG SL++++  V + AD  G+FV GI+
Sbjct: 234 MGVTTVERAAAAGLRGVAVEAGGSLLIDRAAVAETADRLGLFVVGIE 280


>gi|209885096|ref|YP_002288953.1| phosphatidate cytidyltransferase [Oligotropha carboxidovorans OM5]
 gi|209873292|gb|ACI93088.1| phosphatidate cytidyltransferase [Oligotropha carboxidovorans OM5]
          Length = 284

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 154/275 (56%), Gaps = 8/275 (2%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ---DFECRELPLGDFCVLRSILH 62
           +IAG G LP+ +A + R +   PV+  +   C  D Q   ++      +G F  + S L 
Sbjct: 13  LIAGGGTLPFALADSLRARGRVPVLIGLKGYC--DPQRIANYRHHWYSVGQFGSIMSALR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 I   G +  RP ++DL F    ++R+   I + + GG+  +L A+  + E  G 
Sbjct: 71  DEGCSDITFIGTL-VRPALRDLRFDWT-AVRLIPRILRGLRGGDDHLLSATARVFEQGGF 128

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+G  E+ P+LL+ VG L +  P+     D +      +A+S  DVGQ+AV I G VV+
Sbjct: 129 RVLGVRELAPDLLMPVGCLTSTQPDAASLADAVTGRALLQAISPFDVGQAAVVIDGHVVS 188

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E I GTD++L RI + R +GR+ A    GVLVK  K  QD+R DLP++G  TV+ +I A
Sbjct: 189 IEDIAGTDALLARIKELRASGRLRAKPGRGVLVKAPKQGQDLRLDLPALGPVTVKGLIDA 248

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           GLAG+A+ AG S+V E + +   AD AG+F+ G+D
Sbjct: 249 GLAGMAVAAGHSVVAEPQAMVAAADAAGLFIVGLD 283


>gi|154248347|ref|YP_001419305.1| hypothetical protein Xaut_4427 [Xanthobacter autotrophicus Py2]
 gi|154162432|gb|ABS69648.1| protein of unknown function DUF1009 [Xanthobacter autotrophicus
           Py2]
          Length = 306

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 141/274 (51%), Gaps = 3/274 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           I+AG G  P  VA+A   +  + ++  +        + +  +   LG    + ++     
Sbjct: 28  IVAGGGAFPAAVAEAVIAQGRDVLLLLIRGFADPALERYPHQWFRLGSLGSVTAMAKARG 87

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
           +  +V+ GA+ R P V DL F     LR+   I +L  GG+  +L   + L+   G ++V
Sbjct: 88  VRDVVMVGALTR-PRVSDLGFDWT-MLRLLPRIARLFRGGDNHLLSGVLGLVAEQGFNLV 145

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
           GAHE+ P LL+  G LG   P+   ++D++  +     L   DVGQ  + + G V A+E 
Sbjct: 146 GAHEVAPGLLLPQGVLGARAPSAQDRQDMVRGLDVIRTLGPFDVGQGVIVVDGFVAAVEA 205

Query: 186 IEGTDSMLQRIVDCRNNGRI-LAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            EGTD ML R  + R  GR+      GVLVK  K  QD R DLPS+G  TV    + GL 
Sbjct: 206 AEGTDQMLARYGEMRRTGRLRFHAGRGVLVKAPKPGQDRRVDLPSLGPATVARAAEVGLG 265

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GIA EAG ++V + + +   AD AG+F+ G+DR 
Sbjct: 266 GIAFEAGGAIVPDVQALVAGADAAGLFIYGMDRS 299


>gi|299134989|ref|ZP_07028180.1| protein of unknown function DUF1009 [Afipia sp. 1NLS2]
 gi|298589966|gb|EFI50170.1| protein of unknown function DUF1009 [Afipia sp. 1NLS2]
          Length = 284

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 150/275 (54%), Gaps = 8/275 (2%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ---DFECRELPLGDFCVLRSILH 62
           +IAG G+LP+ +A +   +   PV   +   C  D Q   ++      +G F  +   L 
Sbjct: 13  LIAGGGVLPFALADSLLAQGRTPVFIGLKGFC--DPQRIVNYRHHWFSVGQFGSIMKALR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     I   G +  RP  +DL F    ++R+   I + + GG+  IL A+  + E  G 
Sbjct: 71  EEGCSDITFIGNL-VRPAFKDLRFDWL-AMRLIPRILKGLRGGDDHILSATARVFEDGGF 128

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+G  ++ P+LL+  G L    P+     D     +   A+S  DVGQ+ V I G VV+
Sbjct: 129 RVLGVRDLAPDLLMPSGCLTHAQPDAASLNDAAKGREVLRAISPFDVGQAVVVIDGHVVS 188

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E I GTD++L RI + R +GR+ A    GVLVK  K  QD+R DLP++G +T++ V +A
Sbjct: 189 IEDIAGTDALLVRIKELRESGRLRAKPGRGVLVKAPKQGQDLRLDLPALGPQTIRGVAEA 248

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           GLAGIA+ AG S+V E + + + AD AGIFV G++
Sbjct: 249 GLAGIAVMAGHSVVAEPQAMVEAADNAGIFVVGLE 283


>gi|330993386|ref|ZP_08317321.1| hypothetical protein SXCC_03284 [Gluconacetobacter sp. SXCC-1]
 gi|329759416|gb|EGG75925.1| hypothetical protein SXCC_03284 [Gluconacetobacter sp. SXCC-1]
          Length = 290

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 139/274 (50%), Gaps = 13/274 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLN----ECSFDWQDFECRELPLGDFCVLRSIL 61
           I+AG G LP  VA+A         I         E    W     R    G+     S L
Sbjct: 18  ILAGGGPLPGQVARAVERAGGRVFIIGFQGFAEPEVIGHWPHRMVRLAAAGEIL---SAL 74

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
           H++    +V+ G + RRP++  L      + RI   I + +  G+  +L A + +L   G
Sbjct: 75  HEHGCRDLVLIGPV-RRPSLVSLRPDAAGA-RILTRIGKALFAGDDGLLGAIVRVLGEEG 132

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            ++ GAHE +P  + + G+LGT  P+   + DI         L  LD+GQ  V  GG V+
Sbjct: 133 FTIRGAHEYLPGSVARPGALGTLTPDATARADIALGRHVVRQLGRLDIGQGCVVQGGLVL 192

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGTD ML+R+   R   R      GVLVKM K  Q+ RADLP+IG +T+   + A
Sbjct: 193 AVEALEGTDRMLERVATLRQPDR----PGGVLVKMAKPGQERRADLPTIGPRTIAGAMAA 248

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           GL GIA+EAG +L+ +       ADEAG+F+ GI
Sbjct: 249 GLRGIAMEAGATLITDPAACTAMADEAGLFLTGI 282


>gi|27379959|ref|NP_771488.1| hypothetical protein bll4848 [Bradyrhizobium japonicum USDA 110]
 gi|27353112|dbj|BAC50113.1| bll4848 [Bradyrhizobium japonicum USDA 110]
          Length = 289

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 144/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECRELPLGDFCVLRSILHQY 64
           ++AG G +P+ VA +   +   PV+  +   C     + F  R + +G       +  + 
Sbjct: 18  VVAGGGAMPFAVADSLATRGITPVLFPLRGACDPVQVEKFRHRWISVGQLGRAMRLFREE 77

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
               ++  G +  RP++ ++ F    +LR+   + +   GG+  +L     +LE  G  +
Sbjct: 78  GCRDLIFIGTL-VRPSLSEIRFDFT-TLRLLGNVIRAFRGGDDHLLSGVGRILEQGGFRM 135

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           VG  ++ P+LL+  G +    P+   K DI        AL   D+GQ+AV I G VVA+E
Sbjct: 136 VGIKDVAPDLLMPEGCISRAWPSDTSKTDIERGRAVLTALGPFDIGQAAVVIDGHVVAVE 195

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            IEGTD++L R+   R  GRI A    GVLVK  KS QD+R DLP+IG +T++ V +AGL
Sbjct: 196 DIEGTDALLARVARLREEGRIRAATGRGVLVKAPKSSQDLRFDLPTIGPRTIEGVARAGL 255

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AGIA+ AG ++  E + +   AD   +F+ G+
Sbjct: 256 AGIAVIAGNTIAAEPQAMIALADAKYLFIIGL 287


>gi|148255858|ref|YP_001240443.1| hypothetical protein BBta_4505 [Bradyrhizobium sp. BTAi1]
 gi|146408031|gb|ABQ36537.1| hypothetical protein BBta_4505 [Bradyrhizobium sp. BTAi1]
          Length = 285

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 140/272 (51%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILHQY 64
           +IA  G+LP+ VA     +   PV+ ++   C       F    + LG       +L   
Sbjct: 14  LIAAGGVLPFAVADEIVARGQTPVLFALKGICDPKPLARFRHHWIGLGQLGNALKLLKAE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            +  ++  G +  RP V ++      +LR    IW    GG+  +L     + E +G  +
Sbjct: 74  GVRDLMFIGNL-VRPAVSEIRIDWG-TLRELPYIWSAFRGGDDHLLSGVGRIFERHGFHM 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++ P LLV  G L    PN  V  DI   +    A++  DVGQ+ V I G VVALE
Sbjct: 132 IGVKDVAPNLLVPEGHLTRSRPNDLVTGDIAKGLAVLRAMAPFDVGQAVVVIDGHVVALE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRIL-AGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            I GTD +L R+V  R + RI  A   GVLVK  KS QD+R DLP+IG +TV+ +  AGL
Sbjct: 192 DIGGTDGLLARVVRLRADRRIRSAAGRGVLVKAPKSGQDLRYDLPTIGPRTVEGLSAAGL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ AG +L+ + +     AD AG+F+ G+
Sbjct: 252 AGVAVSAGYTLLADPQETVSAADRAGLFITGV 283


>gi|114704864|ref|ZP_01437772.1| hypothetical protein FP2506_08006 [Fulvimarina pelagi HTCC2506]
 gi|114539649|gb|EAU42769.1| hypothetical protein FP2506_08006 [Fulvimarina pelagi HTCC2506]
          Length = 287

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 143/277 (51%), Gaps = 1/277 (0%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           +RL I+AG G LP  VA AA  K  EPV A   +  + D      R    G        L
Sbjct: 7   ERLGIVAGGGGLPMIVANAAIEKGMEPVFARFSDGMTNDSIIGRSRAFAWGRTGDAIEWL 66

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               + ++V  G I  RP+ + +  S K   R+ + + ++V GG+  +L+     LES G
Sbjct: 67  KAEGVQKLVFCGTISSRPDFRSILPSFKTLKRLPRAL-RIVKGGDDRLLRNLSRYLESEG 125

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             ++    + PELL   G L    P  +    +  A ++A AL  LD GQ+ ++   R++
Sbjct: 126 FDLLPVQAVAPELLAPEGVLTARTPTAEESAALDLAHRAATALGVLDAGQAVIASNERII 185

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EGIEGT +M++R+ + R   +I  G+   LVK  K  QD R DLPSIG +T+     A
Sbjct: 186 AMEGIEGTRAMMRRVAEYRAARKIGRGERLALVKAVKPGQDRRFDLPSIGVQTIDEAEAA 245

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           G+  I + AG+SL+L  + V   A+ AG+ VCG+  E
Sbjct: 246 GITAIGVSAGESLILGFDDVIDRANTAGLAVCGLGGE 282


>gi|170749835|ref|YP_001756095.1| hypothetical protein Mrad2831_3435 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656357|gb|ACB25412.1| protein of unknown function DUF1009 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 287

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 144/273 (52%), Gaps = 4/273 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L++IAG+G LP  VA++ R       + ++        +      + L D      +L +
Sbjct: 12  LVLIAGAGRLPELVAESLRRARRPFRVIALRGFTGPALRAGADATVDLLDLAATLKLLRR 71

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           +    +V AG + R P+   +  +   +LR  + +  +  GG+  +L+A++ L+E  G  
Sbjct: 72  WGPATVVPAGGVSR-PSPAAI-LNAGAALRNREALRAIAGGGDDRLLRAAVALVEEEGHR 129

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVG HE  P+LL   G LG   P+ +    I       +ALS  D+GQ+ V  G R++A+
Sbjct: 130 VVGVHEAAPDLLCPDGPLGRRAPDAEAAASIRTGRGVLDALSPYDLGQAVVLAGDRILAV 189

Query: 184 EGIEGTDSML--QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           EG EGTD ML   R +  R  G   A  S VLVK  K  QD R DLP+IGA+TV+N  +A
Sbjct: 190 EGPEGTDRMLARARALGRRPFGFGRAMPSTVLVKAPKVGQDRRIDLPAIGARTVRNAARA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           G  G+ALEAG +LV+++      AD  G+FV G
Sbjct: 250 GCVGLALEAGGTLVIDRAATAAEADRLGLFVVG 282


>gi|91977315|ref|YP_569974.1| hypothetical protein RPD_2845 [Rhodopseudomonas palustris BisB5]
 gi|91683771|gb|ABE40073.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           BisB5]
          Length = 285

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 143/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECRELPLGDFCVLRSILHQY 64
           +IAG G+LP+ +A + + +   P++  +   C       F    + +G +  L+ +L   
Sbjct: 14  VIAGGGVLPFAIADSMQARQITPLLIGLRGFCDPTGIARFRHHWISIGQYGRLKRLLRAE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
           +   ++  G++  RP++  +      ++R+   +     GG+  +L +   + E  G  +
Sbjct: 74  HCRDVMFIGSV-VRPSLASVRLDWG-AVRVLPSVMAAYRGGDDHLLTSIGRIFEGEGFRL 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
            G  ++ PELL+  G L    P+     DI   +    ALS  D+GQ  + I G VVA+E
Sbjct: 132 YGVKDVAPELLMPRGELTQATPDEGHLADIAKGIAVLAALSPFDIGQGVIVIDGHVVAVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            I GTD++L  +   R  G I A    GVLVK  KS QD+R DLP++G +TV+ V  AGL
Sbjct: 192 DIGGTDALLANLARLRAQGAIHAKPGRGVLVKSPKSGQDLRFDLPTLGPRTVEGVAAAGL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AGIA+ AG +LV E +   K AD AG+FV G+
Sbjct: 252 AGIAVAAGNTLVAEPQETIKAADAAGLFVTGV 283


>gi|115524572|ref|YP_781483.1| hypothetical protein RPE_2565 [Rhodopseudomonas palustris BisA53]
 gi|115518519|gb|ABJ06503.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           BisA53]
          Length = 284

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 145/272 (53%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILHQY 64
           +IAG G+LP+ VA + + +    V+ ++   C  D    +    + +G F  LR +L   
Sbjct: 13  LIAGGGVLPFAVADSLQARGIGAVLFALKGSCDADQLSRYRHHWISIGAFGQLRRLLRAE 72

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
               ++  GA+  RP++  +      ++R+   I     GG+  +L     + E  G  +
Sbjct: 73  QCRDVLFIGAL-VRPSLSAVRLDWG-AIRVMPAILAAYRGGDDHLLTGIGQIFERDGFRL 130

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++ P+LL+  G +    PN+D + DI        ALS  D+GQ  V I G VV++E
Sbjct: 131 LGLKDVAPDLLMPEGCMTRARPNKDTEADIAKGRAVLAALSPFDIGQGCVVIDGHVVSVE 190

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
              GTD +L+R+   R   R+ A    GVLVK  KS QD+R DLP++G KT++ +I A +
Sbjct: 191 DTGGTDGLLRRVEQLRGERRLRAKPGRGVLVKAPKSGQDLRFDLPALGPKTIEGLIAAQI 250

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ AG ++V E + +   AD AG+FV G+
Sbjct: 251 AGVAVVAGHTVVAEPQAMVDAADRAGLFVTGV 282


>gi|242279985|ref|YP_002992114.1| hypothetical protein Desal_2519 [Desulfovibrio salexigens DSM 2638]
 gi|242122879|gb|ACS80575.1| protein of unknown function DUF1009 [Desulfovibrio salexigens DSM
           2638]
          Length = 279

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 141/275 (51%), Gaps = 14/275 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSILHQ 63
           +IAG G  P  VAK A  + +  V        +F+  ++     EL LG    L S    
Sbjct: 10  LIAGGGQFPLLVAKGAAAQGNRVVAVFFKGHSNFEVSEYTDASVELKLGQLNKLISFFKN 69

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + ++V+AG I++ P   D    I+   R +K++++L + G+  +L+A     E  G+ 
Sbjct: 70  NGVSKVVMAGTINK-PKALD----IRPDFRAAKLLFKLATKGDDVLLRAIASEFEVEGME 124

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVG HE  P+LL   G L    PN     D+    K A  L  LD+GQ  V   G V A+
Sbjct: 125 VVGPHEYAPDLLTPSGFLTKRKPNDVESGDLAFGWKIARELGRLDIGQCVVVREGIVTAV 184

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD+ ++R       G  L GK   +VK+ K  Q+ R D+PSIG KT+Q + + G 
Sbjct: 185 EAIEGTDAAVKR-------GCELGGKGCCIVKVFKPGQEKRVDMPSIGLKTIQGMKELGA 237

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
             + +EAGKSL  + +   + AD+ GI + G+++E
Sbjct: 238 TCLGVEAGKSLFFDLDESVQFADKYGITIVGLNQE 272


>gi|117925149|ref|YP_865766.1| hypothetical protein Mmc1_1852 [Magnetococcus sp. MC-1]
 gi|117608905|gb|ABK44360.1| protein of unknown function DUF1009 [Magnetococcus sp. MC-1]
          Length = 278

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 143/276 (51%), Gaps = 19/276 (6%)

Query: 6   IIAGSGMLP-YYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSILH 62
           IIAGSG +P   + K     +   V+A+ + E              + LG F  +    H
Sbjct: 3   IIAGSGAIPALLIDKLRHCHHTAVVVAAHVGEADPKLTQLADAIEWVRLGQFKRILRFFH 62

Query: 63  QYNIGRIVVAGAIDRRP--NVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
              +  IV+ G I +    N++    ++K + R+  M        +  +L+A  + LE  
Sbjct: 63  AQGVTHIVMVGGITKTQIWNIRPDTLALKIATRLKHM-------QDDHLLRAIAETLEER 115

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V GAHE+ PELL  VG LG   PN ++ +D+    + A+A+  LD+GQ  V     V
Sbjct: 116 GFVVCGAHELAPELLAPVGILGHHRPNSELWQDMRLGWQMAKAIGALDIGQGVVVRERVV 175

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E +EGTD+MLQR       G       G LVK+ K QQD+R D+P+IG  T+QN+ +
Sbjct: 176 LAVEAVEGTDAMLQRAGKLSRGG-------GCLVKVSKPQQDLRLDMPTIGVATIQNLHR 228

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           AGL G+A+E+G +L+++   +   AD  GI V G D
Sbjct: 229 AGLRGLAVESGSTLIVDYIGMLAEADRLGIVVVGCD 264


>gi|229587084|ref|YP_002845585.1| hypothetical protein RAF_ORF1018 [Rickettsia africae ESF-5]
 gi|228022134|gb|ACP53842.1| Unknown [Rickettsia africae ESF-5]
          Length = 270

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 140/274 (51%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L      SL + K++ Q + G ++ +LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVNR-PNFKNLAVDKIGSLLLFKIVGQKIRGDDS-LLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K  + LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITNTNPISSDKNDIELGIKLLDHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D RNN        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRNNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|302392921|ref|YP_003828741.1| hypothetical protein Acear_2190 [Acetohalobium arabaticum DSM 5501]
 gi|302204998|gb|ADL13676.1| protein of unknown function DUF1009 [Acetohalobium arabaticum DSM
           5501]
          Length = 266

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 152/278 (54%), Gaps = 16/278 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF---ECRELPLGDFCVL 57
           M R+ +IAG+G LP Y A+AA+ K  E V  SV  +   +  D    E  EL +     L
Sbjct: 1   MNRVGLIAGNGRLPLYFAQAAKDKAREVVAVSVTEQALVNKLDSIVDESYELSVAKLDKL 60

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
            + L    I  +V+ G +++     DL F++    R++K++  L    + AIL A ++ L
Sbjct: 61  ITKLQTAGIKEVVMVGKVNK-----DLMFNLDFDERMTKLLMNLEEKNDDAILLALVEEL 115

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
            + G+ V      +  LL Q+G+L    P+ D+ +D+    K A+ + +LD+GQ+ V   
Sbjct: 116 AAAGIKVKKQTTYLESLLPQLGTLTEIEPSPDIIKDMEFGFKMAKGIGDLDIGQTVVVKD 175

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+A+E IEGTD  + R      +G++  G   V  K+ K QQD R D+P+IG  T++N
Sbjct: 176 RAVIAVEAIEGTDQAILR------SGQLAEGV--VAAKVSKPQQDFRFDIPTIGKDTIKN 227

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +I+ G AG+ +EA K+ +L++  V + AD+AG+ +  +
Sbjct: 228 LIEIGAAGLVIEAAKTFILDRREVCQLADKAGLPIVAM 265


>gi|188584403|ref|YP_001927848.1| hypothetical protein Mpop_5219 [Methylobacterium populi BJ001]
 gi|179347901|gb|ACB83313.1| protein of unknown function DUF1009 [Methylobacterium populi BJ001]
          Length = 282

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 150/280 (53%), Gaps = 11/280 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCVLR 58
           + L ++AG+G LP  VA A+  +   P    VL    F  +    R    + L D     
Sbjct: 6   RPLALVAGAGRLPELVA-ASLDRARRPF--RVLAVRGFTERAMRRRADAVVDLLDIPGTL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL  +    +V AG + R P+   L  +   ++R ++ I + ++GG+  +L+A + LLE
Sbjct: 63  RILKDWAPAAVVPAGGVTR-PSPAAL-LNAAHAVR-NRDILKSLAGGDDRLLRAVLSLLE 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+G HE+ P+LL + G LG   P+ D    I        ALS  DVGQ+AV    
Sbjct: 120 ENGHQVLGVHEVAPDLLGRPGRLGRLAPDADAALSIATGRAMLGALSPFDVGQAAVVAAE 179

Query: 179 RVVALEGIEGTDSML--QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           R++A+EG EGTD ML   R ++ +  GR    K  VLVK+ K  QD+R DLP+IG +TV 
Sbjct: 180 RIIAVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVH 239

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              +AG AG+A+ AG +LV++       AD AG+F+ G++
Sbjct: 240 RAAEAGCAGLAIGAGHTLVIDGPETVAAADAAGLFLIGVE 279


>gi|192291628|ref|YP_001992233.1| hypothetical protein Rpal_3256 [Rhodopseudomonas palustris TIE-1]
 gi|192285377|gb|ACF01758.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           TIE-1]
          Length = 285

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 144/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQY 64
           IIAG G LP+ VA +   +   PV+ ++   C  +    +    L +G F  L  +L   
Sbjct: 14  IIAGGGTLPFAVADSLAARGLTPVLFALKGSCDPERVTAYRHHWLRMGAFGRLLRLLRDE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
               +V  G++  RP + D+      ++++   +     GG+  +L     L E +G  +
Sbjct: 74  GCRDLVFIGSL-VRPALSDMRLDWG-AIKVLPAVLAAYRGGDDHLLTGVGRLFERHGFRL 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++  +LL+  G L   VP+  V+ DI        ALS  D+GQ  V I G VVA+E
Sbjct: 132 LGLKDVATDLLMPAGCLTRAVPDAGVEADIAKGRAVLAALSPFDIGQGCVVIDGHVVAVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
              GTD +L+R+   R++ RI A    GVLVK  K+ QD+R DLP++G KT++ +I A L
Sbjct: 192 DTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKTGQDLRFDLPALGPKTIEGLIAAQL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            G+A+ AG ++V E + +   AD+AG+F  G+
Sbjct: 252 GGVAVVAGHTVVAEPQEMIAAADKAGVFAIGM 283


>gi|258541757|ref|YP_003187190.1| hypothetical protein APA01_06610 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632835|dbj|BAH98810.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635892|dbj|BAI01861.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638947|dbj|BAI04909.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642001|dbj|BAI07956.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645056|dbj|BAI11004.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648111|dbj|BAI14052.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651164|dbj|BAI17098.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654155|dbj|BAI20082.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 285

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 143/276 (51%), Gaps = 16/276 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVI-----ASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           I+AG G LP  VA+AA      PV           E    W     R   LG    + S+
Sbjct: 9   ILAGGGPLPGRVAEAAAAAG-RPVFILGFEGFAEPEVIGPWPHEFVR---LGAAGRMLSL 64

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L Q+N   +V+ G I RRP++++L    + + RI   + + +  G+  +L A + +L   
Sbjct: 65  LKQHNCSDLVLIGPI-RRPSLRNLRPDAEGA-RIMARLGRALFAGDDGLLGALVRILGEE 122

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  + GAHE + + + Q G LG   P+   + DI   +   +AL  LD+GQ  V   G V
Sbjct: 123 GFHIRGAHEFLTQAVAQPGVLGRVQPDAQAQADIQRGITVVQALGRLDIGQGCVVQNGVV 182

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           + +E +EGTD ML R  +CR       G+ GVLVKM K  Q+ RAD+P+IG  TVQN   
Sbjct: 183 LTVEAMEGTDRMLARAGECRQ-----PGEGGVLVKMLKPGQEKRADMPTIGPVTVQNAHA 237

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           AGL GIA EA  +L+ +++   + AD  G+F+   D
Sbjct: 238 AGLRGIAFEAAHTLLTDRQRCIEEADRLGLFLLAFD 273


>gi|295689585|ref|YP_003593278.1| hypothetical protein Cseg_2197 [Caulobacter segnis ATCC 21756]
 gi|295431488|gb|ADG10660.1| protein of unknown function DUF1009 [Caulobacter segnis ATCC 21756]
          Length = 280

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 143/277 (51%), Gaps = 3/277 (1%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M++L +IAG G LP  +A           +  + +        +   ++ LG+F  +   
Sbjct: 1   MRKLGLIAGGGALPVELAARCEAAGRSFAVMRLKSFADPALARYPGIDVGLGEFGKVFKA 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L       +  AG + +RP+   L    +  L++   +      G+ A+L+  +D  E  
Sbjct: 61  LRAEGCEVVCFAGNV-KRPDFATLMPDAR-GLKVVPGLIMAARQGDDALLRRVLDEFEKE 118

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  + GAHE+V E+ + +G LG   P  D   DI  A+  A  +  LDVGQ AV   G V
Sbjct: 119 GFEIEGAHEVVDEMTLPLGRLGRFYPAADHMADIDKALMVAREIGRLDVGQGAVVCDGLV 178

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E  EGTD+ML+R+ D  +  R  A +  GVL K  K  Q+ + DLP+IG  T+    
Sbjct: 179 LAVEAQEGTDAMLRRVADLPHAIRGSAERPRGVLAKAPKPIQETKVDLPTIGVATLHRAA 238

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AGLAG+  EAG+ LV+++E V   ADE G+FV G+D
Sbjct: 239 RAGLAGVVGEAGRLLVVDREAVIAAADELGLFVLGVD 275


>gi|157803404|ref|YP_001491953.1| hypothetical protein A1E_01115 [Rickettsia canadensis str. McKiel]
 gi|157784667|gb|ABV73168.1| hypothetical protein A1E_01115 [Rickettsia canadensis str. McKiel]
          Length = 270

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 138/273 (50%), Gaps = 8/273 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +AK    +  +  I ++  E   +  ++FE +   +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAKNYTTQGGKCYITAIQGETDINQIKNFEYKVFKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  +  I+  G ++R PN ++L       L + K++ Q + G ++ +LK   D  ES
Sbjct: 62  YFKENEVQNIIFIGGVNR-PNFKNLAVDKIGGLLLFKILGQKIRGDDS-LLKTVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ +++I          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNKIYKNQQCDSNIITDTHPKSSDKNDIELGIKILNHLSPFDIAQSVIIESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T+QN+ 
Sbjct: 180 ILGIEAAEGTDNLIARCADLRKNHH-----EGVLVKIPKLGQDTRLDIPTIGPGTIQNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           K    GIA++AG+ +V+E+EL  K A+E  IF+
Sbjct: 235 KYNYCGIAIKAGEMIVVEQELTVKLANEHKIFI 267


>gi|39935975|ref|NP_948251.1| hypothetical protein RPA2910 [Rhodopseudomonas palustris CGA009]
 gi|39649829|emb|CAE28351.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 285

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 143/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQY 64
           IIAG G LP+ VA +   +   PV+ ++   C  +    +    L +G F  L  +L   
Sbjct: 14  IIAGGGTLPFAVADSLAARGLTPVLFALKGSCDPERVTAYRHHWLRMGAFGRLLRLLRDE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
               +V  G++  RP + D+      ++++   +     GG+  +L     L E +G  +
Sbjct: 74  GCRDLVFIGSL-VRPALSDMRLDWG-AIKVLPAVLAAYRGGDDHLLTGVGRLFERHGFRL 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++  +LL+  G L    P+  V+ DI        ALS  D+GQ  V I G VVA+E
Sbjct: 132 LGLKDVATDLLMPAGCLTRAAPDAGVEADIAKGRAVLAALSPFDIGQGCVVIDGHVVAVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
              GTD +L+R+   R++ RI A    GVLVK  K+ QD+R DLP++G KT++ +I A L
Sbjct: 192 DTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKTGQDLRFDLPALGPKTIEGLITAQL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            G+A+ AG ++V E + +   AD+AG+F  G+
Sbjct: 252 GGVAVVAGHTVVAEPQEMIAAADKAGVFAIGM 283


>gi|238650386|ref|YP_002916238.1| hypothetical protein RPR_01465 [Rickettsia peacockii str. Rustic]
 gi|238624484|gb|ACR47190.1| hypothetical protein RPR_01465 [Rickettsia peacockii str. Rustic]
          Length = 270

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 138/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L       L + K++ Q + G + ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVNR-PNFKNLAVDKIGGLLLFKIVGQKIRG-DDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E +EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAVEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDIPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|162147924|ref|YP_001602385.1| hypothetical protein GDI_2140 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542542|ref|YP_002274771.1| hypothetical protein Gdia_0360 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786501|emb|CAP56083.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530219|gb|ACI50156.1| protein of unknown function DUF1009 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 282

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 99/280 (35%), Positives = 142/280 (50%), Gaps = 23/280 (8%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF---------ECRELPLGDFCV 56
           I+AG G LP  VA+AA        +A  L      +QDF           R + L     
Sbjct: 17  ILAGGGPLPGQVARAA--------VAMGLRVFIVGFQDFAEPAIIEPWPHRYIRLAAAGE 68

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
           + S L       +V+ G + RRP+  DL      + RI   I + +  G+  +L A + +
Sbjct: 69  ILSCLRAEQCRDLVLIGPV-RRPSFSDLRPDATGA-RIMARIGRALFSGDDGLLAAIVRV 126

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           L   G ++ GAHE +   + + G LG   P+   + DI       +A+  LD+GQ  V  
Sbjct: 127 LAEEGFTIHGAHEFLSGSVGRRGVLGRVQPDAQAQADIGRGRAVVDAIGRLDIGQGCVVQ 186

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
            G V+A+E +EGTD ML R  +CR  GR      GVLVKM K  QD RADLP+IG  TV+
Sbjct: 187 DGLVLAVEAMEGTDRMLLRAGECRQPGR----PGGVLVKMLKPGQDRRADLPTIGPDTVR 242

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              +AGL GIA +AG +L+ + +     A+EAG+F+ GI+
Sbjct: 243 RAAQAGLRGIAFQAGATLLTDPDGCVAAANEAGLFLAGIE 282


>gi|239947176|ref|ZP_04698929.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921452|gb|EER21476.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 270

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 137/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   D  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYIKQGGNCYIAAIKDEADIDQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L       L + K++ Q + G ++ +LK   D  ES
Sbjct: 62  YFKEHEVKNIIFIGGVNR-PNFKNLAVDKIGGLLLFKIVGQKIRGDDS-LLKTVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI         ++    P    K DI   +K    LS  D+ QS +     
Sbjct: 120 YGFKVISSNEIYKNQQGNSNTITDINPTSSDKNDIELGIKLLNHLSSFDIAQSVIVESSY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIARCADLRKNPY-----GGVLVKIPKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|34581279|ref|ZP_00142759.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262664|gb|EAA26168.1| unknown [Rickettsia sibirica 246]
          Length = 270

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 137/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L       L + K++ Q + G + ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVNR-PNFKNLAVDKIGGLLLFKIVGQKIRG-DDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITNTHPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|157964871|ref|YP_001499695.1| hypothetical protein RMA_1147 [Rickettsia massiliae MTU5]
 gi|157844647|gb|ABV85148.1| hypothetical protein RMA_1147 [Rickettsia massiliae MTU5]
          Length = 275

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   D  +DFE + L +G       
Sbjct: 7   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIDQIKDFEYKILKIGMVGEAIK 66

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L       L + K++ Q + G ++ +LK   D  ES
Sbjct: 67  YFKEHEVKNIIFIGGVNR-PNFKNLAVDTIGGLLLFKIVGQKIRGDDS-LLKTVADFFES 124

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 125 YGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNHLSSFDIAQSVIVESGY 184

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R    R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 185 ILGIEAAEGTDNLITRCAALRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 239

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 240 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 273


>gi|92117253|ref|YP_576982.1| hypothetical protein Nham_1706 [Nitrobacter hamburgensis X14]
 gi|91800147|gb|ABE62522.1| protein of unknown function DUF1009 [Nitrobacter hamburgensis X14]
          Length = 285

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 147/272 (54%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQY 64
           +IAG G+LP+ VA +   +  +PV  ++   C  +    F+   + +G    +  +L   
Sbjct: 14  LIAGGGVLPFAVADSLVARGIKPVFFALKGVCDPEKVSQFQHHWIAVGQIGKVARLLRAE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
           N   +   G +  RP + ++      ++R+   +     GG+  +L     +LE  G  +
Sbjct: 74  NCRDLAFIGTL-IRPALSEIRLDWG-TVRVMGHVLAAFRGGDDHLLSGVGRILERDGFRM 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           VG  +I P+LL+  G L    P++    DI   +    ALS  D+GQ+ V I G VV +E
Sbjct: 132 VGIKDIAPDLLMPAGCLTRKTPDQSATADIAKGLDVLRALSPFDIGQAVVVIDGHVVGVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           GIEGTD++L RI   R  GRI A  + GVLVK  K+ QD+R DLP++G +T++N   AGL
Sbjct: 192 GIEGTDALLARIAQLRAEGRIRAKTARGVLVKAPKNGQDLRYDLPTLGPRTIENAAAAGL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ AG +LV E + +   AD + +FV G+
Sbjct: 252 AGMAVVAGNTLVAEPQALVGAADASSLFVVGL 283


>gi|83311584|ref|YP_421848.1| hypothetical protein amb2485 [Magnetospirillum magneticum AMB-1]
 gi|82946425|dbj|BAE51289.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 273

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKN------------DEPVIASVLNECSFDWQDFECREL 49
            +L IIAG G LP  VA A R +             D  VI    ++   DW       +
Sbjct: 3   PKLGIIAGGGDLPGLVAAACRAQGRPFHILALSGHADPQVIG---DQAPQDW-------I 52

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAI 109
            LG+       L Q  +  +V+ G + RRP + +L    + +   +++  + +  G+  +
Sbjct: 53  RLGEAGTGFERLRQAGVAEVVMIGPV-RRPTIMELAPDFRTARFFARVGLKAL--GDDGL 109

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           L+A    LES G  VVG  +++ + L   G  GT VP+   + D+   ++ A  L  LDV
Sbjct: 110 LRAVASELESEGFKVVGVDDVLSDCLATPGPYGTVVPDEQAQADMDRGIQVARGLGALDV 169

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           GQ+ V   G V+ +E IEGTD++L+R   C    R   G  GVLVK+ K  QD R DLP+
Sbjct: 170 GQAVVVQQGIVLGVEAIEGTDNLLRR---CGPLAR--EGLGGVLVKLKKPGQDRRIDLPT 224

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           IG  T++    AGL GIA+EAG +LV++ + +   AD  G+FV GI
Sbjct: 225 IGLTTLREAAAAGLRGIAIEAGGALVVDAKALGAEADRLGLFVTGI 270


>gi|157828955|ref|YP_001495197.1| hypothetical protein A1G_06155 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933680|ref|YP_001650469.1| hypothetical protein RrIowa_1323 [Rickettsia rickettsii str. Iowa]
 gi|157801436|gb|ABV76689.1| hypothetical protein A1G_06155 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908767|gb|ABY73063.1| hypothetical protein RrIowa_1323 [Rickettsia rickettsii str. Iowa]
          Length = 270

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 137/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L       L + K++ Q + G + ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVNR-PNFKNLAVDKIGGLLLFKIVGQKIRG-DDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|16126153|ref|NP_420717.1| UDP-2,3-diacylglucosamine pyrophosphatase [Caulobacter crescentus
           CB15]
 gi|221234924|ref|YP_002517360.1| UDP-2,3-diacylglucosamine pyrophosphatase [Caulobacter crescentus
           NA1000]
 gi|13423363|gb|AAK23885.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964096|gb|ACL95452.1| UDP-2,3-diacylglucosamine pyrophosphatase LpxI [Caulobacter
           crescentus NA1000]
          Length = 280

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 140/277 (50%), Gaps = 3/277 (1%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M++L +IAG G LP  +A           +  + +        +   ++ +G+F  +   
Sbjct: 1   MRKLGLIAGGGALPVELASHCEAAGRAFAVMRLRSFADPSLDRYPGADVGIGEFGKIFKA 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L       +  AG + R P+   L    +  L++   +      G+ A+L+  +D  E  
Sbjct: 61  LRAEGCDVVCFAGNVSR-PDFSALMPDAR-GLKVLPSLIVAARKGDDALLRRVLDEFEKE 118

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  + GAHE++ E+ +  G LG   P  +   DI  A+  A  +  LD+GQ AV   G V
Sbjct: 119 GFEIEGAHEVMGEMTLPRGRLGKVSPAPEHMADIDKALDVAREIGRLDIGQGAVVCEGLV 178

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E  EGTD+ML+R+ D     R  A +  GVL K  K  Q+ R DLP+IG  T+    
Sbjct: 179 LAVEAQEGTDAMLRRVADLPEAIRGRAERRLGVLAKAPKPIQETRVDLPTIGVATIHRAA 238

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AGLAGI  EAG+ LV+++E V   AD+ G+FV G+D
Sbjct: 239 RAGLAGIVGEAGRLLVVDREAVIAAADDLGLFVLGVD 275


>gi|15893033|ref|NP_360747.1| hypothetical protein RC1110 [Rickettsia conorii str. Malish 7]
 gi|15620234|gb|AAL03648.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 270

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 137/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++R PN ++L       L + K++ Q + G + ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVNR-PNFKNLAVDKIGGLLLFKIVGQKIRG-DDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITNTNPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A++  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANKHKIFIT 268


>gi|146341057|ref|YP_001206105.1| hypothetical protein BRADO4128 [Bradyrhizobium sp. ORS278]
 gi|146193863|emb|CAL77880.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 285

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 140/272 (51%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILHQY 64
           +IA  G+LP+ VA A   +   PV+ ++   C       F    + LG       +L   
Sbjct: 14  LIAAGGVLPFAVADAIVARGQTPVLFALKGICDPKPLARFRHHWIGLGQLGNALKLLKAE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            +  ++  G +  RP V ++ F    +LR    IW    GG+  +L     + E +G  +
Sbjct: 74  GVRDLMFIGNL-VRPAVSEIRFDWG-TLRELPYIWSAFRGGDDHLLSGVGRIFERHGFHM 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++ P LLV  G L    P   V  DI   M    A++  DVGQ+ V I G VVALE
Sbjct: 132 IGVKDVAPNLLVPEGPLTRSRPTDLVTGDIAKGMSVLRAMAPFDVGQAVVVIDGHVVALE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            IEGTD +L R+   R + RI +    GVLVK  K+ QD+R DLP+IG +TVQ +  AGL
Sbjct: 192 DIEGTDGLLARVARLRADRRIRSAVGRGVLVKAPKAGQDLRYDLPTIGPRTVQGLSAAGL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ +  +L+ + +     AD AG+F+ G+
Sbjct: 252 AGVAVASAYTLLADPQETVTAADRAGVFITGV 283


>gi|167646754|ref|YP_001684417.1| hypothetical protein Caul_2792 [Caulobacter sp. K31]
 gi|167349184|gb|ABZ71919.1| protein of unknown function DUF1009 [Caulobacter sp. K31]
          Length = 283

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 154/291 (52%), Gaps = 33/291 (11%)

Query: 2   KRLLIIAGSGMLPYYVAK----------AARLKN-DEPVIASVLNECSFDWQDFECRELP 50
           ++L +IAG G LP  +A+            RL++  EPV+A            +   E+ 
Sbjct: 5   RKLGLIAGGGSLPVELAQHCEAAGRPFSVMRLRSFAEPVLAR-----------YPGVEVG 53

Query: 51  LGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG---GNA 107
           LG+F  +   L       +  AG ++R P+      +IK  LR   ++  L++    G+ 
Sbjct: 54  LGEFGKVFKALRAEGCEAVCFAGVVER-PDFA----AIKPDLRGLTVMPGLINAARKGDD 108

Query: 108 AILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSEL 167
           A+L+  +   E  G ++ GAHE+  E+ +  GSLG   P    + D+  A+  A A+  L
Sbjct: 109 ALLRRLLSEFEKEGFAIEGAHEVRGEMTLPRGSLGRHAPTDAHRTDMDRALTVARAIGAL 168

Query: 168 DVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN--NGRILAGKSGVLVKMCKSQQDMRA 225
           DVGQ AV   G V+A+E  EGTD+ML+R+ D      GR  A + GVL K  K  Q+ + 
Sbjct: 169 DVGQGAVVCDGLVLAVEAQEGTDAMLRRVADLPEAIRGRAEAPR-GVLAKAPKPIQETKV 227

Query: 226 DLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           DLP+IG  TVQ   +AGLAG+  EAG+ L++++E V   AD+ G+FV G++
Sbjct: 228 DLPTIGVATVQRAARAGLAGVVGEAGRLLIVDREQVIACADDLGLFVYGVE 278


>gi|254294067|ref|YP_003060090.1| hypothetical protein Hbal_1705 [Hirschia baltica ATCC 49814]
 gi|254042598|gb|ACT59393.1| protein of unknown function DUF1009 [Hirschia baltica ATCC 49814]
          Length = 286

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 150/279 (53%), Gaps = 10/279 (3%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSIL 61
           +L IIAGSG LP  +AK A+ +     I  +      +  + F  + + +G+     S L
Sbjct: 5   KLGIIAGSGDLPETLAKHAQKEGRSVFIVGIAGFVEPELLEQFAHKVISVGEVGKQLSAL 64

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
              N+  +  AG + +RPN ++L    K  + + K++ +  S G+ A+L+  +  +E  G
Sbjct: 65  KSENVNEVCFAGIV-KRPNFKNLKLDAKGMMILPKVL-KAASQGDDALLRVLVKTIEREG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             VVGA +++  L+  +GSLG   P+     DI  A + A  +  LD+GQ A+   G V+
Sbjct: 123 FKVVGADDVLTSLVAPIGSLGKHSPSSADFADIKKAAQIAAEIGRLDIGQGAIVCDGLVL 182

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKS----GVLVKMCKSQQDMRADLPSIGAKTVQN 237
           A+E  EGTD MLQR     +N   L G +    GVLVK  K  Q+ R DLP+IG +T++ 
Sbjct: 183 AVEAQEGTDLMLQRCAALPDN---LRGSTKVPRGVLVKRPKPVQERRVDLPTIGIRTLEG 239

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
             +A L+GIA EA  +L+L  + +  +AD  G+++ G +
Sbjct: 240 AKRACLSGIAYEANSALLLNMDELIAYADNNGLWIYGFE 278


>gi|91205179|ref|YP_537534.1| hypothetical protein RBE_0364 [Rickettsia bellii RML369-C]
 gi|91068723|gb|ABE04445.1| unknown [Rickettsia bellii RML369-C]
          Length = 270

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 135/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LP  +A   + +     IA++  E + +  +DFE +   +G       
Sbjct: 2   LPNLGIIAGKGSLPSLIADNYKKQGGNCYIAAIEGEANIELIKDFEYQPFKIGMVGAAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              QYN+  I+  G +DR PN ++L       L + K+I Q + G +  +L+      E+
Sbjct: 62  YFTQYNVQNIIFIGGVDR-PNFKNLAVDKIGGLLLLKIISQKIRGDDN-LLRIVAKFFEN 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ + EI          +    P    K+DI   +K    LS+ DVGQS +   G 
Sbjct: 120 YGFKVISSSEIYQNQQCDSTIITDTSPTNSDKKDIEFGVKLLNHLSKFDVGQSVIVEDGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E  EGTD+++ R  D R          GVL+K+ K  QD R DLP+IG  T++N+ 
Sbjct: 180 VLGIEAAEGTDNLIARCADLRKKSC-----GGVLIKLSKIGQDNRLDLPTIGVNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++  + ++ E+E   K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKKQVIIAEEEKTIKLANEHKIFIT 268


>gi|298529238|ref|ZP_07016641.1| protein of unknown function DUF1009 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510674|gb|EFI34577.1| protein of unknown function DUF1009 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 279

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 140/277 (50%), Gaps = 14/277 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           K+L IIAG G  P  VA+ AR +      A+   E   + Q +  +   L LG    L  
Sbjct: 5   KKLGIIAGGGSFPLLVAQNARKQGYRVAAAAFEKETLPEIQAYTDQLVWLKLGQLGRLIR 64

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            LHQ  +  +V AG I++ P      F ++   R  K++  L S  + A+L +  D L  
Sbjct: 65  FLHQAGVSHVVFAGPINK-PR----AFDLRPDFRAIKLLVNLRSRNDNALLSSVADELHR 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+ A E VPEL+   G      P+   K+DIL A    + +  LD+GQ  V     
Sbjct: 120 EGLEVISAIEFVPELISPAGLQSRRAPSFAEKKDILFAWPIIKQIGSLDIGQCIVVKERA 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E IEGTD  + R  +       L+G S  +VK+ K  QD R DLP++G++TV+ +I
Sbjct: 180 VVAVEAIEGTDRAILRAGE-------LSGSSLTVVKIFKPGQDQRIDLPALGSQTVRTMI 232

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AG   +A E+G SL  ++      ADE  I + GID
Sbjct: 233 QAGATCLAYESGTSLFFDRAEAVSLADEHKICLVGID 269


>gi|114327609|ref|YP_744766.1| hypothetical protein GbCGDNIH1_0945 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315783|gb|ABI61843.1| hypothetical protein GbCGDNIH1_0945 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 294

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 145/274 (52%), Gaps = 8/274 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILH 62
           L IIAGSG LP  VA AA     +  I +V      +    +    + +G    + ++L 
Sbjct: 19  LGIIAGSGDLPGRVAAAAMRAGRDVFIIAVEGHAEPEVVGPYPHAFVRVGAAGRILALLK 78

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           Q     +V+ G + +RP++  L    + + RI   I +    G+  +L A + +L   G 
Sbjct: 79  QAGCRDLVLVGPV-KRPSILQLRPDAEGA-RILTRIGKAAFAGDDGLLAAVVRVLAEEGF 136

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAH+++ +++   G +   VP++  + DI   +   +AL  +DVGQ  V   G  +A
Sbjct: 137 QVIGAHDVLTDIVGPAGVMTRVVPDKTAQLDITRGIAVVQALGAVDVGQGCVVQQGIALA 196

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E IEGTD+ML R       G       GVL+K+ K  QD RADLP++G +TV+   +AG
Sbjct: 197 VEAIEGTDAMLARSATVARPG-----PGGVLIKLVKPGQDRRADLPTLGPRTVRAATEAG 251

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           L GIA EAG +++  +  + + ADE G+F+ GID
Sbjct: 252 LRGIAFEAGGTILTAQAEMVRLADEGGLFLIGID 285


>gi|157827484|ref|YP_001496548.1| hypothetical protein A1I_05955 [Rickettsia bellii OSU 85-389]
 gi|157802788|gb|ABV79511.1| hypothetical protein A1I_05955 [Rickettsia bellii OSU 85-389]
          Length = 270

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 135/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LP  +A   + +     IA++  E + +  ++FE +   +G       
Sbjct: 2   LPNLGIIAGKGSLPSLIAGNYKKQGGNCYIAAIEGEANIELIKEFEYQPFKIGMVGAAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              QYN+  I+  G +DR PN ++L       L + K+I Q + G +  +L+      E+
Sbjct: 62  YFTQYNVQNIIFIGGVDR-PNFKNLAVDKIGGLLLLKIISQKIRGDDN-LLRIVAKFFEN 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ + EI          +    P    K+DI   +K    LS+ DVGQS +   G 
Sbjct: 120 YGFKVISSSEIYQNQQCDSTIITDTSPTNSDKKDIEFGVKLLNHLSKFDVGQSVIVEDGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E  EGTD+++ R  D R          GVL+K+ K  QD R DLP+IG  T++N+ 
Sbjct: 180 VLGIEAAEGTDNLIARCADLRKKSC-----GGVLIKLSKIGQDNRLDLPTIGVNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++  + ++ E+E   K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNQVIIAEEEKTIKLANEHKIFIT 268


>gi|224369343|ref|YP_002603507.1| hypothetical protein HRM2_22450 [Desulfobacterium autotrophicum
           HRM2]
 gi|223692060|gb|ACN15343.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 271

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 139/272 (51%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQ 63
           +IAG G  P   AK A++K  E    + +NE S D  D     + + LG    + +   +
Sbjct: 5   LIAGGGQFPLLFAKKAKIKGYEIHAVAYVNEASTDLSDHVDTIQWMHLGQVGRMLTFFKR 64

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             I + V+ G++ +     D    IK  L+    I ++    + +IL+A  DLLES GV+
Sbjct: 65  QEIAQAVMLGSVKKTRIFTD----IKPDLKALAFIARMGHTHDDSILRAFADLLESQGVT 120

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  +  ++PEL+   G      P R  K+DI    + A  +  LDVGQ+ V   G V+A+
Sbjct: 121 IKPSTFLLPELVSPRGCWTKRRPGRSEKKDIRTGWRIAREIGRLDVGQAIVIGNGTVLAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E  +GTD+ ++R                VLVK+CK  QD R DLPS G +T+Q ++ +G+
Sbjct: 181 EAADGTDATIRRGGLLGGG-------GSVLVKLCKPGQDRRFDLPSTGVETIQAMVDSGV 233

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + + LEA +S+  ++E +   ADE GI +  +
Sbjct: 234 SVLVLEAERSISFDREQMTALADEHGIAIVAM 265


>gi|163854073|ref|YP_001642116.1| hypothetical protein Mext_4677 [Methylobacterium extorquens PA1]
 gi|163665678|gb|ABY33045.1| protein of unknown function DUF1009 [Methylobacterium extorquens
           PA1]
          Length = 282

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 156/280 (55%), Gaps = 11/280 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCVLR 58
           + L ++AG+G LP  VA A+  +   P    VL    F  +    R    + L D     
Sbjct: 6   RPLALVAGAGHLPELVA-ASLDRAQRPF--RVLAVRGFTERAMRRRADAVVDLLDIPGTL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL ++    +V AG + R P+   L  +   ++R ++ I + ++GG+  +L+A + LLE
Sbjct: 63  RILREWAPAAVVPAGGVTR-PSPAAL-LNAAHAVR-NRDILKSLAGGDDRLLRAVLSLLE 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+G HE+ P+LL ++G LG   P+ D    I +      ALS  DVGQ+AV  G 
Sbjct: 120 ENGHRVLGVHEVAPDLLGRLGRLGRVEPDSDATLSIASGRAMLGALSPFDVGQAAVVAGE 179

Query: 179 RVVALEGIEGTDSML--QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           RV+A+EG EGTD ML   R ++ +  GR    K  VLVK+ K  QD+R DLP+IG +TV+
Sbjct: 180 RVIAVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVR 239

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              +AG AGIA+ AG +LV++ E     AD AG+F+ G++
Sbjct: 240 RAAEAGCAGIAIGAGHTLVIDGEATVAAADAAGLFLIGVE 279


>gi|85716984|ref|ZP_01047947.1| hypothetical protein NB311A_06388 [Nitrobacter sp. Nb-311A]
 gi|85696186|gb|EAQ34081.1| hypothetical protein NB311A_06388 [Nitrobacter sp. Nb-311A]
          Length = 285

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 92/272 (33%), Positives = 144/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQY 64
           +IAG G+LP+ VA +   +  +PV  ++   C  +    F    + +G    +  +L   
Sbjct: 14  LIAGGGVLPFAVADSLTARGLKPVFFALKGVCDPERVSHFPHHWIAVGQIGKVVRLLRAE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
           N   +V  G +  RP + ++      ++R+   +     GG+  +L     +LE  G  +
Sbjct: 74  NCRDLVFIGTL-VRPALSEIRLDWG-TIRVMGQVLAAFRGGDDHLLSGIGRILERDGFRM 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  +I P+LL+  G L    P+R    DI   +    ALS  DVGQ+ V I G V+ +E
Sbjct: 132 MGIKDIAPDLLMPAGCLTRKTPDRSAAADIAKGLDVLRALSPFDVGQAVVVIDGHVIGVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRI-LAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           GIEGTD++L R+   R  GRI      GVLVK  K  QD+R DLP++G +T++N   AGL
Sbjct: 192 GIEGTDALLARVAQLRAEGRIRTKAARGVLVKAPKHGQDLRYDLPTLGPQTIENAAAAGL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ AG +LV E + +   AD + +FV G+
Sbjct: 252 AGLAVVAGNTLVAEPQALVGKADASNLFVVGL 283


>gi|240141527|ref|YP_002966007.1| hypothetical protein MexAM1_META1p5126 [Methylobacterium extorquens
           AM1]
 gi|240011504|gb|ACS42730.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 282

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 103/280 (36%), Positives = 156/280 (55%), Gaps = 11/280 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCVLR 58
           + L ++AG+G LP  VA A+  +   P    VL    F  +    R    + L D     
Sbjct: 6   RPLALVAGAGHLPELVA-ASLDRARRPF--RVLAVRGFTERAMRRRADAVVDLLDIPGTL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL ++    +V AG + R P+   L  +   ++R ++ I + ++GG+  +L+A + LLE
Sbjct: 63  RILKEWAPAAVVPAGGVTR-PSPAAL-LNAAHAVR-NRDILKSLAGGDDRLLRAVLSLLE 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+G HE+ P+LL ++G LG   P+ D    I +      AL   DVGQ+AV  G 
Sbjct: 120 ENGHRVLGVHEVAPDLLGRLGRLGRVEPDSDATLSIASGRAMLGALGPFDVGQAAVVAGE 179

Query: 179 RVVALEGIEGTDSML--QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           RV+A+EG EGTD ML   R ++ +  GR    K  VLVK+ K  QD+R DLP+IG +TV+
Sbjct: 180 RVIAVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVR 239

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              +AG AGIA+ AG +LV+++E     AD AG+F+ G++
Sbjct: 240 RAAEAGCAGIAIGAGHTLVIDREATVAAADAAGLFLIGVE 279


>gi|154253622|ref|YP_001414446.1| hypothetical protein Plav_3183 [Parvibaculum lavamentivorans DS-1]
 gi|154157572|gb|ABS64789.1| protein of unknown function DUF1009 [Parvibaculum lavamentivorans
           DS-1]
          Length = 291

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 151/281 (53%), Gaps = 10/281 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           ++L I AG+G LP  +A+AA+    E  I  +    + D   F    + LG       +L
Sbjct: 8   RKLGIAAGAGPLPVALAEAAQAAGREVFIVGIEGAANEDIARFPHAWVKLGAMGEFLRLL 67

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES-Y 120
                  IV+ G + RRP++  L   +   +++   + + +  G+  +L+   +  E  +
Sbjct: 68  KSAGCQDIVLIGGL-RRPDISKLGLDVT-GMKLLPRVARWMKEGDDGLLRGLAEYFEKDH 125

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVGAHEI   LL+    L    P+   +RDI  A+++A A+  LD+GQ AV+  G V
Sbjct: 126 GFHVVGAHEIAASLLMPEALLTKAAPSDQQERDIDTAIRAALAIGALDIGQGAVACRGIV 185

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKS----GVLVKMCKSQQDMRADLPSIGAKTVQ 236
           +ALE  EGTD ML R+         L G      GVLVK+ K  Q+ R D+P+IG +TV+
Sbjct: 186 LALEAAEGTDEMLHRVARLPAE---LTGSPEVPDGVLVKLSKPGQERRVDMPTIGIQTVE 242

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           N   AGLAGIA+EAG +LV++ E V + A+  G+FV G+ R
Sbjct: 243 NAAAAGLAGIAVEAGGTLVVDGEAVARAANAKGLFVLGLSR 283


>gi|218533018|ref|YP_002423834.1| hypothetical protein Mchl_5142 [Methylobacterium chloromethanicum
           CM4]
 gi|218525321|gb|ACK85906.1| protein of unknown function DUF1009 [Methylobacterium
           chloromethanicum CM4]
          Length = 282

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 155/280 (55%), Gaps = 11/280 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCVLR 58
           + L ++AG+G LP  VA A+  +   P    VL    F  +    R    + L D     
Sbjct: 6   RPLALVAGAGHLPELVA-ASLDRARRPF--RVLAVRGFTERAMRRRADAVVDLLDIPGTL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL ++    +V AG + R P+   L  +   ++R ++ I + ++GG+  +L+A + LLE
Sbjct: 63  RILKEWAPAAVVPAGGVTR-PSPAAL-LNAAHAVR-NRDILKSLAGGDDRLLRAVLSLLE 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+G HE+ P+LL ++G LG   P+ D    I        ALS  DVGQ+AV  G 
Sbjct: 120 ENGHRVLGVHEVAPDLLGRLGRLGRVDPDSDATLSIATGRAMLGALSPFDVGQAAVVAGE 179

Query: 179 RVVALEGIEGTDSML--QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           RV+A+EG EGTD ML   R ++ +  GR    K  VLVK+ K  QD+R DLP+IG +TV+
Sbjct: 180 RVIAVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVR 239

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              +AG AGIA+ AG +LV++ E     AD AG+F+ G++
Sbjct: 240 RAAEAGCAGIAIGAGHTLVIDGEATVAAADAAGLFLIGVE 279


>gi|297568837|ref|YP_003690181.1| protein of unknown function DUF1009 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924752|gb|ADH85562.1| protein of unknown function DUF1009 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 281

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/284 (32%), Positives = 141/284 (49%), Gaps = 21/284 (7%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-----ECRELPLGDFC 55
           M +L IIAG G  P  VAKAAR    E V+ +   E    W +       C+ + LG   
Sbjct: 4   MTKLGIIAGGGQFPLLVAKAARDNGRETVVVAHRGES---WPELAEVADHCQWVKLGQLQ 60

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG-GNAAILKASI 114
            L +  H++ +   V+AG I +    +D+    K     +  +W+ +    + AIL+A  
Sbjct: 61  KLLNFFHRHGVTECVLAGTITKTRMFRDIWPDFK-----ALALWRRIDARQDDAILRALA 115

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
            LL   G+ V  +   +  LL   G LG   P+     DI    + A  +  LD+GQ  V
Sbjct: 116 GLLADEGIQVAPSTLYLQNLLFPRGVLGQKKPDEQQWEDIRFGWRIARQVGALDIGQCVV 175

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
                V+A+E IEGTD+ ++R       G  LAG+  V+VK+ K  QD R DLP+IG +T
Sbjct: 176 VRDRAVLAVEAIEGTDAAIKR-------GGELAGELAVVVKVRKPNQDFRFDLPAIGPRT 228

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +  + +   A +A+EAG++L+ + E   + AD AGI + G+  E
Sbjct: 229 ISGMSEVKAAVLAVEAGQALLFDPEETVRLADRAGIAILGLSEE 272


>gi|254430214|ref|ZP_05043917.1| phosphatidate cytidyltransferase [Cyanobium sp. PCC 7001]
 gi|197624667|gb|EDY37226.1| phosphatidate cytidyltransferase [Cyanobium sp. PCC 7001]
          Length = 276

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 140/274 (51%), Gaps = 15/274 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI--- 60
           L IIAG+G+LP  +++A    +  P +    +    +  D E       +F   RSI   
Sbjct: 6   LAIIAGAGVLPRMLSQAL-TASGRPHLVCRPHGLEVEIDDAE-------EFYFERSISFF 57

Query: 61  --LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L Q  I ++V+ G    RP   ++      +L  +  I   +  G+ A L+A  +++E
Sbjct: 58  RSLEQRGIRQVVMVGKF-HRPRALNIMRFEGSTLMAAPRILASLRKGDDASLRALAEIIE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ VVG  E+ P LL + G   + +P+   + D+  A    EA+S +DVGQ AV  GG
Sbjct: 117 ELGLEVVGVEEVAPNLLPEPGLYASRLPSEADRADVERAAHIVEAISMVDVGQGAVVAGG 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A E + GTD+ML  +   R  G   A +SGVL K  K QQD R DLP+IG  TV   
Sbjct: 177 LCLATEALPGTDAMLDWVASSRALG-PEAPRSGVLYKAPKLQQDRRMDLPAIGPTTVAKA 235

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             AGL+GIA EA  +L+L+ E     A+  G+F+
Sbjct: 236 AAAGLSGIAWEARGALLLDAERTMADAERLGLFL 269


>gi|90423948|ref|YP_532318.1| hypothetical protein RPC_2448 [Rhodopseudomonas palustris BisB18]
 gi|90105962|gb|ABD87999.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           BisB18]
          Length = 284

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 142/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECRELPLGDFCVLRSILHQY 64
           ++AG G+LP+ VA +   +   P+I ++   C +     +    + +G F  L+ +L   
Sbjct: 13  LVAGGGVLPFAVADSLLARGITPIIFALNGFCDAAALHRYRHHWISIGRFGRLQKLLRAE 72

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
           +   +V  GA+  RP++ ++      ++++ + +     GG+  +L     + E  G  +
Sbjct: 73  HCRELVFIGAV-VRPSLSEVRLD-WGAVKVIRAVMAAYRGGDDHLLSGIGQIFEKDGFRL 130

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++ P+LL+  G L    P+     DI        ALS  D+GQ  V I G VVA+E
Sbjct: 131 LGIRDVAPDLLMPAGCLTRATPDGSTVADIAKGRAVLAALSPFDIGQGCVVIDGHVVAVE 190

Query: 185 GIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            I GTD++L  +   R    I A  + GVLVK  K  Q++R DLP++G +T+  V  A L
Sbjct: 191 DIGGTDALLASVARLRAQRLIRAKPRRGVLVKAPKVGQNLRFDLPALGPRTIAGVAAAEL 250

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AGIA+ AG ++V E + +   AD AG+F+ G+
Sbjct: 251 AGIAVVAGHTVVAEPQPMIDAADRAGLFITGM 282


>gi|316933933|ref|YP_004108915.1| hypothetical protein Rpdx1_2595 [Rhodopseudomonas palustris DX-1]
 gi|315601647|gb|ADU44182.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           DX-1]
          Length = 285

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 140/271 (51%), Gaps = 4/271 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQY 64
           IIAG G LP+ VA     +   PV+ ++   C  +    +    LP+G    L  +L   
Sbjct: 14  IIAGGGALPFAVADTLAARGLTPVLFALKGSCDSERVSAYRHHWLPMGALGRLLRLLRAE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
               +V  G++  RP + ++      ++++   +     GG+  +L     L E +G  +
Sbjct: 74  GCRDLVFIGSL-VRPALSEMRLDWG-AIKVLPAVLAAYRGGDDHLLTGVGRLFERHGFRL 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +G  ++  +LL+  G L    P+  V+ DI        ALS  D+GQ  V I G VVA+E
Sbjct: 132 LGLKDVASDLLIPQGCLTRAAPDASVEADIAKGRAVLAALSPFDIGQGCVVIDGHVVAVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
              GTD +L+R+   R++ RI A    GVLVK  K+ QD+R DLP++G  T++ ++ A L
Sbjct: 192 DTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKAGQDLRFDLPAVGPTTIEGLVAARL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            G+A+ AG ++V E + +   AD AG+FV G
Sbjct: 252 GGVAVVAGHTVVAEPQTMIAAADRAGLFVIG 282


>gi|51473899|ref|YP_067656.1| hypothetical protein RT0716 [Rickettsia typhi str. Wilmington]
 gi|51460211|gb|AAU04174.1| rickettsial conserved hypothetical protein [Rickettsia typhi str.
           Wilmington]
          Length = 274

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 140/276 (50%), Gaps = 8/276 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L +IAG G LP+ +A     +  +  IA++ +E +    +DFE +   +G       
Sbjct: 2   LPNLGMIAGRGSLPHLIAYNYIKQGGKCYIAAIKDETNIKQIKDFEYKIFKIGMVGEAIR 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
               +N+  I+  G I+R PN ++L       L + K++ Q + G ++ +LK   +  ES
Sbjct: 62  YFKDHNVKNIIFIGGINR-PNFKNLAVDKIGGLLLFKIVGQTIRGDDS-LLKIVAEFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYRNQQCNSNIITNTTLTSSDKNDIELGIKVLNHLSLFDIAQSVIVKNGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKS--GVLVKMCKSQQDMRADLPSIGAKTVQN 237
           ++ +E  EGTD+++ R  D RN      G+S  GVLVK+ K  QD R D+P+IG  T++N
Sbjct: 180 ILGIEAAEGTDNLIVRCADLRNKSH---GESHGGVLVKIPKLGQDNRLDMPTIGPNTIKN 236

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           + K    G+A++  K +++E+EL  K A++  IF+ 
Sbjct: 237 LAKYNYQGLAIQKNKVIIVEEELTIKLANKHKIFIT 272


>gi|308272625|emb|CBX29229.1| hypothetical protein N47_J02100 [uncultured Desulfobacterium sp.]
          Length = 273

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/276 (30%), Positives = 143/276 (51%), Gaps = 13/276 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           K++ +IAGSG  P   +K A  K      A+ +NE     ++   +   L LG    L +
Sbjct: 7   KKIGLIAGSGQFPIIFSKIAVSKGFLVYAAAFINEAEETLKEEVEKIEWLHLGQVKRLVN 66

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  I  +V+ GAI +     D    +K  ++   +I  + S  +  +L A   +LE 
Sbjct: 67  FFKKNEIKEVVMLGAIKKTKMFSD----VKPDMKAISLIMHMKSTHDDGLLSAFAGMLEK 122

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V  +  ++P+LL Q G      P R  K DI   +  A+ +  LD+GQ  V  GG 
Sbjct: 123 EGIIVKSSTFLLPDLLAQEGCWTKRKPTRSEKADINIGLHIAKEIGRLDIGQCVVVCGGS 182

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E I+GTD+ ++R       G  L     V+VK+CK +QD R D+P++G +T+  + 
Sbjct: 183 VLAVEAIDGTDATIRR-------GGKLGNGEAVIVKVCKPEQDTRFDMPAVGIQTISTMY 235

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           ++G+  +A+EA K++V ++E + + AD+ GI +  +
Sbjct: 236 ESGVKALAVEANKAVVFDREDMIRLADKVGISIVAV 271


>gi|86749933|ref|YP_486429.1| hypothetical protein RPB_2816 [Rhodopseudomonas palustris HaA2]
 gi|86572961|gb|ABD07518.1| Protein of unknown function DUF1009 [Rhodopseudomonas palustris
           HaA2]
          Length = 285

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 145/272 (53%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECRELPLGDFCVLRSILHQY 64
           +IAG G+LP+ VA A + +   P++  +   C   +   F    + +G F  L+ +L   
Sbjct: 14  VIAGGGVLPFAVADALQTRTITPLLIGLRGFCDPNEIARFRHHWISIGQFGRLKRLLRTE 73

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
           +   +V  G++ R P +  +      + R+   +     GG+  +L +   + E  G  +
Sbjct: 74  HCRDVVFIGSLIR-PALTSVRLDW-GAFRVLPRVMAAYRGGDDHLLTSIGRIFEGEGFRL 131

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
            G  ++ PELL+  G L    P+   + DI        ALS  D+GQ+ + I G VVA+E
Sbjct: 132 RGVKDVAPELLMPPGELTKAAPDTRHRADIAKGQAVLAALSPFDIGQAVIVIEGHVVAVE 191

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            I GTD++L  +   R  GRI A    GVLVK  K+ QD+R DLP++G +T++ V  AGL
Sbjct: 192 DIGGTDALLANLARLRGQGRIAAKPGRGVLVKAPKTGQDLRFDLPTLGPRTIEGVAAAGL 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ AG +LV E + +   AD+AG+FV G+
Sbjct: 252 AGVAVAAGNTLVAEPQAMIAAADKAGLFVTGV 283


>gi|75676038|ref|YP_318459.1| hypothetical protein Nwi_1847 [Nitrobacter winogradskyi Nb-255]
 gi|74420908|gb|ABA05107.1| Protein of unknown function DUF1009 [Nitrobacter winogradskyi
           Nb-255]
          Length = 288

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 142/272 (52%), Gaps = 4/272 (1%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQY 64
           +IAG G+LP+ VA +   +  +PV  ++   C  +    F    + +G    +  +L   
Sbjct: 17  LIAGGGVLPFAVADSLTARGLKPVFFALKGVCDPERVSRFPHHWIAVGQIGKVMRLLRAE 76

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
           N   +V  G +  RP + ++      ++R    +     GG+  +L     +LE  G  +
Sbjct: 77  NCRDLVFIGTL-VRPALSEIRLDWG-TIRAMGQVLAAFRGGDDHLLSGVGRILERDGFRM 134

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           VG  +I P+LL+  G L    P++    DI   +    ALS  DVGQ+ V I   VV +E
Sbjct: 135 VGIKDIAPDLLMPAGCLTRKAPDQSAAADIAKGLDVLRALSPFDVGQAVVVIDAHVVGVE 194

Query: 185 GIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           GIEGTD++L RI   R  GRI A    GVLVK  K  QD+R DLP++G +T+ N   AGL
Sbjct: 195 GIEGTDALLARIAQLRAAGRIRAKAPRGVLVKAPKHGQDLRYDLPTLGPRTIANAAAAGL 254

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AG+A+ AG +LV E + +   AD + +FV G+
Sbjct: 255 AGLAVVAGNTLVAEPQALVGEADASNLFVVGL 286


>gi|83592933|ref|YP_426685.1| hypothetical protein Rru_A1598 [Rhodospirillum rubrum ATCC 11170]
 gi|83575847|gb|ABC22398.1| Protein of unknown function DUF1009 [Rhodospirillum rubrum ATCC
           11170]
          Length = 286

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 144/277 (51%), Gaps = 10/277 (3%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC-SFDWQDFECRELP-LGDFCVLRSIL 61
           L IIAG G LP  V +A + +    V+  +  +  +  W      +   LG    +   L
Sbjct: 13  LAIIAGGGDLPKRVVEACQAQGRPFVVVGLNGQAETTGWPPGVPHQWTRLGKCGGMAEDL 72

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               I  + +AG + +RP++  L    + +  ++K+     + G+  +L A +  LES G
Sbjct: 73  RDRGILHLCMAGRV-KRPSLVSLLPDWRTAAFLAKV--GAAALGDDGLLSAIVRELESNG 129

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            ++    +++    +  G +G  VP+   +RD+  A + A+AL  LD+GQ  V   G V+
Sbjct: 130 FTIEAPDQVIGARPLGAGVIGRIVPDDQARRDLAHAFRMAKALGALDIGQGVVVQQGLVL 189

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E IEGTD+ML+R      +G        VLVK CK QQD R DLP++GA+T++   +A
Sbjct: 190 AVEAIEGTDAMLERCACLLRDG-----PGAVLVKACKPQQDRRVDLPALGARTLEVAARA 244

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GL G+  EAG  ++L+   + K AD+ G+F  G+  E
Sbjct: 245 GLRGVGFEAGAVVLLDPAGLGKRADDLGLFFVGLSAE 281


>gi|254564044|ref|YP_003071139.1| hypothetical protein METDI5730 [Methylobacterium extorquens DM4]
 gi|254271322|emb|CAX27334.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 282

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 102/280 (36%), Positives = 154/280 (55%), Gaps = 11/280 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCVLR 58
           + L ++AG+G LP  VA A+  +   P    VL    F  +    R    + L D     
Sbjct: 6   RPLALVAGAGHLPELVA-ASLDRARRPF--RVLAVRGFTERAMRRRADAVVDLLDIPGTL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL ++    +V AG + R P+   +  +   ++R ++ I + ++GG+  +L+A + LLE
Sbjct: 63  RILKEWAPAAVVPAGGVTR-PSPAAI-LNAAHAVR-NRDILKSLAGGDDRLLRAVLSLLE 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+G HE+ P+LL ++G LG   P+ D    I        ALS  DVGQ+AV  G 
Sbjct: 120 ENGHRVLGVHEVAPDLLGRLGRLGRVEPDSDATLSIATGRAMLGALSPFDVGQAAVVAGE 179

Query: 179 RVVALEGIEGTDSML--QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           RV+A+EG EGTD ML   R ++ +  G     K  VLVK+ K  QD+R DLP+IG +TV+
Sbjct: 180 RVIAVEGPEGTDRMLARARALNRKPFGHGTPAKGSVLVKLPKLGQDLRIDLPAIGPRTVR 239

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              +AG AGIA+ AG +LV++ E     AD AG+F+ G++
Sbjct: 240 RAAEAGCAGIAIGAGHTLVIDGEATVAAADAAGLFLIGVE 279


>gi|58040254|ref|YP_192218.1| hypothetical protein GOX1823 [Gluconobacter oxydans 621H]
 gi|58002668|gb|AAW61562.1| Hypothetical protein GOX1823 [Gluconobacter oxydans 621H]
          Length = 280

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/219 (35%), Positives = 126/219 (57%), Gaps = 9/219 (4%)

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L + N   +V+ G + RRP  +DL    + + RI   + + +  G+  +L A + +L   
Sbjct: 65  LKRNNCRELVLIGPV-RRPAWRDLRPDAEGA-RILARLGRAIFSGDDGLLGAVVRVLGEE 122

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V GAHE +     + G+LG  +P+   K+DI   ++  + ++ LD+GQ  V   G V
Sbjct: 123 GFHVRGAHEFLEHATGRSGTLGRVLPDAQAKQDIARGVEVLKVMAALDIGQGCVVQNGLV 182

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRIL-AGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E +EGTD+ML R       GR++ AG  GVLVKM K+ QD+RAD+P+IG +T++N  
Sbjct: 183 LAVEALEGTDAMLGRC------GRLMQAGSGGVLVKMPKTGQDVRADMPTIGPETLENAA 236

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           + GL G+A + G +L+ +     K AD  G+F+ G+  E
Sbjct: 237 RNGLRGVAFQPGVTLMTDPAGCVKLADRYGLFLYGLTPE 275


>gi|220921521|ref|YP_002496822.1| hypothetical protein Mnod_1527 [Methylobacterium nodulans ORS 2060]
 gi|219946127|gb|ACL56519.1| protein of unknown function DUF1009 [Methylobacterium nodulans ORS
           2060]
          Length = 281

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 118/212 (55%), Gaps = 8/212 (3%)

Query: 69  IVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAH 128
           + +AGA+ R P+   L  ++   LR    +  L  GG+  +L+  + LLE +G  ++G H
Sbjct: 71  VTLAGAVAR-PSPAALLNTLA-VLRNRDELRSLAQGGDDHLLRGVLALLEEHGHRILGVH 128

Query: 129 EIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEG 188
           E+ P+L+ + G LG   P+   +  +        +LS  DVGQ+AV    RV+A+EG EG
Sbjct: 129 ELAPDLMAKPGPLGAGRPDAAAETSVATGRALLASLSAHDVGQAAVVANRRVLAIEGPEG 188

Query: 189 TDSMLQRIVDCRNN----GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
           TD ML R           GR   G   VLVK+ KS QD+R DLP+IG +TV+    AG +
Sbjct: 189 TDRMLARARSLARRPFGLGRPPTGL--VLVKLAKSGQDLRVDLPAIGPRTVRAAAAAGCS 246

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           GIA+ AG +L+L++      AD  G+F+ G++
Sbjct: 247 GIAVGAGDTLILDRAETAALADRLGLFLLGLE 278


>gi|310822807|ref|YP_003955165.1| hypothetical protein STAUR_5573 [Stigmatella aurantiaca DW4/3-1]
 gi|309395879|gb|ADO73338.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 267

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 87/284 (30%), Positives = 152/284 (53%), Gaps = 27/284 (9%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE---------CSFDWQDFECRELPL 51
           M+R+ +IAG+G LP+  A+ AR +  + V  +   E          +F W       + L
Sbjct: 1   MERIGLIAGNGQLPFLFAREARARGMDVVAVAHRGETDPALEREVAAFTW-------VRL 53

Query: 52  GDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILK 111
           G    + S   + ++ +  +AG I R   V+ L  +  D +   +++ +L S  + A+L+
Sbjct: 54  GQVGRIVSTFQKASVTQAAMAGGIGR---VRALTEARPD-MGAVRILSRLRSLRDDALLR 109

Query: 112 ASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQ 171
           A  D  E++GV++V   + + +++   G L     + + ++D+   ++ A  L + DVGQ
Sbjct: 110 AVADHFEAHGVTIVAPTDYLAQVMCPAGHLAGPRLHPEQEKDVALGVEVASLLGKADVGQ 169

Query: 172 SAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIG 231
           + V  GG V+ALE +EGTD  ++R       G  L GK  V+VK CK  QD+R DLP+ G
Sbjct: 170 TVVVKGGNVLALEAVEGTDETIRR-------GAKLGGKGAVVVKRCKPGQDLRFDLPAAG 222

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +T++ + + G   +ALEAG++++LE + +   A+  GI V GI
Sbjct: 223 PRTLEVMAEVGAKVLALEAGRTVLLETQALFARAEADGITVVGI 266


>gi|197105230|ref|YP_002130607.1| hypothetical protein PHZ_c1767 [Phenylobacterium zucineum HLK1]
 gi|196478650|gb|ACG78178.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 279

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 125/206 (60%), Gaps = 10/206 (4%)

Query: 78  RPNVQDLCFSIKDSLRISKMIWQLVSG---GNAAILKASIDLLESYGVSVVGAHEIVPEL 134
           RP+      S+   LR  K++ + V+    G+ A+L+  ++  E+ G +V GAHE++ +L
Sbjct: 77  RPDFT----SLMPDLRGLKLLPRAVAAARKGDDALLRLLVEEFEAEGFAVEGAHEVMDDL 132

Query: 135 LVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQ 194
            +  G LG    + D  RD   A++ A A+  LD+GQ+AV   G V+A+E  EGTD+ML 
Sbjct: 133 TLPSGFLGRARGSDDDLRDADRALEVARAVGRLDIGQAAVVTQGLVLAVEAQEGTDAMLA 192

Query: 195 RIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGK 252
           R+ D   +  GR  AG+ GVL K  K  Q+ R DLP+IG  TVQ V +AGLAGI  EAG+
Sbjct: 193 RVADLPAHLRGRPGAGR-GVLAKAPKPIQETRVDLPTIGLATVQGVARAGLAGIVGEAGR 251

Query: 253 SLVLEKELVKKHADEAGIFVCGIDRE 278
            +VL++E V   ADE G+F+ G++ E
Sbjct: 252 VIVLDREAVISLADELGVFIFGVEPE 277


>gi|302343534|ref|YP_003808063.1| hypothetical protein Deba_2104 [Desulfarculus baarsii DSM 2075]
 gi|301640147|gb|ADK85469.1| protein of unknown function DUF1009 [Desulfarculus baarsii DSM
           2075]
          Length = 275

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 132/269 (49%), Gaps = 13/269 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLRSILHQ 63
           +IAGS   P   AKAAR K    V  + L E       +  E   + LG    L     +
Sbjct: 8   LIAGSNQFPILFAKAARAKGLRVVAVAHLGETVPELAAEVDEITWIHLGQLGKLLKAFRK 67

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R V+ G + +     D    ++  LR   ++  L    +  IL+     +   GV+
Sbjct: 68  AGVTRAVMCGGVTKTRIFSD----VRPDLRALFLLRHLRHMADDGILRTVAQYMADQGVT 123

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           ++ +HE++PELL          P+ D   D       AE L  LD+GQ  V  G  VVA+
Sbjct: 124 IMASHELLPELLADGALHSRRGPSVDELDDARVGWTVAEQLGRLDIGQCVVVRGKAVVAV 183

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD+       C   G  LAG+  V+VK CK  QD+R DLPS+G +TV+ + ++G 
Sbjct: 184 EAIEGTDA-------CIARGGKLAGEKAVVVKRCKPTQDLRFDLPSVGRRTVEVMAESGC 236

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
           + + +E+GK+LV ++E +   ADE GI V
Sbjct: 237 SCLVVESGKTLVFDREPMLSLADEKGICV 265


>gi|46202584|ref|ZP_00052965.2| COG3494: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 259

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 129/242 (53%), Gaps = 15/242 (6%)

Query: 35  NECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRI 94
            E + DW       + LG+       L Q  +  +V+ G + RRP + +L    + +   
Sbjct: 29  QEAAQDW-------IRLGEAGTGFERLRQAGVAEVVMIGPV-RRPTLMELAPDFRTARFF 80

Query: 95  SKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDI 154
           +++  + +  G+  +L+A    LES G  VVG  +++ + L   G  G+  P+   + DI
Sbjct: 81  ARVGLKAL--GDDGLLRAVAAELESEGFKVVGVDDVLSDCLATPGPYGSRTPDEQAQADI 138

Query: 155 LAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLV 214
              +  A  L  LDVGQ+ V   G V+ +E IEGTD++++R   C    R   G+ GVLV
Sbjct: 139 TRGIAVARGLGALDVGQAVVVQQGIVLGVEAIEGTDNLIRR---CGPLAR--EGEGGVLV 193

Query: 215 KMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K+ K  QD R DLP+IG  T++    AGL GIA+EAG +LVL  + + + AD  G+FV G
Sbjct: 194 KLKKPGQDRRIDLPTIGLTTLREAASAGLRGIAVEAGGALVLGGKTLGEEADRLGLFVTG 253

Query: 275 ID 276
           I+
Sbjct: 254 IE 255


>gi|304320060|ref|YP_003853703.1| hypothetical protein PB2503_02422 [Parvularcula bermudensis
           HTCC2503]
 gi|303298963|gb|ADM08562.1| hypothetical protein PB2503_02422 [Parvularcula bermudensis
           HTCC2503]
          Length = 290

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 146/281 (51%), Gaps = 14/281 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSI 60
           K+L IIAG G LP  +A++ + + D P     L+  + D  + F+     +G+      +
Sbjct: 6   KKLGIIAGGGSLPLKIAESCQ-QQDAPFHILALSGYADDILKSFKPSWCGIGEVGKAIRV 64

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG---GNAAILKASIDLL 117
           L  +    +V+AG +  RPN      +++   R +K++ +++S    G+ A+L   +   
Sbjct: 65  LKDHGCDAVVLAGNV-TRPNFA----TLRPDWRGAKLLPKILSAATQGDGAMLDVLVATF 119

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
            S G  VVGA ++   L V  G+LG   P+     D+  A     AL   DVGQ AV   
Sbjct: 120 ASEGFYVVGADDVATALTVPAGALGMLGPDTCDLSDMRKAAAVVAALGPFDVGQGAVVRQ 179

Query: 178 GRVVALEGIEGTDSMLQR----IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           G V+A+E  EGTD ML R    I   +      + + GVL+K  K +Q+ R DLP+IG +
Sbjct: 180 GFVIAIEAAEGTDLMLGRCAPLIARLQGEEGNRSERRGVLLKCPKPEQERRVDLPTIGVR 239

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           TV+   +AGLAGIA+EA   LVL+   V + AD  G+FV G
Sbjct: 240 TVELAAEAGLAGIAVEASGGLVLDSGAVARCADARGLFVYG 280


>gi|300023417|ref|YP_003756028.1| hypothetical protein Hden_1906 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525238|gb|ADJ23707.1| protein of unknown function DUF1009 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 425

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 135/276 (48%), Gaps = 8/276 (2%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAGSG LP  VA++   +     +  V          F    +         + L 
Sbjct: 7   RIGIIAGSGSLPREVAESVVARGGHVHVVMVSGAADASLAMFPHTVVNWAQPGRATAALK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              +  +V+ G   +RP+ +     I     +  ++  L +GG+ A+L+  + L E  G+
Sbjct: 67  AAGVRDVVMLGGF-QRPDFRSARPDIAFFQVLPSVLRFLKAGGDDAVLRGLVALFERRGL 125

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           ++VG  ++  +L V  G L     +     D         AL   D+GQ+AV   GRV A
Sbjct: 126 NIVGVRDVARDLTVAEGVLTGPPLSSQNSTDAEKGFALIAALGRYDIGQAAVIANGRVEA 185

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS---GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +EG EGTD ML+R+ + R      AG S   GVLVK  K  QD+R DLP+IG  T++N+ 
Sbjct: 186 IEGAEGTDRMLKRVAEARRA----AGNSKQGGVLVKRPKPGQDLRVDLPAIGPNTIENIA 241

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            AGLAG+A+ AG  L  E+E +   A   G+FV GI
Sbjct: 242 SAGLAGVAVMAGHVLAAERERMIALAGTRGVFVAGI 277


>gi|332703884|ref|ZP_08423972.1| protein of unknown function DUF1009 [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554033|gb|EGJ51077.1| protein of unknown function DUF1009 [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 280

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 142/283 (50%), Gaps = 32/283 (11%)

Query: 4   LLIIAGSGMLPYYVAKAAR-----------LKNDEPVIASVLNECSFDWQDFECRELPLG 52
           L +IAG G  P+ +A  AR             N +P + + ++E          +EL LG
Sbjct: 11  LGLIAGGGRFPFLIADGARKSGLRVVAVGFRSNTDPGLPACVDEY---------QELRLG 61

Query: 53  DFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKA 112
               L        + R+++ G I++          I    R ++++ +L   G+ A+L+ 
Sbjct: 62  QLGKLIDFFKSRGVDRVLMGGTINKA-----RAMDIIPDFRGARLLLKLGGKGDDALLRV 116

Query: 113 SIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQS 172
             D L S G+ V  AHE++PELL+  G L    P+ ++  DI      A+ L  LD+GQ+
Sbjct: 117 ISDELASEGMPVRRAHELIPELLMPEGFLAGRRPSTEIMADIRFGWSVAKELGRLDIGQT 176

Query: 173 AVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGA 232
            V     V A+E +EGTD+ ++R       G  LAG+  V+VK+ K  QD R DLPS+G 
Sbjct: 177 VVVRRQVVAAVEALEGTDNAIRR-------GCSLAGQGAVVVKVFKPGQDERLDLPSVGL 229

Query: 233 KTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            T++ +   G A +A+EAG+SL  ++E     A+ AGI V G+
Sbjct: 230 TTIETMRDVGAACLAVEAGRSLFFDREQALSAANRAGIAVVGV 272


>gi|78356422|ref|YP_387871.1| hypothetical protein Dde_1375 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218827|gb|ABB38176.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 288

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 137/278 (49%), Gaps = 26/278 (9%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--------LPLGDFCVL 57
           IIAGSG  P  VA+AARL+    V+      C F        E        L LG    L
Sbjct: 16  IIAGSGQFPMLVARAARLEGHRVVM------CGFQGHTDSALEHEADVWSMLHLGQLGRL 69

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
                   + R+  AGAI + P   DL    +  +R +K++++L S G+  +L+A +  L
Sbjct: 70  IDFFVSAGVTRLCFAGAISK-PRALDL----RPDMRAAKVLFRLRSKGDDVLLRAVLAEL 124

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           ES G+ +V A E+VP L    G L    P+ +  +DI      A  +  LD+GQ  V   
Sbjct: 125 ESEGLVIVQAAELVPGLRGPEGVLTRRQPSAEEWQDIRYGWPVAMQIGALDIGQCLVVRR 184

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G VVA+EG+EGTD+ L+R       G  L G   V +K  K  QD R DLP++G  TV+ 
Sbjct: 185 GMVVAVEGLEGTDATLRR-------GGELGGDGCVALKFVKPGQDERIDLPALGLATVRT 237

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + + G   +  +AG +L  ++E     AD+ GI + GI
Sbjct: 238 LAQGGYTCLCYQAGNTLFFDREESISLADKHGISIVGI 275


>gi|83858375|ref|ZP_00951897.1| hypothetical protein OA2633_02711 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853198|gb|EAP91050.1| hypothetical protein OA2633_02711 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 287

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 150/292 (51%), Gaps = 32/292 (10%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSI 60
           +RL +IAG G LP YVA+AA+  +    +A V+    F D   +        D  V+R I
Sbjct: 5   QRLGLIAGGGDLPVYVARAAQTGDR---LACVIALKGFADPTRY--------DSPVIRGI 53

Query: 61  ---------LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG---GNAA 108
                    L Q +   +  AG I  RP+      ++K  L+    + Q ++    G+ A
Sbjct: 54  AQLGQVVKDLRQADCDAVCFAG-IVTRPDFS----ALKPDLKGMAFLPQALAAAARGDDA 108

Query: 109 ILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELD 168
           +L+  +   E  G +V+GA++I  ELLV+ G +G+  P+   + D   A+  A      D
Sbjct: 109 LLRVIVGFFEKEGFTVIGANDIADELLVEPGLIGSIRPDAIAEADAKKALHVAGVTGAED 168

Query: 169 VGQSAVSIGGRVVALEGIEGTDSMLQRI--VDCRNNGRILAGKSGVLVKMCKSQQDMRAD 226
           +GQ AV   G V+A+E  EGTD ML R+  +     G  L  +SGVL K  K  Q+ R D
Sbjct: 169 IGQGAVVCKGLVLAVEAQEGTDQMLARVAGLPAELRGDEL-NRSGVLAKRPKPGQERRID 227

Query: 227 LPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LP IG  TVQ   +AGLAGI + AG ++VL +E V + AD AG+ V  ++ +
Sbjct: 228 LPVIGVSTVQGAARAGLAGIVIPAGGAMVLGREAVGQAADAAGLAVWAVEMD 279


>gi|126726878|ref|ZP_01742717.1| hypothetical protein RB2150_03159 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703836|gb|EBA02930.1| hypothetical protein RB2150_03159 [Rhodobacterales bacterium
           HTCC2150]
          Length = 263

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 149/273 (54%), Gaps = 24/273 (8%)

Query: 6   IIAGSGMLPYYVAKAA-----RLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           IIAGSG LP  ++        RLK    V  +  ++ +    +FE     LG+   L + 
Sbjct: 5   IIAGSGSLPEMLSAETAGVLVRLKG---VATTANSKNTIIEAEFE----RLGE---LFAA 54

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           LH   + ++V AGA+ +RP + D       +++++  I   ++ G+  +L+  + +    
Sbjct: 55  LHDEGVTKLVFAGAM-QRPAL-DPARLDSTTMQLAPRIMAALAKGDDGLLREVLAIFTEA 112

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRD-VKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           G  +V AH+++P+LLV  G +  C    D ++ D L  ++   ALS LDVGQ  V   G+
Sbjct: 113 GFEIVAAHDLLPDLLVMDGIM--CGAELDKLQNDALRGIEILAALSPLDVGQGCVVSNGQ 170

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
            + +E ++GTD +L+ +     N R+   K GVLVK  KS QD+R D+P+IG  T++ V 
Sbjct: 171 CIGIETLQGTDQLLKFV----QNTRVQLPKGGVLVKRTKSGQDLRIDMPTIGPATIKAVS 226

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
            AGL GI L+AG  +VL++    + AD+AGI +
Sbjct: 227 DAGLTGICLQAGHVMVLDRAQTIQLADDAGITI 259


>gi|225849912|ref|YP_002730146.1| hypothetical protein PERMA_0354 [Persephonella marina EX-H1]
 gi|225646124|gb|ACO04310.1| conserved hypothetical protein [Persephonella marina EX-H1]
          Length = 268

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 145/277 (52%), Gaps = 13/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRS 59
           M+++ +IAGSG LP   A++A  K     + ++      + + + +   L  G+   L  
Sbjct: 1   MRKVGLIAGSGELPLEFARSASEKGIHVTVLAIKKTTDRNIEKYGKTHWLNFGEAQKLID 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSI-KDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           +L +  I  +V+ G I+       L FS+ K   R  +   +L       IL+A +D L 
Sbjct: 61  LLKKEGIKDLVMLGKIEH----YSLIFSLHKLDKRAREFFSKLKDKRAKTILEAVMDELS 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G S +     +  LL++ G +   + ++ +  D L  +K A+ +++LD+GQ+ V   G
Sbjct: 117 KEGFSFIDPTPYLENLLIEEGLIAGRIEDKRLMNDALFGLKIAKEIAQLDIGQTVVVKDG 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+EGIEGTD        C   G  L G+  V+ K+ +  QDMR D+P IG KT++++
Sbjct: 177 IVIAVEGIEGTDK-------CIIRGGELGGEGTVVCKVARKNQDMRYDVPVIGTKTLKSM 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            KA    +A+EAGK+ +LE+E  KK A++ GI V G 
Sbjct: 230 KKAKARLLAVEAGKTFLLEREKFKKLAEKFGIAVIGF 266


>gi|67458570|ref|YP_246194.1| hypothetical protein RF_0178 [Rickettsia felis URRWXCal2]
 gi|67004103|gb|AAY61029.1| unknown [Rickettsia felis URRWXCal2]
          Length = 270

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 132/274 (48%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +  +  IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIASNYTKQGGKCYIAAIKDEADIEQIKDFEYKILKIGMIGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 +  I+  G ++R PN ++L       L + K++ Q + G +  +LK      ES
Sbjct: 62  YFKDNEVQNIIFIGGVNR-PNFKNLSVDKIGGLLLFKIVGQKIRGDDN-LLKIVAAFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQDNSNIITDITLTNSDKNDIELGVKLLNHLSSFDIAQSVIVENGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R          GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIARCADLRKKPY-----GGVLVKIPKLGQDNRLDMPTIGPDTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|84500831|ref|ZP_00999066.1| hypothetical protein OB2597_01812 [Oceanicola batsensis HTCC2597]
 gi|84390898|gb|EAQ03316.1| hypothetical protein OB2597_01812 [Oceanicola batsensis HTCC2597]
          Length = 268

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 142/275 (51%), Gaps = 15/275 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M R  IIAGSG LP  +A       +  VIA      + D  +       +     L   
Sbjct: 1   MPRTGIIAGSGGLPRLLADGL---PEARVIA--FEGTATDVPEHRLSRHRIERLGALFDD 55

Query: 61  LHQYNIGRIVVAGAIDRR---PNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
           L    + R+V+AGA+ R    P V D    ++D   ++  I Q + GG+ A+L+  + + 
Sbjct: 56  LRAAGVDRVVLAGAMSRPALDPAVLDPV--MRD---LAPRILQAMQGGDDALLRLVVGIF 110

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G +V+GAHE +P+L  + G L    P+   + DI  A     AL  +DVGQ  V  G
Sbjct: 111 EEQGFAVIGAHEALPDLTCEPGVLAGPGPSEATRADIARAEAILAALGPVDVGQGCVVSG 170

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G  + +E ++GTD+ML+ + +  +  R   G  G+L+K  K  QD+R D+P+IG +T + 
Sbjct: 171 GLCLGIETLQGTDAMLRFVAETPDGLRGRPG--GILLKRPKPGQDLRVDMPAIGPETARA 228

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
              AGL+GI + AG++L++++  +    D  G+F+
Sbjct: 229 AAAAGLSGIVVAAGRTLLIDRAALCAECDARGLFL 263


>gi|296115053|ref|ZP_06833695.1| hypothetical protein GXY_04714 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978390|gb|EFG85126.1| hypothetical protein GXY_04714 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 297

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 133/277 (48%), Gaps = 13/277 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD----WQDFECRELPLGDFCVLRSIL 61
           I+AG G LP  VA++         I         D    W     R    G+     S L
Sbjct: 23  ILAGGGPLPAQVARSVVAAGGSVFIIGFEGFADPDVIAPWPHRFIRLAAAGEIL---STL 79

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
             +    +V+ G + RRP+   L      + RI   I + +  G+  +L A + +L   G
Sbjct: 80  RLHGCRELVLIGPV-RRPSFATLRPDAVGA-RILARIGRALFSGDDGLLGAIVRVLGEEG 137

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             + GAHE +   + + G +G   P+     DI    +  +A+  LD+GQ  V   G V+
Sbjct: 138 FVIRGAHEYLHASIGRRGVMGMVRPDHVAMSDIGRGRRVVQAMGALDIGQGCVVQDGLVL 197

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E IEGTD ML+R+     +GR      GVL+KM K  Q+ RADLP+IG +TV+    A
Sbjct: 198 AVEAIEGTDEMLERVGRYHQDGR----PGGVLIKMVKPGQERRADLPTIGPETVRRAAGA 253

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GL GIA EAG +L+ +       AD AG+F+ GI  E
Sbjct: 254 GLRGIAFEAGATLLTDPLECVTRADAAGLFLVGITAE 290


>gi|326404914|ref|YP_004284996.1| hypothetical protein ACMV_27670 [Acidiphilium multivorum AIU301]
 gi|325051776|dbj|BAJ82114.1| hypothetical protein ACMV_27670 [Acidiphilium multivorum AIU301]
          Length = 287

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 120/208 (57%), Gaps = 7/208 (3%)

Query: 69  IVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAH 128
           IV+AG + RRP++ DL      + R+   I +    G+   L A + +L   G +V+GAH
Sbjct: 75  IVLAGPV-RRPSLFDLRPDAVGA-RLLARIGRAAFAGDDGFLAAIVRVLGEEGFTVLGAH 132

Query: 129 EIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEG 188
           E++ E+    G L    P+     DI   +    AL  +DVGQ AV   G V+A+E  EG
Sbjct: 133 EVISEVFAPEGLLSGAAPDAAALADIARGIAVVRALGAVDVGQGAVVQQGIVLAVEAAEG 192

Query: 189 TDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIAL 248
           TD+ML R    R  G       GVLVK+ K  Q+ RADLP++G +TV+  ++AGL GIA 
Sbjct: 193 TDAMLARAATLRRPG-----PGGVLVKLVKPGQERRADLPTLGVRTVRGAVEAGLRGIAF 247

Query: 249 EAGKSLVLEKELVKKHADEAGIFVCGID 276
           EA  ++++++E++ + A+ AG+F+ GID
Sbjct: 248 EAEGAILMDREVMVREAEAAGLFLLGID 275


>gi|144898245|emb|CAM75109.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 270

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 144/281 (51%), Gaps = 25/281 (8%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEP--VIA-------SVLNECSFDWQDFECRELPLGD 53
           +L IIAG G  P     A R +   P  V+A       +V+ +   DW       + LG+
Sbjct: 4   KLGIIAGGGAFPGLAIAACRSQG-RPFHVLALSGHADPAVIGDAPVDW-------IRLGE 55

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKAS 113
                  LH+  +  +V+ G + RRP +++L    + +   +K+   L + G+  +L+A 
Sbjct: 56  AGTGFKKLHEAGVIDLVMIGPV-RRPTLKELAPDWRTTKFFAKV--GLKALGDDGLLRAV 112

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
              +E  G  VVG  +++ + L   G  G+  P+     DI    + A+ +  LDVGQ+ 
Sbjct: 113 TREIEDEGFRVVGIDDVLADCLAPDGLFGSLAPDDQALADIDRGWEVAKGIGALDVGQAV 172

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           +   G ++A+E IEGTD +++R  + R +G        VLVK+ K  QD R DLP+IG  
Sbjct: 173 IVQQGIILAVEAIEGTDRLIRRSAELRRDG-----PGAVLVKVRKPGQDRRLDLPTIGLG 227

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           T++    AGL GI +EAG +LVL++  +   AD AG+F+ G
Sbjct: 228 TLREAAAAGLRGICVEAGGTLVLDRAELGAEADRAGLFILG 268


>gi|46580770|ref|YP_011578.1| hypothetical protein DVU2365 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450190|gb|AAS96838.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 274

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 137/285 (48%), Gaps = 32/285 (11%)

Query: 6   IIAGSGMLPYYVAKAARLK-----------NDEPVIASVLNECSFDWQDFECRELPLGDF 54
           IIAG G  P  VA+ AR             + +P +A   +  S          + LG F
Sbjct: 3   IIAGRGQFPALVAREARRAGLRVAICGFHGHTDPSLAEACDAFSL---------IHLGQF 53

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASI 114
             L    H     R+  AGAID+ P   DL    +  LR ++++++L   G+ A+L+A I
Sbjct: 54  GRLSEFFHGQGASRLCFAGAIDK-PRALDL----RPDLRAARVLFRLRGKGDDALLRAVI 108

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           + LES G  V+ A E+VP L    G L    P  +   DI      A  +  LD+GQ  V
Sbjct: 109 EELESDGFKVMQAAELVPGLRAPEGVLTRRQPGDEEWDDIRFGWPVARTMGRLDIGQCIV 168

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
              G V+A+EG EGTD+ L+R       G  L G   V +K+ K  QD R DLP++G  T
Sbjct: 169 VKRGIVMAVEGPEGTDAALRR-------GGELGGAGCVAIKLVKPGQDERIDLPALGTGT 221

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           +  + + G + +AL+A K+L  +++     A+  GI +  +  +F
Sbjct: 222 IGVLAEYGYSCLALQAHKTLFFDRDESLALAERHGIAIVALPEDF 266


>gi|83951894|ref|ZP_00960626.1| hypothetical protein ISM_15065 [Roseovarius nubinhibens ISM]
 gi|83836900|gb|EAP76197.1| hypothetical protein ISM_15065 [Roseovarius nubinhibens ISM]
          Length = 266

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 120/208 (57%), Gaps = 4/208 (1%)

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            + R+V AG + R       C +    L I+  I Q +  G+ A+L+  I + E  G +V
Sbjct: 58  GVTRMVFAGHLARPAINPAECDA--QMLSIAPRIMQALPKGDDALLREVIAIFEEQGFAV 115

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           VGAHE++PEL+V+ G      P++  + D+  A++    +S LD+GQ  V  GG+ + +E
Sbjct: 116 VGAHELLPELVVESGLALGPAPSKAEEADVARAIEILSHMSPLDIGQGCVVAGGQCLGIE 175

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            ++GTD+ML  +       R   G+ GV VK  K  QD+R D+P+IGA TV+ V KAGLA
Sbjct: 176 TVQGTDAMLGFVAGTPEALR--RGQKGVYVKAPKRGQDLRVDMPAIGANTVEAVAKAGLA 233

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFV 272
           G+ + A + ++++++   +  ++ G+F+
Sbjct: 234 GLVVAADQVMMIDRKTTLEALEKTGVFL 261


>gi|311234480|gb|ADP87334.1| protein of unknown function DUF1009 [Desulfovibrio vulgaris RCH1]
          Length = 278

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 137/285 (48%), Gaps = 32/285 (11%)

Query: 6   IIAGSGMLPYYVAKAARLK-----------NDEPVIASVLNECSFDWQDFECRELPLGDF 54
           IIAG G  P  VA+ AR             + +P +A   +  S          + LG F
Sbjct: 7   IIAGRGQFPALVAREARRAGLRVAICGFHGHTDPSLAEACDAFSL---------IHLGQF 57

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASI 114
             L    H     R+  AGAID+ P   DL    +  LR ++++++L   G+ A+L+A I
Sbjct: 58  GRLSEFFHGQGASRLCFAGAIDK-PRALDL----RPDLRAARVLFRLRGKGDDALLRAVI 112

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           + LES G  V+ A E+VP L    G L    P  +   DI      A  +  LD+GQ  V
Sbjct: 113 EELESDGFKVMQAAELVPGLRAPEGVLTRRQPGDEEWDDIRFGWPVARTMGRLDIGQCIV 172

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
              G V+A+EG EGTD+ L+R       G  L G   V +K+ K  QD R DLP++G  T
Sbjct: 173 VKRGIVMAVEGPEGTDAALRR-------GGELGGAGCVAIKLVKPGQDERIDLPALGTGT 225

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           +  + + G + +AL+A K+L  +++     A+  GI +  +  +F
Sbjct: 226 IGVLAEYGYSCLALQAHKTLFFDRDESLALAERHGIAIVALPEDF 270


>gi|148261434|ref|YP_001235561.1| hypothetical protein Acry_2449 [Acidiphilium cryptum JF-5]
 gi|146403115|gb|ABQ31642.1| protein of unknown function DUF1009 [Acidiphilium cryptum JF-5]
          Length = 287

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 119/208 (57%), Gaps = 7/208 (3%)

Query: 69  IVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAH 128
           IV+AG + RRP++ DL      + R+   I +    G+   L A + +L   G +V+GAH
Sbjct: 75  IVLAGPV-RRPSLFDLRPDAVGA-RLLARIGRAAFAGDDGFLAAIVRVLGEEGFTVLGAH 132

Query: 129 EIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEG 188
           E++ E+    G L    P+     DI   +    AL  +DVGQ AV   G V+A+E  EG
Sbjct: 133 EVISEVFAPEGLLSGAAPDAAALADIARGIAVVRALGAVDVGQGAVVQQGIVLAVEAAEG 192

Query: 189 TDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIAL 248
           TD+ML R    R  G       GVLVK+ K  Q+ RADLP++G +TV+  ++AGL GIA 
Sbjct: 193 TDAMLARAATLRRPG-----PGGVLVKLVKPGQERRADLPTLGVRTVRGAVEAGLRGIAF 247

Query: 249 EAGKSLVLEKELVKKHADEAGIFVCGID 276
           EA  ++++++E + + A+ AG+F+ GID
Sbjct: 248 EAEGAILMDREAMVREAEAAGLFLLGID 275


>gi|163741165|ref|ZP_02148557.1| hypothetical protein RG210_16935 [Phaeobacter gallaeciensis 2.10]
 gi|161385518|gb|EDQ09895.1| hypothetical protein RG210_16935 [Phaeobacter gallaeciensis 2.10]
          Length = 262

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 141/270 (52%), Gaps = 15/270 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVL-NECSFDWQDFECRELPLGDFCVLRSILH 62
           L +IAG G LP  +A  ARL +D P+I ++  +E      +   R   LG F    + L 
Sbjct: 2   LALIAGQGALPAELA--ARL-SDRPLICAMRGSEPDHIEAELTFRLEQLGSFI---ARLA 55

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              +  I +AGA+ RRP ++       ++L +  ++   ++ G+   L+A I + E  G+
Sbjct: 56  ASGVTEICLAGAV-RRPAIEPAEID-AETLPLVPVLQGALAAGDDGALRAIIGIFEQAGM 113

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V  AHE+ P+LL+  G      P    K D     +  EA+S  DVGQS     G+ +A
Sbjct: 114 NVRAAHEVAPDLLMAEGIPTEVKPGELDKPDAERGAEVVEAMSRADVGQSCAVRRGQAIA 173

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E + GTD ML  +   R +G       G+L K  K  QD RADLP+IG +TV+   KAG
Sbjct: 174 VENLFGTDWMLNAL-QSRPDG-----TGGLLFKAPKPGQDRRADLPTIGVQTVELAAKAG 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           LAGI LEAG  +VL +E V    +  G+F+
Sbjct: 228 LAGIVLEAGGVIVLNQEDVVATCNRLGLFL 257


>gi|206602499|gb|EDZ38980.1| Conserved protein of unknown function [Leptospirillum sp. Group II
           '5-way CG']
          Length = 296

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 136/272 (50%), Gaps = 14/272 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQ 63
           ++AG+G+ P     +AR K  E ++ +   E     + F    R + +G    +    H+
Sbjct: 34  LVAGNGLFPNLFLDSARKKGYEVIVVAHRGETDPSVESFGVPVRWIRVGQLDPIFKTFHE 93

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           + +     AG I ++P +    F ++   R  +++ ++    +  +L+A  D  E   + 
Sbjct: 94  HGVKAAAFAGGI-KKPRL----FDLRPDWRGVRILARVAVNHDDQVLRALADEFEQESIR 148

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +V +  ++PEL    G LG   P    + DI   +++ + L +LDVGQ  V     ++AL
Sbjct: 149 IVPSTWLLPELTTPEGVLGVHHPTEAEREDIRIGLEAGKVLGKLDVGQCVVVKEKVILAL 208

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD  ++R       G        V+VKM K  QD+R DLPS+G KT++ + + G 
Sbjct: 209 EAIEGTDETIRR-------GARFTSPGIVVVKMAKPGQDLRFDLPSVGMKTLELMAEVGG 261

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             +ALEAGKSL+L+     + AD  GI V G+
Sbjct: 262 RVLALEAGKSLILDTGHFLETADRYGICVLGV 293


>gi|157826197|ref|YP_001493917.1| hypothetical protein A1C_05870 [Rickettsia akari str. Hartford]
 gi|157800155|gb|ABV75409.1| hypothetical protein A1C_05870 [Rickettsia akari str. Hartford]
          Length = 270

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 131/274 (47%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +  +  IA++ +E   D  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGKCYIAAIKDEADIDPIKDFEYKILKIGMVGEAIR 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 +  I+  G ++R PN ++L       L + K++ Q + G +  +LK   D  ES
Sbjct: 62  YFKDNEVQNIIFIGGVNR-PNFKNLSVDKIGGLLLFKIVGQKIRGDDN-LLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++ I          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNAIYKNQQGNSNIITDTNSTSADKNDIEVGVKLLNHLSSFDIAQSVIVENGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R    R          GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIARCAALRKKEH-----EGVLVKIPKLGQDNRLDMPTIGPDTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|120601945|ref|YP_966345.1| hypothetical protein Dvul_0897 [Desulfovibrio vulgaris DP4]
 gi|120562174|gb|ABM27918.1| protein of unknown function DUF1009 [Desulfovibrio vulgaris DP4]
          Length = 278

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 137/285 (48%), Gaps = 32/285 (11%)

Query: 6   IIAGSGMLPYYVAKAARLK-----------NDEPVIASVLNECSFDWQDFECRELPLGDF 54
           IIAG G  P  VA+ AR             + +P +A   +  S          + LG F
Sbjct: 7   IIAGRGQFPALVAREARRAGLRVAICGFHGHTDPSLAEACDAFSL---------IHLGQF 57

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASI 114
             L    H     R+  AGAID+ P   DL    +  LR ++++++L   G+ A+L+A I
Sbjct: 58  GRLSEFFHGQGASRLCFAGAIDK-PRALDL----RPDLRAARVLFRLRGKGDDALLRAVI 112

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           + LES G  V+ A E+VP L    G L    P  +   DI      A  +  LD+GQ  V
Sbjct: 113 EELESDGFKVMQAAELVPGLRAPEGVLTRRQPGDEEWDDIRFGWPVARTVGRLDIGQCIV 172

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
              G V+A+EG EGTD+ L+R       G  L G   V +K+ K  QD R DLP++G  T
Sbjct: 173 VKRGIVMAVEGPEGTDAALRR-------GGELGGAGCVAIKLVKPGQDERIDLPALGTGT 225

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           +  + + G + +AL+A K+L  +++     A+  GI +  +  +F
Sbjct: 226 IGVLAEYGYSCLALQAHKTLFFDRDESLALAERHGIAIVALPEDF 270


>gi|163736306|ref|ZP_02143725.1| hypothetical protein RGBS107_14281 [Phaeobacter gallaeciensis
           BS107]
 gi|161390176|gb|EDQ14526.1| hypothetical protein RGBS107_14281 [Phaeobacter gallaeciensis
           BS107]
          Length = 262

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 95/270 (35%), Positives = 141/270 (52%), Gaps = 15/270 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVL-NECSFDWQDFECRELPLGDFCVLRSILH 62
           L +IAG G LP  +A  ARL +D P+I ++  +E      +   R   LG F    + L 
Sbjct: 2   LALIAGQGALPAELA--ARL-SDRPLICAMRGSEPDHIEAELTFRLEQLGSFI---ARLA 55

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              +  I +AGA+ RRP ++       ++L +  ++   ++ G+   L+A I + E  G+
Sbjct: 56  ASGVTEICLAGAV-RRPAIEPGEID-AETLPLVPVLQGALAAGDDGALRAIIGIFEQAGM 113

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V  AHE+ P+LL+  G      P    K D     +  EA+S  DVGQS     G+ +A
Sbjct: 114 NVRAAHEVAPDLLMAEGIPTEVKPGELDKPDAERGAEVVEAMSRADVGQSCAVRRGQAIA 173

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E + GTD ML  +   R +G       G+L K  K  QD RADLP+IG +TV+   KAG
Sbjct: 174 VENLFGTDWMLNAL-QSRPDG-----TGGLLFKAPKPGQDRRADLPTIGVQTVELAAKAG 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           LAGI LEAG  +VL +E V    +  G+F+
Sbjct: 228 LAGIVLEAGGVIVLNQEDVVATCNRLGLFL 257


>gi|119386615|ref|YP_917670.1| hypothetical protein Pden_3908 [Paracoccus denitrificans PD1222]
 gi|119377210|gb|ABL71974.1| protein of unknown function DUF1009 [Paracoccus denitrificans
           PD1222]
          Length = 265

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 135/272 (49%), Gaps = 11/272 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M R+ +IAG G L   +A A     D+P++ ++ N         E +   L         
Sbjct: 1   MSRIALIAGEGSLAPAIAAAL----DQPLVYALDNLKP----QVEAKPFRLERLVPFLDE 52

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    + + V AGAI RRP ++   F  +    + +++  + SG +AA L+A +D+ E  
Sbjct: 53  LADQGVTQAVFAGAI-RRPKIEPELFDARTLTIVPRILMGMQSGDDAA-LRAVLDVFEEA 110

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+S+    +I+PEL+   G L      RD ++D   A +    L  LD+GQ AV   G  
Sbjct: 111 GISICSVDQILPELVPGEGVLSGEPSQRD-QKDAARAAEIVAGLGALDIGQGAVVAQGLC 169

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E + GT +ML+             G  GVL K  K  QD R DLP+IG  TV    +
Sbjct: 170 LAVEALPGTQAMLEFAKLHAGLKPDPKGAGGVLYKAPKPGQDRRIDLPTIGPDTVTQAAE 229

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           AGLAGIA EAG  ++L++    + A  AG+F+
Sbjct: 230 AGLAGIAWEAGSVILLDRAEALRRAQAAGLFL 261


>gi|124514699|gb|EAY56211.1| conserved protein of unknown function [Leptospirillum rubarum]
          Length = 296

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 136/272 (50%), Gaps = 14/272 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQ 63
           ++AG+G+ P     +AR K  E ++ +   E     + F    R + +G    +    H+
Sbjct: 34  LVAGNGLFPNLFLDSARKKGYEVIVVAHRGETDPSVESFGAPVRWIRVGQLEPIFKTFHE 93

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           + +     AG I ++P +    F ++   R  +++ ++    +  +L+A  D  E   + 
Sbjct: 94  HGVKAAAFAGGI-KKPRL----FDLRPDWRGVRILARVAVNHDDQVLRALADEFEQESIR 148

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +V +  ++PEL    G LG   P    + DI   +++ + L  LDVGQ  V     ++AL
Sbjct: 149 IVPSTWLLPELTTPEGVLGVHHPTDAEREDIRIGLEAGKVLGTLDVGQCVVVKEKVILAL 208

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD  ++R       G   +    V+VKM K  QD+R DLPS+G KT++ + + G 
Sbjct: 209 EAIEGTDETIRR-------GARFSSPGIVVVKMAKPGQDLRFDLPSVGMKTLELMAEVGG 261

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             +ALEAGKSL+L+     + AD  GI V G+
Sbjct: 262 RVLALEAGKSLILDTGHFLETADRYGICVLGV 293


>gi|260889716|ref|ZP_05900979.1| putative septum site-determining protein MinC [Leptotrichia
           hofstadii F0254]
 gi|260860322|gb|EEX74822.1| putative septum site-determining protein MinC [Leptotrichia
           hofstadii F0254]
          Length = 267

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 147/277 (53%), Gaps = 14/277 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR-ELPLGDFCVLRS 59
           M+++ +IAG+G LP        LK  EP    +        ++ +   +  +     + S
Sbjct: 1   MEKVGLIAGNGKLPELFLNQCILKGIEPFSVYLFESVEESVKEHKNSVKYSVAQVGKIIS 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFS-IKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
              +  I  +++ G +++     +L FS +K  L  +K++    +  +  ILKA ID +E
Sbjct: 61  HFKKNGITHLIMLGKVEK-----NLIFSNLKFDLTATKILLSTKNKKDKNILKAIIDYIE 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           S  + V+  + ++ E +    +    +P+++ ++ I   +++A  L+++D GQ+ V    
Sbjct: 116 SENIEVLPQNYLMDEYIAGNETYTKVLPSKNEEKTIEIGIEAARMLTDIDAGQTVVVKDE 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALEG+EGTD  + R       G  LAGK+ ++VKM +  QD R D+P+IG +T++ V
Sbjct: 176 SVIALEGVEGTDKAILR-------GGELAGKNCIVVKMARRNQDYRIDIPTIGLETIKKV 228

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           ++    GI +EA K L ++KE V K A++  IF+ GI
Sbjct: 229 VEINGRGIVIEADKMLFIDKEEVIKFANKNKIFIKGI 265


>gi|94269143|ref|ZP_01291381.1| Protein of unknown function DUF1009 [delta proteobacterium MLMS-1]
 gi|93451329|gb|EAT02203.1| Protein of unknown function DUF1009 [delta proteobacterium MLMS-1]
          Length = 280

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 141/279 (50%), Gaps = 15/279 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLR 58
           M +L IIAG G  P  VA+AAR    E  + +   E     +     C  + LG    + 
Sbjct: 5   MSKLGIIAGGGQFPLLVAQAARRHGREVAVVAHRGESVPELEQAAASCLWIKLGQLGKMV 64

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIW-QLVSGGNAAILKASIDLL 117
           + L +  + + + AG I +    +D+    K     +  +W ++ S  + AIL+A  DLL
Sbjct: 65  NFLRRQGVQQCLFAGTITKTRIFRDVWPDFK-----ALQLWGRIDSRQDDAILRAIADLL 119

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
            + G+ VV +   + ELL   G L    PN + + DI    + A  + ELD+GQ  V   
Sbjct: 120 AAEGIEVVASTLYLEELLFPKGVLSRKKPNAEQRADIDFGWQMARRIGELDIGQCVVVRQ 179

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+A+E IEGTD+ ++R       G  L  +  V+VK+ K  QD R DLP+IG +T+  
Sbjct: 180 RAVLAVEAIEGTDAAIRR-------GGELGREQAVVVKVRKPNQDFRFDLPAIGRQTIAT 232

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           + +A  A +A+EA ++L+ +       AD+AG+ V G++
Sbjct: 233 MQEARAAVLAVEARQALLFDPRETLAAADQAGLVVVGVE 271


>gi|209964507|ref|YP_002297422.1| hypothetical protein RC1_1195 [Rhodospirillum centenum SW]
 gi|209957973|gb|ACI98609.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 278

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 147/275 (53%), Gaps = 10/275 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRS 59
            RL I+AG G LP  +A+       + V+ ++  +   D            +G    +  
Sbjct: 3   PRLAILAGGGDLPGRLAETCHSAGRDVVLVALEGQAEPDRLPSGLPTAWFRMGAVGAILD 62

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    +G I +AG + RRP++ +L    K +  ++++    ++ G+  +L+A   +LE+
Sbjct: 63  HLRTAGVGDIALAGRV-RRPSLGELRPDWKAAQILARV--GALALGDDGLLRAVACVLEA 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  VVG  +++ +LL+  G +G      + + DI   +  A AL  LDVGQ+ V   G 
Sbjct: 120 EGFRVVGVPDLMADLLMPEGPVGGLDAPAECRDDIGRGVAVARALGRLDVGQAVVVQQGI 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E IEGTD+++ R  D +  GR       VLVK+ K QQD R DLP+IG +TV    
Sbjct: 180 VLGVEAIEGTDALIDRCGDLKREGR-----GPVLVKVRKPQQDRRLDLPTIGTETVARAA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           +AG AGIA EAG +++L ++ V + AD AG+FV G
Sbjct: 235 RAGFAGIAAEAGSAILLGRDQVARAADAAGLFVVG 269


>gi|116751168|ref|YP_847855.1| hypothetical protein Sfum_3750 [Syntrophobacter fumaroxidans MPOB]
 gi|116700232|gb|ABK19420.1| protein of unknown function DUF1009 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 649

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 135/271 (49%), Gaps = 13/271 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           +R+ +IAGSG  P   A AAR    E V      E       +  E   L LG    + +
Sbjct: 14  ERIGLIAGSGQFPLLFAHAARQAGVEVVALGFQGETDPALSKYVNEFHMLKLGQLSRMIN 73

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  I R  +AGAI    N   L   I+   R  K +  L +  + ++L+A  D LES
Sbjct: 74  AFRRAGITRAAMAGAI----NKTKLYTRIRPDWRAVKFLNSLRNKKDDSLLRAFADELES 129

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ +  +   +P LL   G L    PN   + DI+   K A+ +  LD+GQ  V     
Sbjct: 130 EGIKIEPSTMFLPSLLAPEGILTRRKPNHREQVDIVFGWKMAKVIGGLDIGQCLVVKNQA 189

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGI+GTDS + R       GR L  +  ++VK+ K  QD+R D+P++G  T++ + 
Sbjct: 190 VLAVEGIDGTDSTILR------GGR-LCREGAIIVKVSKPIQDLRFDVPAVGYDTIETMK 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
           +     +A+EAGK+L+ ++E +   AD AGI
Sbjct: 243 RVKARVLAVEAGKTLMFDREKMIDAADAAGI 273


>gi|257463719|ref|ZP_05628108.1| hypothetical protein FuD12_07695 [Fusobacterium sp. D12]
 gi|317061263|ref|ZP_07925748.1| conserved hypothetical protein [Fusobacterium sp. D12]
 gi|313686939|gb|EFS23774.1| conserved hypothetical protein [Fusobacterium sp. D12]
          Length = 267

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 141/275 (51%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ II G+G  P Y  K A+ +  +     + +    + ++ +  +   +G    +  
Sbjct: 1   MEKIGIIVGNGKFPLYFMKEAKKRGYDLYPVGLFDSIEKEIKEMKHFQSFHIGHLGEIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
               Y + ++++ G +++    Q+L         I KM   L    +  +L A I  L+ 
Sbjct: 61  YFSFYGVKKLILLGKVEKSILFQNLDLDYYGQ-EILKM---LPDRKDETLLFAIISFLKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   +V+       +P ++  R I   M++A+ L+ LD+GQ+ +     
Sbjct: 117 NGIRVLSQNYLLSSYMVEEKCYTEEMPKKEDDRSIQLGMEAAKMLTSLDIGQTVIVKEEA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEG+EGTD  + R  +       LAGK+ +++KM + +QDMR D+P++G +T++  I
Sbjct: 177 VVALEGMEGTDRAILRAGE-------LAGKNCIIIKMARPKQDMRVDIPTVGVETIRRAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + G  GI +EA K   LE+E     A++ GIF+ G
Sbjct: 230 EIGAKGIVMEANKMFFLEREEAISLANKHGIFLIG 264


>gi|312142805|ref|YP_003994251.1| protein of unknown function DUF1009 [Halanaerobium sp.
           'sapolanicus']
 gi|311903456|gb|ADQ13897.1| protein of unknown function DUF1009 [Halanaerobium sp.
           'sapolanicus']
          Length = 276

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 145/276 (52%), Gaps = 14/276 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--LPLGDFCVLR 58
           M +  ++AG G +P   A+ A  + ++ ++  +  E +  + D +C+E  + L DF +L 
Sbjct: 1   MAKTALLAGWGDMPRLWAERAEARGEDFIVIKIAEEITAQFSDLDCKEQTVNLADFNLLL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +L +  I R+++ G I +    +D     +  L++  ++  L +  +  ILKA +D   
Sbjct: 61  ELLKKEGISRLILLGKIHKEKLFKDF----EADLKLKMLLASLPNFNDDTILKALVDQFI 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V+  H ++ ++L + G L    P+  +K+++    K+A  L   D+GQ+A+   G
Sbjct: 117 ELGIDVLAQHYLLEDILAKRGILAGD-PSAKLKKELAYGFKTAYNLGRFDIGQTALVKDG 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE +EGTD  ++R            G   V+ K  K +QD R D+P++G  T++ +
Sbjct: 176 AVMALEAVEGTDEAIKRAAK-------FGGPGFVMAKCSKKEQDFRFDIPTVGLNTLELL 228

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           ++   AG+ +EA K+ +L++    + A++ G+ V  
Sbjct: 229 LEHQAAGLVIEAEKTFMLDQAEFCRRAEKEGLVVAA 264


>gi|310778908|ref|YP_003967241.1| protein of unknown function DUF1009 [Ilyobacter polytropus DSM
           2926]
 gi|309748231|gb|ADO82893.1| protein of unknown function DUF1009 [Ilyobacter polytropus DSM
           2926]
          Length = 267

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 139/276 (50%), Gaps = 12/276 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ II G+G LP Y  K A  K  E     + +    + +  E  R + +G    +  
Sbjct: 1   MEKIGIIVGNGKLPLYFLKEAGAKGYEVFPIGLFDTIEEEIKQHENFRMMNVGRIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   NI ++V+ G +++     ++ F         K++ +L    +  +L   I LL+ 
Sbjct: 61  HLLGNNIVKLVMLGKVEKSILFNEIEFDDHGK----KLLKKLPDNKDETLLFGIISLLKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   + +        P ++    I    ++A+ALSELD GQ+ V     
Sbjct: 117 CGIKVLPQNHLLGNFMFENKVYTNSSPEKNDSLTIKMGTEAAKALSELDAGQTVVCKDSS 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEGIEGTD   Q I+   N     AG + +++KM + QQDMR D+P++G  T++  I
Sbjct: 177 VVALEGIEGTD---QTILRAGN----YAGDNCIIIKMARPQQDMRVDIPAVGLDTIKRAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +    GI  EAGK L L++E   K ADE  +F+ GI
Sbjct: 230 EIKAKGIVGEAGKMLFLDQEEAIKLADENKLFIMGI 265


>gi|315499842|ref|YP_004088645.1| hypothetical protein Astex_2856 [Asticcacaulis excentricus CB 48]
 gi|315417854|gb|ADU14494.1| protein of unknown function DUF1009 [Asticcacaulis excentricus CB
           48]
          Length = 281

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 139/279 (49%), Gaps = 11/279 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M +L +IAG G++P  +A+  +       +  +      +       ++ +G F  +   
Sbjct: 1   MDKLGLIAGGGLVPVEIARYLKRSGRPYCVIRLEGLADAELAAHPGHDIDVGHFQKIFVA 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L Q     + + G + +RP+   +      +  +   I     GG+ ++L+    + ES 
Sbjct: 61  LAQEGCRAVCMVGYV-KRPDFDAMQRDEGGAAHLPG-IQAAGRGGDDSLLRQVARVFESQ 118

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G ++ GAH+  PEL ++ G      P+ + + D+  A + A AL  LD+GQ+AV  G   
Sbjct: 119 GYAIEGAHDANPELCLEEGLQAGEAPSPEAREDMEEAFRVAHALGALDIGQAAVVAGRIT 178

Query: 181 VALEGIEGTDSMLQRIVDCR-----NNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV 235
           +A+E  EGTD++L+R+           GR    + GVL K+ K  QD+R D+P+IG +TV
Sbjct: 179 LAVEAQEGTDALLKRVATLSPVLIGTQGR----RKGVLAKVPKPIQDLRLDMPTIGVQTV 234

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           +    AGL GI  +AG  LV++K  V   A E G+F+ G
Sbjct: 235 EAAAAAGLCGIVGQAGALLVVDKARVYARAAELGLFIYG 273


>gi|218888086|ref|YP_002437407.1| hypothetical protein DvMF_3002 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759040|gb|ACL09939.1| protein of unknown function DUF1009 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 281

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 139/282 (49%), Gaps = 26/282 (9%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--------LPLGDFCVL 57
           IIAG G  P  VA+ AR +    V+      C F     E  E        L LG    L
Sbjct: 8   IIAGKGQFPALVARGARAEGLSVVM------CGFHGHTDEALEHEADAFAMLHLGQLGKL 61

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
                  N+ R+ +AGAI + P   DL    +  LR +K++++L + G+ AIL+A ID L
Sbjct: 62  IDFFRDNNVRRLCLAGAISK-PRALDL----RPDLRAAKVLFRLRAKGDDAILRAVIDEL 116

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           ES G++VV    +VP L    G L    P+ +   DI      A  L  LD+GQ  V   
Sbjct: 117 ESEGLAVVQPASLVPGLRAPEGVLTRRPPSDEEWADIRYGWPIAHVLGRLDIGQCIVVKR 176

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G  VA+EG+EGTD+ L+R          L G+  V VK+ K  QD R DLP++GA T++ 
Sbjct: 177 GMTVAVEGMEGTDATLRRGG-------ELGGEGCVAVKVVKPGQDDRIDLPALGAGTIRV 229

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           +   G   +ALEAGK+L  ++E     AD+  I +  +   F
Sbjct: 230 LADYGYTCLALEAGKTLFFDREESIALADKHDISIISMPEGF 271


>gi|313672271|ref|YP_004050382.1| hypothetical protein Calni_0306 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939027|gb|ADR18219.1| protein of unknown function DUF1009 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 270

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 138/273 (50%), Gaps = 31/273 (11%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           +IAG G LP       + + D+ V+ S+  E + D             F  +   LHQ++
Sbjct: 5   LIAGYGRLPLIAYNKLKERYDKVVVVSLAEEVTVD-------------FSSVAENLHQFS 51

Query: 66  IGRIVVAGAIDRRPNVQDLCF-----------SIKDSLRISKMIWQLVSGGNAAILKASI 114
           +G++       +   VQD+ F           ++K      K++W L +  +  I+   +
Sbjct: 52  VGQVGKIIKTLKSEGVQDILFAGKVNKTLLYKNLKLDFTAIKLLWALENRNDDTIMLKIV 111

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           + L+ +G+ V+   +I+ +L +  G +    PN+ +  D+    K A+ L  +DVGQ+ V
Sbjct: 112 EELQKHGIGVLKQSDILRDLFLPEGVISKKKPNKAIMDDVAFGYKVAKVLGSVDVGQTVV 171

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
                V+ALE IEGTD+ ++R   CR     LA +  V+VK+ K +QD R D+P++G  T
Sbjct: 172 VKNKAVMALEAIEGTDATIER--GCR-----LAKEGAVVVKVAKPKQDERFDIPTVGIDT 224

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADE 267
           ++ ++      +A+EAG ++V++ + VKK  DE
Sbjct: 225 LKKILDNKGVCLAIEAGTTIVVDIDEVKKFCDE 257


>gi|237755581|ref|ZP_04584197.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692244|gb|EEP61236.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 267

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 138/272 (50%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRSILHQY 64
           +IAGSG LP   AK+A   N++  I ++ +    + + + +       +   +   L + 
Sbjct: 5   LIAGSGELPKAFAKSAYQNNEDLTIIAIKSSADKELERYGKTHWFSFTEAQKIIDFLKKE 64

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSI-KDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           N+  +V+ G I+       + F   K   R    + +L      +IL + I  LES G  
Sbjct: 65  NVQNLVMLGKIEH----SSILFHFHKLDHRAKTFLSKLKDKRAKSILHSIIQELESEGFK 120

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
            +     + ELL+  G L   V + +V +D+   +K A+ +++LD+GQ+ V   G V+A+
Sbjct: 121 FIDPTPYLKELLIPEGFLINPVDDAEVLKDVEFGIKIAKEIADLDIGQTVVVKNGVVIAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG+EGTD  + R       G    G++ V+ K  +S QDMR D+P IG+KT++ + KA  
Sbjct: 181 EGVEGTDKCILR-------GGEFGGENTVVCKTARSNQDMRYDVPVIGSKTLEIMKKAKA 233

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             +A+EA K+ +LEKE     A E GI V  +
Sbjct: 234 KVLAIEANKTFLLEKEKFINRAKEYGITVMSV 265


>gi|146278178|ref|YP_001168337.1| hypothetical protein Rsph17025_2142 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556419|gb|ABP71032.1| protein of unknown function DUF1009 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 273

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 145/269 (53%), Gaps = 10/269 (3%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILHQY 64
           IIAG+G LP ++A A R   + P++A++        + D   R   L  F  LR  L   
Sbjct: 8   IIAGAGALPRHLAWALRAAGEVPLVAALEGFAPEGLEADITFRVERLVPF--LRE-LETA 64

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            + R+V AGA+ RRP +    F    +  + ++I  + +G +A  L+A I + E  G +V
Sbjct: 65  GVSRLVFAGAV-RRPRLDPSLFDPLTAQMVPRLIGAMQAGDDA-TLRAVIAIFEEEGFAV 122

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           VG  +I P+L+ +  +L       DV RD+  A    EA+  +DVGQ AV   G  +A+E
Sbjct: 123 VGVSDIAPDLVPEAATLCGAPREGDV-RDVARAAAIVEAIGRVDVGQGAVVAQGLCLAVE 181

Query: 185 GIEGTDSMLQRIVDCRNNGRI-LAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
            + GTD+ML  +      GR   AG  GVL K  K  QD R DLP++G  TV     AGL
Sbjct: 182 ALPGTDAMLDWV--AATAGRPDPAGARGVLYKAPKPGQDRRIDLPTLGPATVARAAAAGL 239

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
           AGIA EAG  ++L++E   + A+EAG+F+
Sbjct: 240 AGIAWEAGGVILLDREATVRAAEEAGLFL 268


>gi|149915225|ref|ZP_01903753.1| hypothetical protein RAZWK3B_15348 [Roseobacter sp. AzwK-3b]
 gi|149810946|gb|EDM70785.1| hypothetical protein RAZWK3B_15348 [Roseobacter sp. AzwK-3b]
          Length = 268

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 122/216 (56%), Gaps = 12/216 (5%)

Query: 61  LHQYNIGRIVVAGAIDRRP-NVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           L    + R+V AG++ R P N  +    +   L ++  +   + GG+ A+L+  I + E 
Sbjct: 56  LRAQGVDRVVFAGSLSRPPLNPAEFDPVM---LGLAPRLMVAMQGGDDALLREVIAIFEE 112

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAE---ALSELDVGQSAVSI 176
            G +V+GAHE+VP L  + G    CV     + D+  A ++ +   ALS LDVGQ  V  
Sbjct: 113 QGFAVMGAHELVPGLTAEEG---LCVGAEMSETDLTDAGRAWDILMALSPLDVGQGCVVA 169

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           GG+ + +E ++GTD++L  +       R   G  GV VK  K  QD+R D+P IG KT++
Sbjct: 170 GGQCLGIETVQGTDALLGFVAATPEALR--RGVRGVYVKAAKRGQDLRVDMPVIGPKTIE 227

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
            V +AGLAG+ +EA + ++LE+E   +  ++AG+F+
Sbjct: 228 AVAEAGLAGLVVEASRVMILEREKTVQAVEKAGLFL 263


>gi|15604565|ref|NP_221083.1| hypothetical protein RP730 [Rickettsia prowazekii str. Madrid E]
 gi|3861260|emb|CAA15159.1| unknown [Rickettsia prowazekii]
 gi|292572372|gb|ADE30287.1| hypothetical protein rpr22_CDS711 [Rickettsia prowazekii Rp22]
          Length = 270

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L +IAG G LP+ +A     +  +  IA++ +E + +  ++FE +   +G       
Sbjct: 2   LPNLGMIAGRGSLPHLIACNYIKQGGKCYIAAIKDETNIEQIKEFEYKIFKIGMVGEAIR 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
               +N+  I+  G I+R PN ++L       L + K++ Q + G ++ +LK   +  ES
Sbjct: 62  YFQDHNVENIIFIGGINR-PNFKNLAVDKIGRLLLFKIVEQKIRGDDS-LLKIVANFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ +++I          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNQIYQNQQCNSNIITNTTITNSDKNDIELGIKVLNHLSLFDIAQSVIVKNGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R          G+LVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIVRCADLRKKSH-----GGILVKIPKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A++  IF+ 
Sbjct: 235 KYNYQGLAIQKNNVIIVEEELTIKLANKHKIFIT 268


>gi|257468114|ref|ZP_05632210.1| hypothetical protein FulcA4_02182 [Fusobacterium ulcerans ATCC
           49185]
 gi|317062399|ref|ZP_07926884.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313688075|gb|EFS24910.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 267

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 86/286 (30%), Positives = 149/286 (52%), Gaps = 32/286 (11%)

Query: 1   MKRLLIIAGSGMLP-YYVAKAARLK-NDEPV-----IASVLNECSFDWQDFECRELPLGD 53
           M +L II G+G LP Y++ +A + K N  P+     I   +  CS +++ F   E+    
Sbjct: 1   MDKLGIIVGNGKLPLYFLQEAEKQKINVFPIGLFETIEPEIKSCS-NFKAFNIGEVG--- 56

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISK----MIWQLVSGGNAAI 109
             +++  L   +I  I++ G +++     ++ F     +++ K    ++ +L    +  +
Sbjct: 57  -AIVKHFLLN-DIREIIMLGKVEK-----EIIFK---EMKLDKYGEELLKRLPDKKDETL 106

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           L A I      G+ V+  + ++   + Q        P+ +  + I   M++A+ALSE+D 
Sbjct: 107 LFAIIAFFRLNGIKVLPQNYLLKNFMFQENCYTQLKPSEEDMKTIKIGMEAAKALSEVDA 166

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           GQ+ V     VVALEGIEGTD  ++R  +       LAG   ++VKM + QQDMR D+P+
Sbjct: 167 GQTVVCKDSSVVALEGIEGTDKTIKRAGE-------LAGTGTIIVKMSRPQQDMRVDIPA 219

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +G +T++  I+ G  GI  EAGK L L ++   K A+E  +F+ GI
Sbjct: 220 VGIETIKRAIEIGAKGIVGEAGKMLFLNRDEAVKLAEENSLFIMGI 265


>gi|323698041|ref|ZP_08109953.1| protein of unknown function DUF1009 [Desulfovibrio sp. ND132]
 gi|323457973|gb|EGB13838.1| protein of unknown function DUF1009 [Desulfovibrio desulfuricans
           ND132]
          Length = 279

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 131/272 (48%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSILHQ 63
           +IAG    P  VA+  + +    V+A      + D        REL LG    L S L +
Sbjct: 10  LIAGGKQFPVLVARGVKARGHRLVVAGFTGHTNMDVVPLADVFRELKLGKLNQLISFLKE 69

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + ++++AG I++ P V D+       +R  K+I      G++A+L       E  G+ 
Sbjct: 70  EKVDKVIMAGTIEK-PKVMDIRHL---DMRAIKLILGRKDKGDSALLGIIGREFEKEGMP 125

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV AHE +P+LL   G +    P+     D+  A   A+ L  +DVGQ  V   G V A+
Sbjct: 126 VVPAHEYLPDLLSPEGVMTRREPDAREWGDLRFAWDIAKELGRMDVGQCVVVREGIVAAV 185

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E +EGTD  L+R       G    G   V+VK+ K  Q    DLPS+G  T++ + +   
Sbjct: 186 EALEGTDETLRR-------GFRYGGPECVVVKVFKPGQQQEVDLPSLGLDTLKLMAEGKA 238

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             + +EAGKSL  ++E   + AD AGI V G+
Sbjct: 239 TCLGVEAGKSLFFDREAAIEFADRAGIAVVGL 270


>gi|256831136|ref|YP_003159864.1| hypothetical protein Dbac_3376 [Desulfomicrobium baculatum DSM
           4028]
 gi|256580312|gb|ACU91448.1| protein of unknown function DUF1009 [Desulfomicrobium baculatum DSM
           4028]
          Length = 270

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 136/279 (48%), Gaps = 17/279 (6%)

Query: 1   MKRLL-IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCV 56
           M R L IIAG G  P  VA  A+ + +  V     ++    +Q   C     L LG    
Sbjct: 1   MTRTLGIIAGGGSFPITVASTAKERGERVVGVGFASDTDPSFQA-HCDNFSWLKLGQLGR 59

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
           L       ++  +V+AG I++ P   DL    +   R +++++ + + G+  +L+A    
Sbjct: 60  LIDFFTANHVTHVVMAGPINK-PKALDL----RPDWRAARLLFSIKARGDDVLLRALTTE 114

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G++VV  H   P+LL   G L    P +  + D+  A   +++L + D+GQ  V  
Sbjct: 115 LEREGLTVVAPHLYSPDLLAPEGVLTKRKPTQSEREDVEFAWTLSQSLGQFDIGQCLVVR 174

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+ ++R       G  L G   V+VK  K  QD R DLP+ G KT+Q
Sbjct: 175 EKIVLAVEAIEGTDAAIRR-------GGQLGGPGAVVVKRPKPTQDKRLDLPAFGLKTLQ 227

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           ++ + G   +A EAG  +  E+      A+  GI + G+
Sbjct: 228 SMAEVGATCLAFEAGGCIFFEQREALDFANAHGIALLGL 266


>gi|188996318|ref|YP_001930569.1| protein of unknown function DUF1009 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931385|gb|ACD66015.1| protein of unknown function DUF1009 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 267

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 137/272 (50%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRSILHQY 64
           +IAGSG LP   AK+A   N++  I ++ +    + + + +       +   +   L + 
Sbjct: 5   LIAGSGELPKAFAKSAYQNNEDLTIIAIKSSADKELERYGKTHWFSFTEAQKIIDFLKKE 64

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSI-KDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           NI  +V+ G I+       + F   K   R    + +L      +IL + I  LES G  
Sbjct: 65  NIQNLVMLGKIEH----SSILFHFHKLDHRAKTFLSKLKDKRAKSILHSIIQELESEGFK 120

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
            +     + ELL+  G L   V + +V  D+   +K A+ +++LD+GQ+ V   G V+A+
Sbjct: 121 FIDPTPYLKELLIPEGFLINPVDDTEVLNDVEFGIKIAKEIADLDIGQTVVVKDGVVIAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG+EGTD  + R       G  L G++ V+ K  +S QDMR D+P IG KT++++ KA  
Sbjct: 181 EGVEGTDKCILR-------GGELGGENTVVCKTARSNQDMRYDVPVIGLKTLESMKKAKA 233

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             +A+EA K+ +LE+E       E GI V  +
Sbjct: 234 KVLAVEANKTFLLEREKFINRVKEYGITVMSV 265


>gi|163795629|ref|ZP_02189595.1| glutamyl-tRNA synthetase [alpha proteobacterium BAL199]
 gi|159179228|gb|EDP63761.1| glutamyl-tRNA synthetase [alpha proteobacterium BAL199]
          Length = 282

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 135/281 (48%), Gaps = 11/281 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-FECRELPLGDFCVLRS 59
           M  L I+AG G LP  +A+AA        I + +     D  D F    L LG       
Sbjct: 9   MDGLGIVAGGGELPRRIAEAAASDGRPVFIVAFIGHTDADTVDGFPHAWLKLGQTGAALQ 68

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L       +V+AG + RRP++  L    +    +++   ++   G+  +L   ++ +E 
Sbjct: 69  NLRDAACSDVVMAGPM-RRPSLSSLSLDRRSVAALARAGTRVF--GDDGLLSVIVEEIER 125

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  VVG  +++   L   G L    P+RD + DI   +    AL   DVGQ+     G 
Sbjct: 126 DGFRVVGVDDLLGGYLASTGVLAGRAPDRDDEIDIARGIAVLRALGTADVGQAVAVQEGL 185

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E IEGTD+M+ R  D R +GR       VLVK  K  Q+ RAD P+IG  T     
Sbjct: 186 VLAVEAIEGTDAMIARAGDLRRDGR-----GPVLVKGSKPGQERRADRPTIGEGTAVAAA 240

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
            AG  GI +EAG +L++++    +  + AG+F+  + R FA
Sbjct: 241 AAGFRGIVVEAGATLIVDRVPTVRALEAAGLFL--VARSFA 279


>gi|187735386|ref|YP_001877498.1| protein of unknown function DUF1009 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425438|gb|ACD04717.1| protein of unknown function DUF1009 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 287

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 137/270 (50%), Gaps = 21/270 (7%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASV-----LNECSFDWQDFECRELPLGDFCVLR 58
           L ++AG G+ P Y+ + AR +  E  I +V      N       D   +E  +G      
Sbjct: 8   LGLVAGDGVYPEYIVRGARRRTPELRIVAVGFKGETNPAVIPLCD-AYQEFSVGQISKPF 66

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L ++ +  +++AG I+ + N+     S++  LR   ++ ++      ++L A I   E
Sbjct: 67  TFLKKHGVRNVIMAGGINPK-NI----LSLRPDLRALSVLMRMPEKNADSLLGAVITEAE 121

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  ++ A   + E + Q G +    P  +   D    M++A+ +S L +GQS +  GG
Sbjct: 122 KEGFIILPASTYMEEHMPQPGHIAGPPPTPEQWEDARFGMQTAKEISRLHIGQSVIVHGG 181

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGT++ ++R       G +  GK   L K+ +   DMR D+P++G  T++  
Sbjct: 182 TVIAVEAIEGTNNCIRR------GGELGNGKPATLAKVARLGHDMRFDIPTVGPVTIETC 235

Query: 239 IKAGLAGIALEAGKSLVLEK----ELVKKH 264
            + G+  IALEAGK+++LE+    EL K+H
Sbjct: 236 AECGVRQIALEAGKTILLERDRVEELCKRH 265


>gi|126736311|ref|ZP_01752053.1| hypothetical protein RCCS2_00929 [Roseobacter sp. CCS2]
 gi|126714132|gb|EBA11001.1| hypothetical protein RCCS2_00929 [Roseobacter sp. CCS2]
          Length = 293

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 135/292 (46%), Gaps = 31/292 (10%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP   A  ARL    P+I ++         D   R   LG F    + L  
Sbjct: 2   LALIAGTGDLPP--ALVARLPT-RPLICAMDGFRPALTPDVTFRIEQLGSFL---ADLKT 55

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA+  RP +            +++ I   +  G+   L+A I + E  G+S
Sbjct: 56  RGVTDVCMAGAV-TRPPIDPTAIDAATQPLVTR-IMDAIGQGDDGALRAIIAIFEEAGLS 113

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AH+I P+LL Q G L       D ++D + A  +   +   DVGQ+ +   GRV+A 
Sbjct: 114 VKPAHQIAPDLLPQTGVLSRKPVTIDNRQDAVTAEHTIAEMGRADVGQACIVRNGRVLAR 173

Query: 184 EGIEGTDSMLQRIVDCRNN--------GRILAG---------------KSGVLVKMCKSQ 220
           EG  GTD+ML R     +         G +L G               +  +L K  K  
Sbjct: 174 EGQAGTDAMLARFAPSDDPLWGAVDGLGAVLGGAAEWLSGAEGEPTDARGAILFKAPKPG 233

Query: 221 QDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           QD RADLP IG +T Q V+ AG AG+ +EA   +VLE + V    D AG+F+
Sbjct: 234 QDRRADLPVIGPQTAQGVVAAGFAGVVIEADGVMVLELDAVLSILDRAGLFL 285


>gi|89054940|ref|YP_510391.1| hypothetical protein Jann_2449 [Jannaschia sp. CCS1]
 gi|88864489|gb|ABD55366.1| hypothetical protein Jann_2449 [Jannaschia sp. CCS1]
          Length = 255

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 134/267 (50%), Gaps = 23/267 (8%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           I+AG+G LP  +     L+ DE  +            D   R   LG    L   L +  
Sbjct: 4   ILAGTGALPGLL-----LQADEARVVGFKGVPVGVPVDIPARFEQLG---TLFETLRKEG 55

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKM--IWQLVSGGNAAILKASIDLLESYGVS 123
           +  + +AGA+ R P +  + F   D L  SKM  +   +  G+ A+L+  + ++E  G +
Sbjct: 56  VTEVCLAGAMSR-PTLDPVAF---DPLTASKMPVLMSAMGQGDDALLRTIVGVIEDAGFT 111

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV AHEI  +L+ + G L   +  +D   D   A    +AL  LDVGQ AV+  G+V+ +
Sbjct: 112 VVAAHEIRDDLVAEAGVLAGKIKGKD---DATRARAVLDALGPLDVGQGAVAARGQVIGV 168

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E ++GTD+ML  +       +   G  GVL K  K  QD+R D+P+IG  T++N  +AGL
Sbjct: 169 ETLQGTDAMLAFVE------QTAPGSGGVLAKRPKPGQDLRVDMPAIGPDTIRNAARAGL 222

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGI 270
           +GI +  G  L+L++  +     E G+
Sbjct: 223 SGIEIAPGNVLLLDRPAILAACAETGL 249


>gi|262038002|ref|ZP_06011414.1| conserved hypothetical protein [Leptotrichia goodfellowii F0264]
 gi|261747955|gb|EEY35382.1| conserved hypothetical protein [Leptotrichia goodfellowii F0264]
          Length = 268

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 147/280 (52%), Gaps = 14/280 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR-ELPLGDFCVLRS 59
           M R+ +IAG+G LP    K  + K  E     + +      ++     +  +     + S
Sbjct: 1   MDRVGLIAGNGKLPELFLKQCQKKGIELFSVYLFDSVEESIKNHSNSVKYSVAQPGKIIS 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFS-IKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
              +  +  I++ G +++     DL FS +K     +K++    +  +  ILKA I+ +E
Sbjct: 61  HFKRNGLSHIIMLGKVEK-----DLIFSNLKFDFTATKILLSAKNKKDKNILKAIINYIE 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           S G++V+  + ++ + +V+        P+ + ++ I   +++A+ L+++D GQ+ V    
Sbjct: 116 SEGITVLPQNYLMDDYMVKQTVYTKYSPSAEEEKTIEIGIEAAKMLTDIDAGQTVVVKNQ 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALEGIEGTD  + R       G  LAGK+ ++VKM +  QD R D+P+IG +TV+ V
Sbjct: 176 SVIALEGIEGTDKAILR-------GGELAGKNCIVVKMARKNQDYRIDIPTIGLETVKKV 228

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            +    GI +EA K L +++E V  +A++  IF+ GI  E
Sbjct: 229 AEIKGRGIVVEADKMLFIDQEEVINYANKNKIFIKGIKYE 268


>gi|258406346|ref|YP_003199088.1| hypothetical protein Dret_2226 [Desulfohalobium retbaense DSM 5692]
 gi|257798573|gb|ACV69510.1| protein of unknown function DUF1009 [Desulfohalobium retbaense DSM
           5692]
          Length = 278

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/279 (29%), Positives = 136/279 (48%), Gaps = 26/279 (9%)

Query: 4   LLIIAGSGMLPYYVAKAARLKN--------DEPVIASVLNECSFDWQDFECRELPLGDFC 55
           L ++AG G  P  VA  A+ +          E   + +  E   DW  +    L LG   
Sbjct: 9   LGLVAGQGQFPALVAAGAKAQGWGVAAVGFAENTTSGLAAET--DWFQW----LKLGQLG 62

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASID 115
            L +    + + ++V AGAI++ P   D    I+   R ++++W L S  +  +L A   
Sbjct: 63  KLVAFFRTHGVRQVVFAGAINK-PRALD----IRPDFRAARLLWNLRSKSDNTLLTAVAG 117

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
            L   G+ VV A   VPEL    G L     +R  ++D+      A+A+  +D+GQ  V 
Sbjct: 118 ELRREGMEVVSALRFVPELQTPAGQLTKRGLSRREQQDLEYGWPIAKAIGRMDIGQCVVV 177

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV 235
               VVA+EG+EGT++ML+R  D       L G+ G+ +K+ K  Q+   D PS+G  TV
Sbjct: 178 REQMVVAVEGLEGTNAMLKRAGD-------LGGRGGMAIKIFKPGQEEAIDQPSVGLSTV 230

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + +++AGL  + +EA  SL  +++     A+  G+ + G
Sbjct: 231 ETMLEAGLTSLVVEAHTSLFFDRDASVALANRHGLCLYG 269


>gi|257452058|ref|ZP_05617357.1| hypothetical protein F3_03260 [Fusobacterium sp. 3_1_5R]
 gi|257466143|ref|ZP_05630454.1| hypothetical protein FgonA2_01715 [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315917301|ref|ZP_07913541.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
 gi|317058606|ref|ZP_07923091.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313684282|gb|EFS21117.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313691176|gb|EFS28011.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 267

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 139/275 (50%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ II G+G  P Y  K A+ +  +     + +    + ++ E  R   +G    +  
Sbjct: 1   MEKIGIIVGNGKFPLYFMKEAKSQGYDLYPVGLFDSIEEEIKNMEHYRSFHIGHIGEIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 I ++++ G +++    Q+L         I KM   L    +  +L A I  L+ 
Sbjct: 61  HFSFCGIKKLILLGKVEKSLLFQNLDLDYYGQ-EIMKM---LPDKKDETLLFAVISFLKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   +V+        P ++  + I   +++A+ L++LD+GQ+ +     
Sbjct: 117 NGIKVLSQNYLLSSFMVEEICYTEKKPEKEDHKTIQLGVEAAKMLTKLDIGQTVIVKEEA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEG+EGTD  + R  +       LAGK  ++VKM + +QDMR D+P++G +TV+  I
Sbjct: 177 VVALEGMEGTDKTILRAGE-------LAGKGCIIVKMARPKQDMRVDIPTVGVETVKKAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + G  GI +EA K   LE+E     A++ GIF+ G
Sbjct: 230 EIGAKGIVMEAKKMFFLEREEAISLANQYGIFLIG 264


>gi|254510140|ref|ZP_05122207.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221533851|gb|EEE36839.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 264

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 134/275 (48%), Gaps = 25/275 (9%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL------PLGDFCVL 57
           L +IAG+G+LP  V          P+I      C+   + FE   L      PL      
Sbjct: 2   LALIAGTGVLPDEVVACL---PKRPLI------CAL--EGFEPDTLTADVIFPLEQLGSF 50

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
            + L    +  + +AGA+ RRP V D       ++ +  ++ + +  G+   L+A I++ 
Sbjct: 51  IADLKSRGVTEVCMAGAV-RRPAV-DPARIDAATMPLVPILQKAIMSGDDGALRAVIEIF 108

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G+SV  AH I P+LL  +G L    P+     D   A     A+   D+GQ+ V + 
Sbjct: 109 EQAGLSVRAAHAIAPDLLPALGCLTEVQPSASDLSDADRAAGILRAMGAADIGQACVVLK 168

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G+ +A+EGI GT  MLQ +    + G       GVL K  K  QD RAD+P+IG  TV  
Sbjct: 169 GQALAIEGIYGTAWMLQSLTQRPDAG------GGVLFKGPKPDQDRRADMPAIGPDTVSG 222

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
            + AGL+GI +E G  LVL +E V +  +  G+F+
Sbjct: 223 AVAAGLSGIVIEKGGVLVLHRERVIEECNRLGLFL 257


>gi|254489041|ref|ZP_05102246.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214045910|gb|EEB86548.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 263

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 135/275 (49%), Gaps = 25/275 (9%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP----LGDFCVLRS 59
           L +IAG G LP+ VA A   + D P++      C ++    E  E+     L     L  
Sbjct: 2   LALIAGGGGLPHRVASA---QADRPLV------CGYEGVAVEGVEVDQTFRLETLGSLIK 52

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRIS--KMIWQLVSGGNAAILKASIDLL 117
            L    + ++ + GAI  RP+      S  D+L +       + +  G+   L+  ID+ 
Sbjct: 53  SLQDQGVTQVCLCGAI-ARPSFDP---SKLDALTMPLVPAFQKALGAGDDGALRVLIDIF 108

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E+ G +V  AHE+ P+LL   G L T  P+  + +D   A +    L+ +D+GQ  V  G
Sbjct: 109 ETSGFTVRAAHELAPDLLASPGVLSTKAPDTQMTQDAARAAQVVATLAPMDIGQCCVVGG 168

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G+V  +E I GTD +L  + D     R+ +  S +L K  K  Q    D+P+IG  T++ 
Sbjct: 169 GQVYGIETIGGTDHLLATLPD-----RVQS-ASAILFKGPKPDQSRLVDMPTIGPATLEA 222

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             KAGLAGI + AG  +VLE E  K  AD+ G+ +
Sbjct: 223 AHKAGLAGIVIVAGNVIVLEPERCKTLADDLGLVL 257


>gi|260655095|ref|ZP_05860583.1| conserved hypothetical protein [Jonquetella anthropi E3_33 E1]
 gi|260630206|gb|EEX48400.1| conserved hypothetical protein [Jonquetella anthropi E3_33 E1]
          Length = 272

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 141/278 (50%), Gaps = 20/278 (7%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR----ELPLGDFCVLR 58
           +L ++AG G LP  + +  R + +      +L++ S  W D  C     + PL  F V+ 
Sbjct: 4   KLALVAGEGRLPLAILQGLRRRGETDPAVFLLSDDSAPWTDLGCAFKSVKNPLA-FGVIL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGN-AAILKASIDLL 117
           + +    + R+++AG + ++     L +  K+    S+      S  N  ++L A +  +
Sbjct: 63  TSMRLAGVRRLILAGRVPKK-----LMYDRKNMDETSRSTLAEASERNDHSLLGAVVRTI 117

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E +G+ VV   ++VPE++V  G + +  P+ +   D        E +  L  GQS V   
Sbjct: 118 ERFGIRVVPYEDVVPEMVVSEGQVSSGRPSENEMADAQYGWSVLEKILPLSFGQSLVVAD 177

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+A+E +EGTD M++R          LAG+ GVLVK  +  QD R DLP +G +T+  
Sbjct: 178 KSVIAVEAMEGTDGMIER-------AGALAGR-GVLVKGMRRDQDRRYDLPVVGLRTLHK 229

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +  AGL  + L+AG  L+L++  V + AD+ GI V G+
Sbjct: 230 MADAGLTALFLQAGSVLLLDESFVSE-ADKLGIAVWGV 266


>gi|253583580|ref|ZP_04860778.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251834152|gb|EES62715.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 267

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 139/286 (48%), Gaps = 32/286 (11%)

Query: 1   MKRLLIIAGSGMLPYYVAKAAR-----------LKNDEPVIASVLNECSFDWQDFECREL 49
           M +L II G+G LP Y  + A             +  EP I S  N  +F+         
Sbjct: 1   MNKLGIIVGNGKLPLYFLQEAEKQKINVFPIGLFETIEPEIKSYSNFKAFN--------- 51

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAI 109
            +G+   +       ++  I++ G +++    +++    K      +++ +L    +  +
Sbjct: 52  -IGEVGAIVKHFLLNDVREIIMLGKVEKEIIFKEM----KLDKYGEELLKRLPDKKDETL 106

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           L A I      G+ V+  + ++   + Q        P+ +  + I   M++A+ALSE+D 
Sbjct: 107 LFAIIAFFRLNGIKVLPQNYLLKNFMFQEKCYTGIKPSEEDMKTIKIGMEAAKALSEVDA 166

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           GQ+ V     V+ALEGIEGTD  ++R  +       LAG   ++VKM + QQDMR D+P+
Sbjct: 167 GQTVVCKDSSVIALEGIEGTDKTIKRAGE-------LAGTGTIIVKMSRPQQDMRVDIPA 219

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +G +T++  ++ G  GI  EAGK L L ++   + A+E  +F+ GI
Sbjct: 220 VGIETIKRAVEIGAKGIVGEAGKMLFLNRDEAVEFAEEHSLFIIGI 265


>gi|89068198|ref|ZP_01155608.1| hypothetical protein OG2516_02014 [Oceanicola granulosus HTCC2516]
 gi|89046115|gb|EAR52173.1| hypothetical protein OG2516_02014 [Oceanicola granulosus HTCC2516]
          Length = 269

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 83/254 (32%), Positives = 121/254 (47%), Gaps = 9/254 (3%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G+LP  +        + P++  +         D       L     L   L  
Sbjct: 2   LALIAGTGLLPGLLCARLAENGEVPLVCEMAGFAPDLPPDLPRLPFRLETLGSLIGALRS 61

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+ +AGA+ RRP +            + ++   L  G + A L+  + L E  G+ 
Sbjct: 62  RGVERVCLAGAV-RRPVIDPAAIDAATVPLVPRLKAALGKGDDGA-LREIVGLFEEAGME 119

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVGAH+IVPELL   G      P   +K D   A      L   D+GQ+    GGRV+A 
Sbjct: 120 VVGAHDIVPELLPPAGHYAGPAPGEALKADAALAEAVVAELGAADLGQACAVRGGRVLAQ 179

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG EGT +ML  +     +G     ++G+L K  K  QD R DLP+IG +T  +V +AGL
Sbjct: 180 EGPEGTAAMLALLT---PDGP----RTGLLYKAAKPGQDRRVDLPAIGPQTPMSVAEAGL 232

Query: 244 AGIALEAGKSLVLE 257
            GI +EAG  +VL+
Sbjct: 233 GGIVVEAGGVVVLD 246


>gi|237736789|ref|ZP_04567270.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420651|gb|EEO35698.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 267

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 140/282 (49%), Gaps = 24/282 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           MK++ II G+G LP Y  + A  +N       V     FD  D   +         +G+ 
Sbjct: 1   MKKVGIIVGNGKLPLYFLEEAEKQN-----IDVFPLGLFDTIDDRIKAHKNFVSFNIGEV 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRI-SKMIWQLVSGGNAAILKAS 113
             +        I  IV+ G +++     D+ F      R   +++ +L    +  +L A 
Sbjct: 56  GSIVKYFLLNGIDEIVMLGKVEK-----DIIFKDMKLDRFGEELLKRLPDRKDETLLFAV 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I      G+ V+  + ++ + + +       VP+ + ++ I   +++A+ALSE+D GQ+ 
Sbjct: 111 IGFFRLNGIKVLPQNHLLKDFMFRDECYTKIVPSDEDRKTIKIGIEAAKALSEVDAGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     VVALEGIEGTD  ++R  +       LAG   ++VKM + QQDMR D+P++G +
Sbjct: 171 VCKDSSVVALEGIEGTDKTIKRAGE-------LAGSGCIVVKMSRPQQDMRVDIPAVGIE 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           T++  ++ G  GI  EAG+ L L ++   + A+E  +F+ GI
Sbjct: 224 TIKRAVEIGARGIVGEAGRMLFLNRDEAIRLAEENSLFILGI 265


>gi|254465037|ref|ZP_05078448.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685945|gb|EDZ46427.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 262

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 87/276 (31%), Positives = 135/276 (48%), Gaps = 27/276 (9%)

Query: 4   LLIIAGSGMLPYYVAKAAR-------LKNDEPVIASVLNECSFDWQDFECRELPLGDFCV 56
           L +IAG+G LP  VA  A        +   EP   +V  E +F ++        LG F  
Sbjct: 2   LALIAGTGGLPAEVAARAPGRPLICAMAGSEP--DAVDPEITFRFEQ-------LGSFL- 51

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
               L    +  I +AGA+ +RPN+         +L +  ++   ++ G+   L+A I +
Sbjct: 52  --ERLKAAEVTEICMAGAV-QRPNIDPSAIDAA-TLPLVPVLQGALAAGDDGALRAIIGI 107

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            E  G +V  AHE+ P+LL+  G      P    K D     +   A+S  D+GQS    
Sbjct: 108 FEQAGFAVRAAHEVAPDLLMAAGVPTKVQPGELDKADAERGAEIVAAMSAADIGQSCAVR 167

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
             + +A+E + GTD ML  +    +      G+ G+L K  K  QD RADLP+IG +TV+
Sbjct: 168 KRQAIAVENVFGTDWMLAALAQRPD------GQGGLLFKAPKPAQDRRADLPAIGVETVE 221

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
              +AGL+GI LEAG  +VL+++ V    D  G+++
Sbjct: 222 AAARAGLSGIVLEAGGVIVLDQDAVIAACDRLGLYL 257


>gi|260881397|ref|ZP_05893422.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
 gi|260848839|gb|EEX68846.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
          Length = 298

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 137/268 (51%), Gaps = 26/268 (9%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDE-------PVIASVLNECSFDWQDFECRELPLGD 53
           M+R+ ++AG+G LP   A+AA+L   E       P   + L EC+ D     C+ + +  
Sbjct: 32  MERIGLLAGAGKLPVECARAAKLLGYEVYAVALLPETDAELKECTAD-----CQFISIAH 86

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFS--IKDSLRISKMIWQLVSGGNAAILK 111
              + + L ++ + ++ + G +      ++L FS  ++   R+ K+I +L    +  I+ 
Sbjct: 87  LDDVLNYLKEHQVSKVTMIGKV-----TKELLFSGKVQPDARMMKLIMELPDRKDDTIMM 141

Query: 112 ASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQ 171
             +  L   G+       ++  L+   G +    P  + ++D+    + A+ +  LDVGQ
Sbjct: 142 MFVRELAKAGIQAFDQTALIRRLMPHRGVITKREPTAEERKDMEFGFRMAKEIGRLDVGQ 201

Query: 172 SAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIG 231
           +AV     V+ALE IEGTD+       C + G  LA    V+ K+ K QQD R D+P++G
Sbjct: 202 TAVVKNMAVMALEAIEGTDA-------CIHRGGELARGGAVVAKVAKPQQDDRFDVPTVG 254

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKE 259
             T+Q+++  G   +A+EA K+L++E+E
Sbjct: 255 LATIQSMVDVGATALAIEADKTLLVERE 282


>gi|94987560|ref|YP_595493.1| hypothetical protein LI1118 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731809|emb|CAJ55172.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 269

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 120/254 (47%), Gaps = 14/254 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQ 63
           +IAGSG  P+ V K A+ K  + ++           +D       +PLG F  L     +
Sbjct: 4   VIAGSGQFPFMVVKGAQEKGYKVIVCGFHGHTDSKLEDIADHFEMMPLGQFNRLIRFFRR 63

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGAI++   +Q     ++   R  ++ + L   G+ A+ +  I   E  G  
Sbjct: 64  SGVIELCMAGAINKPRALQ-----VRPDFRAFRLYFSLCRKGDDALFRTIIKEFEKEGFL 118

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +V     VP L    G L    P++D+  +I      A +L   D+GQ  V     V+A+
Sbjct: 119 MVSPSTFVPFLHCPPGVLSNKQPDKDILAEISYGWPIATSLGRFDIGQLIVVKQQMVIAI 178

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E +EGT++ LQR       G  L GK+ V +K+ K  QD R DLP+IG +T+  ++K   
Sbjct: 179 ECLEGTNATLQR-------GAELGGKNCVAIKIAKPIQDERVDLPAIGLETIHLLVKYQF 231

Query: 244 AGIALEAGKSLVLE 257
             IA+ A K+L  +
Sbjct: 232 KCIAVSAEKTLFFD 245


>gi|225847953|ref|YP_002728116.1| hypothetical protein SULAZ_0119 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644181|gb|ACN99231.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 270

 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 140/272 (51%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRSILHQY 64
           +IAG G LP   AK+A  KN +  I ++ +  S + + + +       +   +   L + 
Sbjct: 8   LIAGWGDLPLTFAKSAFEKNQDLTIIAIKSSASKELEKYGKTYWFSFTEAQKIIDTLKKE 67

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSI-KDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
            +  +V+ G I+ +     + F + K   R    ++ L      +IL + I+ LE  G  
Sbjct: 68  KVKNLVMLGKIEHKS----ILFHLHKFDERAKNFLFSLKDKRAKSILHSIINELEKEGFE 123

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
            +     +  LLV+ G L   + + ++K+DI+  MK A+ +++LD+GQ+ +   G V+A+
Sbjct: 124 FIDPTPFLSSLLVEEGFLVNPIEDENIKKDIVFGMKIAKEVADLDIGQTVIVKDGVVIAV 183

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG+EGTD        C   G  L G+  V+ K  +  QDMR D+P +G KT++++ KA  
Sbjct: 184 EGVEGTDK-------CILRGGELGGEGTVVCKAARKNQDMRYDVPVVGVKTLESMKKAKA 236

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             +A+E+GK+ +L K+   K A E  I V G+
Sbjct: 237 KVLAVESGKTYLLNKDEFIKKAKEYKISVLGV 268


>gi|108763981|ref|YP_632885.1| hypothetical protein MXAN_4723 [Myxococcus xanthus DK 1622]
 gi|108467861|gb|ABF93046.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 268

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 85/286 (29%), Positives = 146/286 (51%), Gaps = 30/286 (10%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDE-----------PVIASVLNECSFDWQDFECREL 49
           M R+ +IAG+G LP+  A+AAR K  E           P +A+ ++  +  W       +
Sbjct: 1   MDRIGLIAGNGRLPFLFARAARKKGLEVVAVAHRGETDPALAAEVDRLT--W-------V 51

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAI 109
            +G    ++    +  + + V+AG I R   V+ L  +  D L   ++I +L S  + A+
Sbjct: 52  RVGQVDRIQKAFREAGVKQAVMAGGIGR---VRALAEARPD-LGAVRIISRLRSFRDDAL 107

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           L+A     ES GV+++   + + E+L   G L     +   ++D+    + A  L + DV
Sbjct: 108 LRAVASDFESRGVTIIAPTDFLGEVLCPEGHLAGPRLHPAQEKDVALGREVAMLLGQADV 167

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           GQ+ V   G V+ALE +EGTD  + R       GR+      V+VK CK QQD+R DLP+
Sbjct: 168 GQTVVVHNGHVLALEAVEGTDEAILR------GGRLGGNSGAVVVKRCKPQQDLRFDLPA 221

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +G  T++ + + G   +ALE G++++L+   +   A+  GI + G+
Sbjct: 222 VGPHTLEVMQEVGARVLALEVGRTVLLDAPALFAGAESRGITIVGV 267


>gi|257126039|ref|YP_003164153.1| hypothetical protein Lebu_1273 [Leptotrichia buccalis C-1013-b]
 gi|257049978|gb|ACV39162.1| protein of unknown function DUF1009 [Leptotrichia buccalis
           C-1013-b]
          Length = 269

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 121/218 (55%), Gaps = 13/218 (5%)

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFS-IKDSLRISKMIWQLVSGGNAAILKASIDLL 117
           S   +  +  +V+ G +++     +L FS +K  L  +K++    +  +  ILKA ID +
Sbjct: 62  SYFKKSGVSHLVMLGKVEK-----NLIFSNLKFDLTATKILLSTKNKKDKNILKAIIDFI 116

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           ES  + V+  + ++ E +          P++D ++ I   +++A  L+++D GQ+ V   
Sbjct: 117 ESENIQVLPQNYLMDEYIAGNEIYTKVSPSKDEEKTIKIGIEAARMLTDIDAGQTVVVKD 176

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+ALEG+EGTD  + R       G  LAGK+ ++VKM +  QD R D+P+IG +T++ 
Sbjct: 177 ESVIALEGVEGTDKAILR-------GGELAGKNCIVVKMARRNQDYRIDMPTIGLETIKK 229

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + +    GI +EA K L ++KE V K A++  IF+ GI
Sbjct: 230 IAEINGRGIVIEADKMLFIDKEEVIKFANKNKIFIKGI 267


>gi|328954375|ref|YP_004371709.1| protein of unknown function DUF1009 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454699|gb|AEB10528.1| protein of unknown function DUF1009 [Desulfobacca acetoxidans DSM
           11109]
          Length = 269

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 140/272 (51%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLRSILHQ 63
           +IAG    P    +AA+ +  E V  +   E   + +      + + +G    +     Q
Sbjct: 7   LIAGKNKFPLIFTQAAQKQGLEVVAVAHHGETDPALEQMVSALKWVYVGQLGKIIRFFQQ 66

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + + V+AG I +      L   ++   R  K+I ++    +  IL+A  D LES G++
Sbjct: 67  AGVSQAVMAGGITK----GRLFTHLRPDWRALKIIRRVGQARDDGILRALADELESEGIT 122

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +V     + ELL   G L    P+   +RDI      A+ + +LD+GQ  V     V+AL
Sbjct: 123 IVSPTLFLEELLAPAGVLSRRRPSAGEQRDIRFGWSIAKEIGKLDIGQCVVVRRQAVLAL 182

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I+GTD+ ++R       G +LAG+  V+VK+ K  QD+R D+P++G +T+Q + +   
Sbjct: 183 EAIDGTDATIRR-------GGLLAGEGAVVVKVSKPGQDLRFDVPAVGVETIQVMREVKA 235

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + +ALEAGK+LV +++ +   AD+A I V G+
Sbjct: 236 SVLALEAGKTLVFDRDAMLHLADQAKIAVVGL 267


>gi|317153116|ref|YP_004121164.1| hypothetical protein Daes_1404 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943367|gb|ADU62418.1| protein of unknown function DUF1009 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 277

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 138/277 (49%), Gaps = 23/277 (8%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-------WQDFECRELPLGDFCVLR 58
           +IAG    P  VA+  +      V+A      + D       WQ     EL LG    L 
Sbjct: 10  LIAGGRQFPILVARGVKAHGYRLVVAGFTGHTNMDVVPYADVWQ-----ELKLGKLGRLI 64

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           +   +  + R+++AG ID+ P V D+       +R  K++++  + G++AIL +  +  E
Sbjct: 65  AFFRENGVDRVIMAGTIDK-PKVMDIRHL---DMRAVKLLFRQKNKGDSAILGSLAEEFE 120

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ VV AH+ +PELL  +G +    P+   + D+    K A+ L  +D+GQ  V   G
Sbjct: 121 REGMPVVPAHDYLPELLSPLGVMTRREPDEREREDLRYGWKIAKELGRMDIGQCVVLREG 180

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            + A+E +EGTD+ + R       G  L G   V++K+ K  Q  + DLPS+G  TV+ +
Sbjct: 181 IISAVEALEGTDAAIAR-------GCGLGGPGCVVIKVFKPGQQEQVDLPSLGLDTVRAM 233

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           I      + +EAG+SL  +++     AD AG+ + G+
Sbjct: 234 IDGKATCLGVEAGRSLFFDRDEALALADRAGMAIVGL 270


>gi|86138413|ref|ZP_01056987.1| hypothetical protein MED193_04896 [Roseobacter sp. MED193]
 gi|85824938|gb|EAQ45139.1| hypothetical protein MED193_04896 [Roseobacter sp. MED193]
          Length = 262

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 136/276 (49%), Gaps = 27/276 (9%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC-------RELPLGDFCV 56
           L +IAG+G+LP  V    +LK   P+I      C+ +  + +C       R   LG F  
Sbjct: 2   LAVIAGTGLLPKEVCDR-QLKR--PLI------CAMEGSEPDCVDAEISFRIEHLGSFL- 51

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
             + L    +  + +AGA++R P   D       +L +  +I   +  G+   L+A + L
Sbjct: 52  --ARLKSAGVTEVCLAGAVNRPPI--DPTAIDAATLPMVPVIQAALGAGDDGALRAVMGL 107

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           +E  G ++  AHE+ PELL+  G      P    K D     +   A+S  D+GQ     
Sbjct: 108 IEQAGFTLRAAHEVAPELLMAEGVASKFQPGALDKADADRGAEVVAAMSAADIGQCCAIR 167

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
             + +A+E   GT+ MLQ +    +      G+ G+L K  K  QD RADLP++G +TV+
Sbjct: 168 ARQAIAVENTFGTNWMLQSLRQRPD------GQGGILFKAPKPGQDRRADLPAVGPQTVE 221

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
              +AGL+GI LEAG  +VLE+E V    D  G+F+
Sbjct: 222 LAAQAGLSGIVLEAGSVIVLEQEEVVAACDRLGLFL 257


>gi|115377101|ref|ZP_01464316.1| phosphatidate cytidyltransferase [Stigmatella aurantiaca DW4/3-1]
 gi|115365876|gb|EAU64896.1| phosphatidate cytidyltransferase [Stigmatella aurantiaca DW4/3-1]
          Length = 242

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 130/239 (54%), Gaps = 18/239 (7%)

Query: 37  CSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISK 96
            +F W       + LG    + S   + ++ +  +AG I R   V+ L  +  D +   +
Sbjct: 21  AAFTW-------VRLGQVGRIVSTFQKASVTQAAMAGGIGR---VRALTEARPD-MGAVR 69

Query: 97  MIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILA 156
           ++ +L S  + A+L+A  D  E++GV++V   + + +++   G L     + + ++D+  
Sbjct: 70  ILSRLRSLRDDALLRAVADHFEAHGVTIVAPTDYLAQVMCPAGHLAGPRLHPEQEKDVAL 129

Query: 157 AMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKM 216
            ++ A  L + DVGQ+ V  GG V+ALE +EGTD  ++R       G  L GK  V+VK 
Sbjct: 130 GVEVASLLGKADVGQTVVVKGGNVLALEAVEGTDETIRR-------GAKLGGKGAVVVKR 182

Query: 217 CKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           CK  QD+R DLP+ G +T++ + + G   +ALEAG++++LE + +   A+  GI V GI
Sbjct: 183 CKPGQDLRFDLPAAGPRTLEVMAEVGAKVLALEAGRTVLLETQALFARAEADGITVVGI 241


>gi|260433797|ref|ZP_05787768.1| phosphatidate cytidyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417625|gb|EEX10884.1| phosphatidate cytidyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 264

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 135/276 (48%), Gaps = 27/276 (9%)

Query: 4   LLIIAGSGMLP-YYVAKAARLKNDEPVIASVLNECSFDWQDFECREL------PLGDFCV 56
           L +IAG+G+LP   V+  A    + P+I      C+   + FE   L      PL     
Sbjct: 2   LALIAGTGVLPDELVSHLA----ERPLI------CAL--EGFEPDRLRPDISFPLEHLGS 49

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
             + L    +  I +AGA+ RRP +       + +  +  +   LVSG + A L+A I +
Sbjct: 50  FIAELKARGVTHICMAGAV-RRPKIDPSRIDAQTAPLVPIIQKALVSGDDGA-LRAVIGV 107

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G+ V  AH+I P+LL  +G L    P      D   A+    A+   D+GQ+ V  
Sbjct: 108 LEDAGLQVQAAHQIAPDLLPPLGCLTQAQPTEAELADANRAVGVLRAMGAADIGQACVVH 167

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
            G+V+A+EG  GT  MLQ +    + G       G+L K  K  QD RADLP+IG  TV 
Sbjct: 168 QGQVLAVEGAFGTAWMLQSLAARPDAG------GGILFKGPKPGQDRRADLPAIGPDTVT 221

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             + AGL+GI +E G  +VL++  V    D  G+F+
Sbjct: 222 GAVAAGLSGIVVEKGGVIVLQRAEVVAECDRLGLFL 257


>gi|225874201|ref|YP_002755660.1| hypothetical protein ACP_2639 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793020|gb|ACO33110.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 282

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 139/270 (51%), Gaps = 16/270 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-------FECRELPLGD 53
           M +L +IAG+G  P+ + +AAR    E V+A++  E   +  D            L LG+
Sbjct: 1   MSKLGLIAGNGRFPFLLLEAARASGLEVVVAAIKEETDPEMNDRAAADPGLRVYWLSLGE 60

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKAS 113
              L    H+  + R V+AG +  +     +  SI+   R++K++  L +     +L A 
Sbjct: 61  LSKLIDTFHKEGVTRAVMAGQVRHK----QIFSSIRPDWRLAKLLMSLRTRNTDMLLGAV 116

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
             +L   G+ ++ +   +  +LV+ G L    P  D +RDI    + A+ ++  D+GQ+ 
Sbjct: 117 AKVLGDEGIELISSTTYLEPMLVEPGVLTERAPEEDEQRDIAYGREVAKGIAGYDLGQTV 176

Query: 174 VSIGGRVVALEGIEGTDSMLQR----IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           V      VA+E +EGTD+ ++R    +    +    L+ +  V VK+ K +QDMR D+P 
Sbjct: 177 VVAAQACVAVEAMEGTDATIERAGALMRTLDDEASTLSHRLTV-VKVAKPKQDMRFDVPV 235

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           IG +T++ +I AG   +A+EA ++L+ +++
Sbjct: 236 IGLRTIETMIAAGATCLAIEAKRTLIFDRD 265


>gi|262277269|ref|ZP_06055062.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224372|gb|EEY74831.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 262

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 137/254 (53%), Gaps = 11/254 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           I AG+G  P  +  + + KN++  I  VLN      +D    ++ LG+F  +  +L  Y 
Sbjct: 4   IFAGTGDYPKEIIYSLK-KNNKKFI--VLNITEKKIKD--SFKINLGEFGKILKLLKDYE 58

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
           I  ++ AG + +RPN++++ F +K    +  +I    SG +  IL  +  +L    + VV
Sbjct: 59  IREVIFAGYV-KRPNLRNMKFDMKAISYMPHLIKAFKSG-DGNILNLAKKILNQNKIKVV 116

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
            +H+    LL++  ++    PN+   +D     K  + LS+ D  Q  V   G +VA+E 
Sbjct: 117 ESHKYSKNLLLK-KTVTQKKPNKIDLQDAKKGKKILDNLSKFDNAQGVVIDEGYIVAIEA 175

Query: 186 IEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAG 245
            EGTDSML+R+++     +    KSGVL+K  K  Q+++ DLP+IG KTV+  +++ L G
Sbjct: 176 AEGTDSMLKRVINLN---KNKNKKSGVLIKFPKKNQNLKYDLPTIGLKTVKLCMQSKLNG 232

Query: 246 IALEAGKSLVLEKE 259
           I L+  +++ L ++
Sbjct: 233 IFLKKNQNIFLNQK 246


>gi|299136293|ref|ZP_07029477.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX8]
 gi|298602417|gb|EFI58571.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX8]
          Length = 299

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 134/268 (50%), Gaps = 21/268 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--------LPLGDFCVL 57
           +IAG+G  P+ +  AAR      V+A++  E   +  +   RE        L LG+   L
Sbjct: 11  LIAGNGRFPFLLLDAARAHGLRVVVAAIKEETDLEINERAAREPEFVRVHWLSLGELSKL 70

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
             +  +  + R V+AG +  +     +  SI+   R++K++  L +     +L A   +L
Sbjct: 71  IEMFQRAGVARAVMAGQVKHK----QIFSSIRPDWRLAKLLLNLRTRNTDMLLGAVAKVL 126

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G++++ +   +  +L   G L +  P+   + DI   ++ A  ++  D+GQ+ V   
Sbjct: 127 EDEGITLMSSTAFLEPMLAVEGVLTSRAPDATERGDIDYGLRVARGIAGFDLGQTVVIAA 186

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVL------VKMCKSQQDMRADLPSIG 231
           G  VA+E +EGTD+ + R  +     R L  ++  L      VK+ K +QDMR D+P +G
Sbjct: 187 GACVAVEAMEGTDATIARAGEL---FRTLEDEASTLDRRLTVVKVAKPKQDMRFDVPVVG 243

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKE 259
             T+Q +  AG   + +EAG++L+ ++E
Sbjct: 244 LPTIQAMQAAGATCLCIEAGRTLLFDRE 271


>gi|296122606|ref|YP_003630384.1| hypothetical protein Plim_2359 [Planctomyces limnophilus DSM 3776]
 gi|296014946|gb|ADG68185.1| protein of unknown function DUF1009 [Planctomyces limnophilus DSM
           3776]
          Length = 294

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 140/282 (49%), Gaps = 15/282 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC---RELPLGDFCVLR 58
           +R+ ++AG+G  P   A+AA+ +  + V   V    S +  +  C   +E PL  F    
Sbjct: 11  QRVGLLAGAGRFPISFAEAAKKQGIKVVCVGVAGMASPELAE-HCHIYQEGPLARFGYAM 69

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDL-CFSIKDSLRISKMIWQLVSGG--NAAILKASID 115
            +  ++ + R+++AG I++    Q    F +    R  +M +   +    +  IL A I 
Sbjct: 70  KVFKRHRVDRLIMAGKIEKTVLFQSWRIFRLLPDFRTLRMWYSFATSNRKDDTILLAVIR 129

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
             E        A +  PELLV+ G L    P     RDI      A+ +  LDVGQS V 
Sbjct: 130 EFERDNFHFDSALDYCPELLVKHGFLTRRKPTDAQWRDIRFGWSLAKEMGRLDVGQSVVV 189

Query: 176 IGGRVVALEGIEGTDSMLQRIVD-CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
               V+A+E IEGTD  ++R  + CR  G         +VK+ K  QD R D+P+IG +T
Sbjct: 190 NDMAVIAVEAIEGTDRCIRRAAELCRRGG-------FTVVKVAKPNQDRRFDVPTIGIQT 242

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           ++ + +AG   +A+EAG+++++++    + AD+ GI +  ++
Sbjct: 243 IRTMHEAGGRVLAVEAGQTIIIDEPEAVELADKLGIAIVSLN 284


>gi|251771048|gb|EES51632.1| conserved protein of unknown function [Leptospirillum
           ferrodiazotrophum]
          Length = 277

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 135/273 (49%), Gaps = 14/273 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLRSILHQ 63
           +IAG+G  P    +AA+      V+ +   E   + +   F  R + LG    +    H+
Sbjct: 17  MIAGNGSFPLIFLEAAQKAGIRVVVVAHEGETDPAIETMGFPVRWIRLGQVGAIFDTFHK 76

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             I R    G + R+P + DL    K  +    ++ +L    +   L+A  D  E  G++
Sbjct: 77  NGISRAAFVGGV-RKPRLFDLRPDWKGMM----ILGRLSRYHDDEALRALADEFEKEGIT 131

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +V +  ++P+L   VG L    P    + DI   +  A  L   D+GQ  V     VVA+
Sbjct: 132 IVPSTLLLPDLAAPVGPLTRRKPTASEEADIRVGIDVARILGPADIGQCLVVREKVVVAV 191

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD  ++R       GR   G+ GV+VKM K  QD+R DLPS+G +T++ +++A  
Sbjct: 192 EAIEGTDETIRR------AGR-FGGEGGVVVKMAKPGQDLRFDLPSVGPETIRVMMEAKA 244

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
             +A+EAGK+L+  +E     AD A I V GI+
Sbjct: 245 RVLAVEAGKTLLFSREETLGLADSADIAVVGIE 277


>gi|220932590|ref|YP_002509498.1| hypothetical protein Hore_17540 [Halothermothrix orenii H 168]
 gi|219993900|gb|ACL70503.1| uncharacterized protein conserved in bacteria [Halothermothrix
           orenii H 168]
          Length = 272

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 140/278 (50%), Gaps = 13/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M ++ +IAG G LP   A +AR +  +     ++ E     ++     + + +G F  L 
Sbjct: 1   MSKIGLIAGRGKLPAIWAASARDRGHDVYAFPIIEEADEGLKNIAKVIKPVNVGAFDNLI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           +IL + +I ++V+ G +    N   L    +   R+ +M+  L    + +IL   ++ L+
Sbjct: 61  NILIENDISKVVMIGKV----NKTRLFGKTRLDARMQQMLANLRELNDDSILLGIVNELK 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V+     + +L    G + +  P+  +  D+  A K A  +  LD+GQ+ +    
Sbjct: 117 KEGIEVLKQSTFIEDLFPTPGPVTSKTPDDSLLEDMKYAFKLARGIGGLDIGQTVLVKNR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD  ++R  +       L G    + K+ K  QD R D+P++G  T++N+
Sbjct: 177 AVLAVEAIEGTDQAIKRAGE-------LGGAGATMAKVSKPNQDFRFDIPTVGLTTLRNL 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           IK    G+ +EAGK+ ++++E   + A+ +GI V  ++
Sbjct: 230 IKIKARGLVIEAGKTFIVDREEFIETAEASGITVMALE 267


>gi|304437452|ref|ZP_07397410.1| protein of hypothetical function DUF1009 [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
 gi|304369502|gb|EFM23169.1| protein of hypothetical function DUF1009 [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
          Length = 272

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 143/279 (51%), Gaps = 16/279 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M++L ++AG G LP   A+AAR +  E    ++L +C  + +D     RE+ +G    + 
Sbjct: 6   MEKLGLLAGVGHLPAACARAARAQGFEVHAIALLPDCDPELKDAANAYREISIGSIASIL 65

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFS--IKDSLRISKMIWQLVSGGNAAILKASIDL 116
           + L Q  I ++ + G + +     +L F+  ++    +  M+ QL +  +  I+   I  
Sbjct: 66  AYLQQEKIQKVTMIGKVTK-----ELLFTGAVQPDEMLRGMLMQLPNQNDDTIMMMFIGA 120

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           L   GV+ +    ++  L+   G L +  P+   + D+   ++ A  +  LDVGQ+AV  
Sbjct: 121 LMKIGVTPLDQTALIRPLMPPAGVLTSRQPSAAERADMEYGLQMAREIGRLDVGQTAVVK 180

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+ALE IEGTD+       C   G  LAG   V+ K  K QQD R D+P++G  T++
Sbjct: 181 DRAVMALEAIEGTDA-------CIRRGGQLAGGGAVVAKAAKPQQDSRFDVPAVGLDTIE 233

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +++    + +A+EAGK+L ++KE     A+  GI +  +
Sbjct: 234 SLVAVKASALAIEAGKTLFVDKERAIALAEANGITIAAM 272


>gi|56696556|ref|YP_166913.1| hypothetical protein SPO1674 [Ruegeria pomeroyi DSS-3]
 gi|56678293|gb|AAV94959.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 264

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 139/275 (50%), Gaps = 25/275 (9%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP  +   ARL   EP +   +   + +    +    P+     L + L  
Sbjct: 2   LALIAGTGALPEELV--ARLS--EPPLVCAMEGFAPERLAVDI-PFPIEHLGSLVADLKA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  I +AGA+ R P V D       +L +  +I Q ++ G+   L+A + + E+ G++
Sbjct: 57  RGVSEICLAGAVGR-PAV-DPARIDAATLPLVPVIQQALTSGDDGALRAVMGIFENAGLT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNR----DVKR--DILAAMKSAEALSELDVGQSAVSIG 177
           V  AHEI P+LL+  G      P      D +R  +I+AAM +A      D+GQ+ V   
Sbjct: 115 VRAAHEIAPDLLMPAGCPTKAQPEPAELADARRGAEIVAAMSAA------DIGQACVVHR 168

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G+ +A+E + GT+ ML  +    + G       GVL K  K  QD RADLP+IG  TV  
Sbjct: 169 GQALAVESVFGTNWMLGSLGQRPDAG------GGVLFKAPKPDQDRRADLPTIGPDTVTA 222

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
            + AGL+G+ + AG  +VLE++ V    D  G+F+
Sbjct: 223 AVVAGLSGLVIAAGGVIVLERDRVIAECDRLGLFL 257


>gi|187250501|ref|YP_001874983.1| hypothetical protein Emin_0079 [Elusimicrobium minutum Pei191]
 gi|186970661|gb|ACC97646.1| Uncharacterized protein conserved in bacteria DUF1009
           [Elusimicrobium minutum Pei191]
          Length = 273

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 144/274 (52%), Gaps = 10/274 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVL-NECSFDWQDFECR--ELPLGDFCVL 57
           M+++ IIAG G +P Y+A  A+ K     +A +  N    D++ +     E  +G     
Sbjct: 1   MEKIGIIAGEGKMPVYIAAEAKEKGVAVYVACIKGNAFPSDFEAYSASTVEFKMGQLSKG 60

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
            +   +  + ++++AG +        +  +I   LR +KM+  L       IL+A I+  
Sbjct: 61  INFFKENGVTKVLMAGRVKHTA----IFSNIMPDLRGAKMLAGLKDMKAQTILRAIINEF 116

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G+S + +   + + +   G LG   P  + K  I   ++ A+ALS LD+G + V   
Sbjct: 117 EKEGISFISSVSFLEKYMPGPGLLGKRPPTEEEKLSIEFGIEIAKALSGLDIGLTVVVAD 176

Query: 178 GRVVALEGIEGTDSMLQRI-VDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
             VVALEG+EGTD  ++R  +  +N+ +    KS V+VK+ + QQD R DLP IG  T++
Sbjct: 177 RAVVALEGMEGTDECIKRAGMLYKNSSK--KNKSLVVVKVARPQQDFRFDLPIIGKGTIK 234

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
           + +++G   + +E  K+L+L+ + V K AD+A I
Sbjct: 235 SAVESGAKVVVIEGRKTLILDMDEVIKMADKASI 268


>gi|116327597|ref|YP_797317.1| hypothetical protein LBL_0829 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331792|ref|YP_801510.1| hypothetical protein LBJ_2278 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116120341|gb|ABJ78384.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125481|gb|ABJ76752.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 282

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 134/264 (50%), Gaps = 14/264 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M RL I+AG G LP+   K A    ++P+  S++ E  F   D+  R +P+       L 
Sbjct: 1   MGRLGILAGGGELPHIGMKEALAAGEDPIFFSII-ESDFHEGDYGDRNVPVHIVKIGTLM 59

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +  +Y+I R+++ G + +    ++L F +K    IS ++ ++++  + +I K + D   
Sbjct: 60  KLCKRYDIDRLLLLGKVKKEIIFKNLKFDLK---AIS-LLARMINKHDYSIFKTASDEFS 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              ++++     +  L +  G     V N+    D+   M+ AE ++ELD+GQ+ + +  
Sbjct: 116 KEKIAIISQKTYLQSLFLPEGRFTKKVLNKKELEDVSFGMEYAEKMAELDIGQTVIVLDK 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTDS ++R       G     +   + K  K  QD R DLP++G  T++ +
Sbjct: 176 SVLAVEAVEGTDSAIRR------GGSFAKKRKATVCKSSKPDQDHRFDLPTVGENTLRIM 229

Query: 239 IKAGLAGIALEAGKSLVLE-KELV 261
            +     +AL  G+++++  KE +
Sbjct: 230 HENNCETLALRTGETIIVHPKEFI 253


>gi|254477136|ref|ZP_05090522.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214031379|gb|EEB72214.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 253

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 128/253 (50%), Gaps = 11/253 (4%)

Query: 20  AARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRP 79
           A RLK+   V A   +E      +   R   LG F    + L    +  I +AGA+ RRP
Sbjct: 6   AHRLKDRPLVCAMRGSEPDHIEAELTFRLEQLGSFI---ARLTASGVTEICLAGAV-RRP 61

Query: 80  NVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVG 139
            + D      +++ +  ++   ++ G+   L+A I + E  G+SV  AHE+ P+LL+  G
Sbjct: 62  AI-DPSEIDAETMPLVPILQGAIAAGDDGALRAIIGIFEQAGLSVRAAHEVAPDLLMGEG 120

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P    + D     +  EA+S  DVGQS     G+ +++E + GTD ML+ +   
Sbjct: 121 VPTEIQPGELDRPDADRGAEVVEAMSRADVGQSCAIRRGQAISVENLFGTDWMLRALAQR 180

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
            +      G  G+L K  K  QD RADLP+IG +TV+   +AGL+GI LEAG  +VL ++
Sbjct: 181 PD------GTGGLLFKAPKPDQDRRADLPTIGPQTVELAAQAGLSGIVLEAGGVIVLSQD 234

Query: 260 LVKKHADEAGIFV 272
            V    +  G+F+
Sbjct: 235 EVIAACNRLGLFL 247


>gi|317485989|ref|ZP_07944844.1| hypothetical protein HMPREF0179_02199 [Bilophila wadsworthia 3_1_6]
 gi|316922762|gb|EFV43993.1| hypothetical protein HMPREF0179_02199 [Bilophila wadsworthia 3_1_6]
          Length = 281

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 134/265 (50%), Gaps = 18/265 (6%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASV--LNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           IIAGSG  P  VA+ A+      V+ +     +   +        + LG F  +     +
Sbjct: 7   IIAGSGQFPRLVAEDAKAAGYGVVVCAFHGFTDPGLEALADAYTTVYLGQFDKVIDYFRK 66

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           + + R+ +AGAI++ P   DL    +   R +++++ L   G+ A+L+A +  LE  G +
Sbjct: 67  HGVRRLCMAGAINK-PRALDL----RPDFRAARILFSLRGKGDDALLRAIMADLEKEGFT 121

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           ++ A E+   LL   G L    P+ +   +I      AEAL   D+GQ  V   G VVA+
Sbjct: 122 LIQAAELSTSLLCPEGVLTRRGPSAEEIAEIDYGWPIAEALGRFDIGQCIVVKQGMVVAV 181

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E +EGTD+ L+R       G  L G+  V +K  K +QD R DLPSIG +TV+ +I+   
Sbjct: 182 ECLEGTDAALRR-------GGELRGEGCVAIKRFKPKQDERVDLPSIGLQTVRLLIEQHY 234

Query: 244 AGIALEAGKSLVLEK----ELVKKH 264
             +A++AGK+L  ++     L  KH
Sbjct: 235 RCLAVDAGKTLFFDRAEALALADKH 259


>gi|320529924|ref|ZP_08031001.1| hypothetical protein HMPREF9555_01076 [Selenomonas artemidis F0399]
 gi|320137942|gb|EFW29847.1| hypothetical protein HMPREF9555_01076 [Selenomonas artemidis F0399]
          Length = 267

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 140/289 (48%), Gaps = 36/289 (12%)

Query: 1   MKRLLIIAGSGMLP-----------YYVAKAARLKNDEPVIASVLNECSFDWQDFECREL 49
           M+++ ++AG G LP           Y V   A L + +P +    N           RE+
Sbjct: 1   MEKIGLLAGVGHLPAACARAARALGYEVHAVALLPDTDPELKDAANVY---------REI 51

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFS---IKDSLRISKMIWQLVSGGN 106
            +G    + + L Q  I ++ + G + +     +L F+   + D + +  M+ QL +  +
Sbjct: 52  SIGQIASILAYLQQEEIKKVTMIGKVTK-----ELLFTGAIVPDEM-LRGMLMQLPNQND 105

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSE 166
             I+   +  L   GV+ +    ++  L+   G+L +  P+   +RD+   ++ A  +  
Sbjct: 106 DTIMMMFVGALMKIGVTPLDQTALIRPLMPAEGTLTSRAPSEAERRDMEFGLQMAREIGR 165

Query: 167 LDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRAD 226
           LDVGQ+AV     V+ALE IEGTD+       C   G  LAG   V+ K  K QQD R D
Sbjct: 166 LDVGQTAVVKDMAVMALEAIEGTDA-------CIRRGGQLAGSGAVVAKAAKPQQDSRFD 218

Query: 227 LPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +P++G  T+++++    + +A+EAGK+L ++KE     A+  GI +  +
Sbjct: 219 VPAVGLDTIESLVAVKASALAIEAGKTLFIDKERAVALAEANGITIAAL 267


>gi|294084075|ref|YP_003550833.1| hypothetical protein SAR116_0506 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663648|gb|ADE38749.1| protein of unknown function DUF1009 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 273

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 124/251 (49%), Gaps = 9/251 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M +L IIAG G +P  +  AA     + V+  + ++   D+  F+   + L +    R +
Sbjct: 1   MTKLAIIAGQGHIPVDIGHAAIANGHDVVMMPLEHQADADYSSFQTEPIGLANIGRTRKL 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           +  +    +++ G + RRP + DL   +     + KM+ +    G+   L+   +     
Sbjct: 61  MLDHACDAMIMVGKV-RRPPIGDLRPDVDGVKLLGKMLMR----GDDQTLRLVAEYFAEV 115

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ V+ A +I+P+  + +G +      +  + DI       +++   D+GQ  V   GR+
Sbjct: 116 GIKVMAASDIMPDRHLAIGLVAGSRLGKQNRADIDLGCAVLDSIGSHDIGQGVVVQDGRI 175

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +++E  EGTD+ML R  D  +          V VK+ KS QD R D+P IG +TV+ V+ 
Sbjct: 176 ISIEAAEGTDAMLARSADLIDK----TASGAVFVKIPKSAQDKRLDIPFIGLETVKAVVD 231

Query: 241 AGLAGIALEAG 251
           AG+  +A+EAG
Sbjct: 232 AGIRVMAIEAG 242


>gi|254452404|ref|ZP_05065841.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198266810|gb|EDY91080.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 266

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 133/272 (48%), Gaps = 15/272 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASV---LNECSFDWQDFECRELPLGDFCVLRSI 60
           L +IAG G LP  +  A ++     ++  +   ++E + D+     R   LG F    + 
Sbjct: 3   LALIAGLGGLPTALVAALQVPKRAVIVCEMHGFVSEVTGDFHRITFRFETLGTFL---AD 59

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    +  + +AGAI +RP V D       ++ +   +   ++ G+   L A + L E  
Sbjct: 60  LKTAGVTEVCMAGAI-QRPKV-DPSLIDAATMPLVPRLMAAMAKGDDGTLSAVVALFEEQ 117

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G +VVGAH I P+LL   G + T V   D+   I AA  + + + ++D+GQ+ +  G  V
Sbjct: 118 GFAVVGAHAIAPDLLPMAG-VHTQVAPPDLTAGIAAAQVALDDMGQIDLGQAMLLRGSDV 176

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A E + GT +MLQ   D + +G    G    L K  K  Q+MR D+P IG +T      
Sbjct: 177 IAREDVRGTAAMLQ---DVKTHGN---GAGVTLFKAPKPNQNMRVDMPLIGPETALQAAD 230

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           AGLAGI +  G  LVL+   V    D  G+++
Sbjct: 231 AGLAGIVIPQGSVLVLDLPQVVATLDTHGLYL 262


>gi|256844939|ref|ZP_05550397.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|256718498|gb|EEU32053.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
          Length = 267

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 138/281 (49%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDDEIKKLDNYAEFNVGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   ++ +IV+ G +++R   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDVTKIVMLGKVEKRLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+    ++ + + +        P+ D ++ IL  +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLSGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTILLGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKR------AGQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           TV+  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TVETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|238927539|ref|ZP_04659299.1| protein of hypothetical function DUF1009 [Selenomonas flueggei ATCC
           43531]
 gi|238884821|gb|EEQ48459.1| protein of hypothetical function DUF1009 [Selenomonas flueggei ATCC
           43531]
          Length = 272

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 142/279 (50%), Gaps = 16/279 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC--RELPLGDFCVLR 58
           M++L ++AG G LP   A+AAR +  E    ++L +C  + +D     RE+ +G    + 
Sbjct: 6   MEKLGLLAGVGHLPAACARAARAQGFEVHAIALLPDCDPELKDAASAYREISIGSIASIL 65

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFS--IKDSLRISKMIWQLVSGGNAAILKASIDL 116
           + L Q  I ++ + G + +     +L F+  ++    +  M+ QL +  +  I+   I  
Sbjct: 66  AYLQQEKIQKVTMIGKVTK-----ELLFTGAVQPDEMLRAMLMQLPNQNDDTIMMMFIGA 120

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           L   GV+ +    ++  L+   G L +  P+   + D+   ++ A  +  LDVGQ+ V  
Sbjct: 121 LMKIGVTPLDQTALIRPLMPSAGVLTSRQPSAAERADMEYGLQMAREIGRLDVGQTVVVK 180

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+ALE IEGTD+       C   G  LAG   V+ K  K QQD R D+P++G  T++
Sbjct: 181 DRAVMALEAIEGTDA-------CIRRGGQLAGGGAVVAKAAKPQQDSRFDVPAVGLDTIE 233

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +++ A  + +A+EA K+L ++KE     A+  GI +  +
Sbjct: 234 SLVAAKASALAIEADKTLFIDKERAIALAEANGITIAAM 272


>gi|170738984|ref|YP_001767639.1| hypothetical protein M446_0644 [Methylobacterium sp. 4-46]
 gi|168193258|gb|ACA15205.1| protein of unknown function DUF1009 [Methylobacterium sp. 4-46]
          Length = 280

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 142/283 (50%), Gaps = 24/283 (8%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           I+AG+G LP  VA A       P    +L    F       R     D   +R  L + +
Sbjct: 8   IVAGAGRLPLLVASALDAAG-RPF--RILAIRGFADPATRRRAHATVDLLDVRGALARLD 64

Query: 66  IGR---IVVAGAIDRRPNVQDLCFSI-----KDSLRISKMIWQLVSGGNAAILKASIDLL 117
             R   + +AGA+ R P+   L  ++     +D LR       L  GG+  +L+  + LL
Sbjct: 65  AWRPSGVTLAGAVSR-PSPAALLNTLAALRNRDELR------SLAQGGDDHLLRGVLALL 117

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E +G  ++G HE+ P L+   G LG   P+   +  +        +L+  DVGQ+A   G
Sbjct: 118 EEHGHRILGVHELAPGLMAPPGPLGARRPDAAAEISVATGRALLASLAAHDVGQAAAVAG 177

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNN----GRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
            RV+A+EG EGTD ML R+          GR  AG   VLVK+ KS QD+R DLP++G +
Sbjct: 178 RRVLAVEGPEGTDRMLARVRGLARRPLGLGRPPAGL--VLVKLAKSGQDLRVDLPAVGPR 235

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           TV+    AG AGIA+ AG +L+L++      AD  G+F+ G++
Sbjct: 236 TVRAAAAAGCAGIAVGAGDTLILDRGETAALADALGLFLIGLE 278


>gi|259416465|ref|ZP_05740385.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259347904|gb|EEW59681.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 262

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 127/267 (47%), Gaps = 13/267 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           +IAG G LP  +   ARL     V A   +E      D   R   LG F      L    
Sbjct: 4   LIAGRGALPAELI--ARLPERPMVCAMAGSEPDLAEADVTFRLEQLGSFL---EQLKSQG 58

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
           +  + +AGA+  RP +         +L +  ++   ++ G+   L+A I +LE  G +V 
Sbjct: 59  VTEVCLAGAV-TRPQIDPGAIDAA-TLPLVPVLQAAIAAGDDGALRAVIGILEQSGFAVK 116

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
            AHEI P+LL+  G      P    K D   A   A  LS  D+GQ+     G+ +A+E 
Sbjct: 117 AAHEIAPDLLMDEGVPTKVQPGEIDKADAERASVIAFGLSAADIGQACAVRSGQAIAIET 176

Query: 186 IEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAG 245
           + GTD ML  + +  +      G+ G+  K  K+ QD RADLP+IG  TV+    AGL G
Sbjct: 177 LFGTDWMLASLANRPD------GQGGLFYKAPKAGQDRRADLPTIGPATVEGAAMAGLNG 230

Query: 246 IALEAGKSLVLEKELVKKHADEAGIFV 272
           I LEA   +VL++E V    D  G+F+
Sbjct: 231 IVLEAEGVIVLDREEVIAACDRRGMFL 257


>gi|320108836|ref|YP_004184426.1| hypothetical protein AciPR4_3680 [Terriglobus saanensis SP1PR4]
 gi|319927357|gb|ADV84432.1| protein of unknown function DUF1009 [Terriglobus saanensis SP1PR4]
          Length = 293

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 138/282 (48%), Gaps = 14/282 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-------DFECRELPLGDFC 55
           +L +IAG+G  P+ +  AAR +    V+A++  E   +               + LG+  
Sbjct: 7   KLGLIAGNGRFPFLLLDAARARGIAVVVAAIHEETDPEMNARATADAGIRVHWMSLGELS 66

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASID 115
            L    H   + + V+AG +  +     +  +I+   +++K++  L +     +L A   
Sbjct: 67  KLIDTFHAEGVMQAVMAGQVRHK----QIFSAIRPDWKLAKLLMSLRTRNTDMLLGAVAK 122

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
           +L   G+ ++ +   +  +L + G L    P+ +  +DI   +  A  ++  D+GQ+ V 
Sbjct: 123 VLGDEGIELISSTAYLEPMLARAGVLTQRAPDEEELKDIAYGLTVARGIAGFDLGQTVVI 182

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRNNGRILAG---KSGVLVKMCKSQQDMRADLPSIGA 232
                VA+E +EGTD+ + R  +        A    +S  +VK+ K +QDMR D+P IG 
Sbjct: 183 AAQACVAIEAMEGTDATIARAGELFRTLEAEASTLRRSLTVVKVAKPKQDMRFDVPVIGL 242

Query: 233 KTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            T++ +I AG   +A+EAG++L+ ++  +   A+ AGI V G
Sbjct: 243 PTIEAMISAGATCLAIEAGRTLLFDEPALIARANAAGICVVG 284


>gi|296536114|ref|ZP_06898245.1| protein of hypothetical function DUF1009 [Roseomonas cervicalis
           ATCC 49957]
 gi|296263559|gb|EFH10053.1| protein of hypothetical function DUF1009 [Roseomonas cervicalis
           ATCC 49957]
          Length = 295

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 137/280 (48%), Gaps = 19/280 (6%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE------CRELPLGDFCVL 57
           L +I G G++P   A AA      P +  V+ E   D +D+       CR   LG    +
Sbjct: 14  LGMIVGGGLMPQRAAAAALAAGRRPHV--VVLEGFGDPRDYAAYPHIVCR---LGAAGRM 68

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
              L       +V+AG + +RP+   L      + R+   I     GG+ ++L A + +L
Sbjct: 69  LDWLRAAGCRDLVLAGQV-KRPSFLSLRPD-AGAARLLPRIGMKAFGGDDSLLNAVLRVL 126

Query: 118 ESYGVSVVGAHEIVPELLVQV-GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
              G   + A  ++ ELLVQ  G LG   P+    +DI   +     +   DVGQ  V  
Sbjct: 127 VEEGFRPLAAQTLLAELLVQAPGQLGLVAPDEQAAQDIRRGVFVLRRMGAADVGQGCVVQ 186

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
            G V+A+E IEGTD+ML R    R  G       GV VK+ K  QD R DLP+IG  T++
Sbjct: 187 QGLVLAVEAIEGTDAMLARAGTLRREG-----PGGVFVKILKPGQDRRVDLPTIGPDTIR 241

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            V +AGL G+A+EA  ++V+++      AD AG+F+  ID
Sbjct: 242 AVAEAGLRGLAIEAKGTIVIDRAETVAAADAAGLFLLAID 281


>gi|313895258|ref|ZP_07828815.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976153|gb|EFR41611.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 267

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 139/289 (48%), Gaps = 36/289 (12%)

Query: 1   MKRLLIIAGSGMLP-----------YYVAKAARLKNDEPVIASVLNECSFDWQDFECREL 49
           M+++ ++AG G LP           Y V   A L + +P +    N            E+
Sbjct: 1   MEKIGLLAGVGHLPAACARAARALGYEVHAVALLPDTDPELKDAANVY---------HEI 51

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFS---IKDSLRISKMIWQLVSGGN 106
            +G    + + L Q  I ++ + G + +     +L F+   + D + +  M+ QL +  +
Sbjct: 52  SIGQIASILAYLQQEEIKKVTMIGKVTK-----ELLFTGAIVPDEM-LRGMLMQLPNQND 105

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSE 166
             I+   +  L   GV+ +    ++  L+   G+L +  P+   +RD+   ++ A  +  
Sbjct: 106 DTIMMMFVGALMKIGVTPLDQTALIRPLMPAEGTLTSRAPSEAERRDMEFGLQMAREIGR 165

Query: 167 LDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRAD 226
           LDVGQ+AV     V+ALE IEGTD+       C   G  LAG   V+ K  K QQD R D
Sbjct: 166 LDVGQTAVVKDMAVMALEAIEGTDA-------CIRRGGQLAGSGAVVAKAAKPQQDSRFD 218

Query: 227 LPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +P++G  T+++++    + +A+EAGK+L ++KE     A+  GI +  +
Sbjct: 219 VPAVGLDTIESLVAVKASALAIEAGKTLFIDKERAVALAEANGITIAAL 267


>gi|288572983|ref|ZP_06391340.1| conserved hypothetical protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568724|gb|EFC90281.1| conserved hypothetical protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 275

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 141/279 (50%), Gaps = 24/279 (8%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFCVLR- 58
           +L ++AG G LP  + K      + PV+ ++      DWQD E      +P+ +  +++ 
Sbjct: 9   KLALVAGEGDLPLVILKNLVASGETPVVYAIRP----DWQDIEAYGVSVIPVKEINLVKI 64

Query: 59  --SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
             S++ +  I R+++AG + +     D   S      I  ++  L    + A+L A ID 
Sbjct: 65  FGSLVFR-RIKRLLLAGYVSKTVIYDDSADS-----EIKGIVAGLDDRNDHALLGAVIDR 118

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           +E  G+SV+G   I+P+++   G +    P+     D+         L  L  GQS V  
Sbjct: 119 VEKLGISVLGYDSILPDMIAPEGRIAGPEPSSSDLVDVDYGRAVLGRLLPLSFGQSLVVC 178

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              VVA+E +EGTD  ++R  D           +GVLVK  ++ QD R D+P +G KT+ 
Sbjct: 179 RRSVVAVEAMEGTDETVKRAGDISG--------AGVLVKGMRADQDRRYDIPVVGTKTLD 230

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           ++ ++GL+ +A+EAG  L++++E + + A   GI V G+
Sbjct: 231 SMSESGLSCLAVEAGNVLIMDREKLSEAASRLGISVIGV 269


>gi|282856199|ref|ZP_06265482.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
 gi|282585958|gb|EFB91243.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
          Length = 274

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 139/278 (50%), Gaps = 19/278 (6%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVL--NECSFDWQDFECREL--PLGDFCVLR 58
            L ++AG G LP  + KA   K   P    +L  N+  +  +    +++  P+    +L 
Sbjct: 5   HLALVAGEGALPLEILKAMIKKKAPPPKVYLLAENDAPYLEEGIAVQKIANPMAIAMIL- 63

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGN-AAILKASIDLL 117
           + +    I R+++AG + ++ N+    +S +   R +K I   V   N  ++L   +  +
Sbjct: 64  AKMRLMGIRRLMMAGGVPKK-NI----YSAEKLDRGAKSILSSVQDRNDHSLLAGIVKYI 118

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E +G+ V+   E++PELL   G +   VP+ +  +D    +     L  L  GQS V   
Sbjct: 119 EKFGIQVMSYEEVIPELLAPEGHIAGPVPDAEQLQDCEYGLSILRVLLPLSFGQSVVVSN 178

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             VVA+E +EGTD  ++R      +        G+L+K  ++ QD R DLP +G +T++N
Sbjct: 179 RAVVAVEAMEGTDEAVRRAASLSAH--------GILLKGMRADQDRRYDLPVVGVQTLRN 230

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +  +GL G+ +EAG  L+LEK+   + A+   I V G+
Sbjct: 231 MADSGLTGLFIEAGSVLLLEKDAFLQEAERLEISVTGV 268


>gi|99081244|ref|YP_613398.1| hypothetical protein TM1040_1403 [Ruegeria sp. TM1040]
 gi|99037524|gb|ABF64136.1| protein of unknown function DUF1009 [Ruegeria sp. TM1040]
          Length = 262

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/267 (33%), Positives = 127/267 (47%), Gaps = 13/267 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           +IAG G LP  +   ARL     V A   +E      D   R   LG F      L    
Sbjct: 4   LIAGRGALPAELI--ARLPERPMVCAMSGSEPDQVEADVTFRLEQLGSFL---EELKSKG 58

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
           I ++ +AGA+ R P +         +L +  ++   ++ G+   L+A I +LE  G  V 
Sbjct: 59  ITQVCMAGAVTR-PQIDPSAID-GATLPLVPVLQAAIAAGDDGALRAVIGILEQSGFEVK 116

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
            AHEI P+LL+  G      P    K D   A   A  LS  D+GQ+     G+ +A+E 
Sbjct: 117 AAHEIAPDLLMPEGVPTKVKPGEIDKADAERAAVIAFGLSAADIGQACAVRSGQAIAIET 176

Query: 186 IEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAG 245
           + GTD ML+ +    +      G+ G+  K  K+ QD RADLP+IG  TV    +AGL G
Sbjct: 177 LFGTDWMLESLAQRPD------GQGGLFYKAPKAGQDRRADLPTIGPATVAGAARAGLNG 230

Query: 246 IALEAGKSLVLEKELVKKHADEAGIFV 272
           I LEA   +VL++E V    D  G+F+
Sbjct: 231 IVLEAEGVIVLDREEVVAACDRHGLFL 257


>gi|260426988|ref|ZP_05780967.1| phosphatidate cytidyltransferase [Citreicella sp. SE45]
 gi|260421480|gb|EEX14731.1| phosphatidate cytidyltransferase [Citreicella sp. SE45]
          Length = 261

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 128/271 (47%), Gaps = 19/271 (7%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILH 62
           L +IAG G LP  VA+A+    + P+I ++          D   R   LG F      L 
Sbjct: 2   LALIAGQGALPRAVAEAS---TERPLICALEPHAPEGLTVDRSFRVERLGGFL---HWLR 55

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  + RI + G + +RP ++      + +L +  M   L  G + A L+  I LLE  G 
Sbjct: 56  RKGVRRICMCGRV-QRPELRLSRLDWRTALMLPAMRRALKRGDDGA-LRIVISLLEEQGF 113

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +VGAHE  P LL   G      P+   +   L   + +      D GQ+ V  G  ++A
Sbjct: 114 EIVGAHEAAPSLLPPEGVPTRAQPDEAARAAALLGDRVSAEQGARDFGQACVIRGTELLA 173

Query: 183 LEG-IEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
            E    GTD+M+  +            + GVL K  K  QD R DLP IG +T +  I+A
Sbjct: 174 REDDATGTDAMIDALT---------GAEGGVLYKAEKPGQDTRVDLPVIGPRTARGAIRA 224

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GLAGI + AG  +VL+++ V    DEAG+F+
Sbjct: 225 GLAGIVVSAGGVMVLDRDEVLSLLDEAGLFL 255


>gi|237744959|ref|ZP_04575440.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|256028417|ref|ZP_05442251.1| hypothetical protein PrD11_10579 [Fusobacterium sp. D11]
 gi|260494740|ref|ZP_05814870.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289766341|ref|ZP_06525719.1| conserved hypothetical protein [Fusobacterium sp. D11]
 gi|229432188|gb|EEO42400.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|260197902|gb|EEW95419.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289717896|gb|EFD81908.1| conserved hypothetical protein [Fusobacterium sp. D11]
          Length = 267

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 138/281 (49%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      S+     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISLYPIGLFPSVDEEIKKLDNYAEFNIGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   ++ +IV+ G ++++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDVTKIVMLGKVEKKLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLSGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISIGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           TV+N IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TVENAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|51246794|ref|YP_066678.1| hypothetical protein DP2942 [Desulfotalea psychrophila LSv54]
 gi|50877831|emb|CAG37671.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 286

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 137/281 (48%), Gaps = 33/281 (11%)

Query: 2   KRLLIIAGSGMLPYYVAKAARL-----------KNDEPVIASVLNECSFDWQDFECRELP 50
           +++ IIAG G  P    +AAR               +P +A   + C +         + 
Sbjct: 11  EKIGIIAGGGQFPLLFIEAARRAGRSVAVVAHRSETDPEVAKAADSCCW---------VK 61

Query: 51  LGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVS-GGNAAI 109
           LG    + S   +  +G  V  G I +     D+   ++     +  +W  +    + AI
Sbjct: 62  LGQLGKILSFFKKEGVGETVFVGTITKTRIFHDIMPDVR-----ALTLWNKIDIKQDDAI 116

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           L+A    LE  GV V+ +   + ELL   G+L     ++D ++D+    K+A A+  +D+
Sbjct: 117 LRAVAGALEKDGVKVLESTIYLQELLFPRGTLTAKSLSKDQRKDVEFGWKNARAIGAMDI 176

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPS 229
           GQ+ V     VVA+E IEGTD+ ++R       G  LA +  V+VK+ K  QD R DLP+
Sbjct: 177 GQTVVVRDCSVVAVEAIEGTDAAIKR-------GGELAREKAVVVKVRKPGQDFRFDLPA 229

Query: 230 IGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
            G +T+Q++     A +A+EAG+SL+ ++E +   AD AGI
Sbjct: 230 TGIQTIQSLASVKGAVLAVEAGQSLLFDREAMVAAADAAGI 270


>gi|163731904|ref|ZP_02139351.1| hypothetical protein RLO149_21409 [Roseobacter litoralis Och 149]
 gi|161395358|gb|EDQ19680.1| hypothetical protein RLO149_21409 [Roseobacter litoralis Och 149]
          Length = 263

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 137/269 (50%), Gaps = 17/269 (6%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD--WQDFECRELPLGDFCVLRSIL 61
           L ++ G G LP  VA A   ++ +P+I  VL+  + +    D   R   LG F    + L
Sbjct: 2   LALVTGRGGLPARVAAA---QSTQPLI-CVLDGFAPEGLTADITFRLEHLGSFM---AQL 54

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +  +  +   GAI+R P   D       +L +   + Q +  G+ A L+A + L E  G
Sbjct: 55  RERGVTAVCFCGAIERPPF--DPAALDGATLPLVPTLMQAMGAGDDAALRAVMALFEQQG 112

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             +  AH + P++L   G L    P+  ++ DI  A    +ALS +DVGQ  V   G+V 
Sbjct: 113 FEIAAAHVLAPDILAPEGVLSDAQPDAAMQADIARADAVLQALSPVDVGQGCVVGQGQVW 172

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
            +E I GTD +L  +       R       VLVK  K+ QD+RADLP+IG  TVQ   +A
Sbjct: 173 GIETIGGTDHLLTSLPTGVRGAR------AVLVKAPKTGQDVRADLPTIGPDTVQAAAEA 226

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGI 270
           GLAG+ ++AG+ ++LE +     A++AG+
Sbjct: 227 GLAGLIIQAGQVILLEPDATIAGANKAGL 255


>gi|296327501|ref|ZP_06870047.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155327|gb|EFG96098.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 267

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 138/281 (49%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDEEIKKIDNYTEFNIGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   +I +IV+ G ++++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDINKIVMLGKVEKKLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  ++  G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIKLSGIKVLPQSYLMKKFIFETKCYTEKKPDVDDEKTISIGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKR------AGQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           T++  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TIETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|195953384|ref|YP_002121674.1| protein of unknown function DUF1009 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932996|gb|ACG57696.1| protein of unknown function DUF1009 [Hydrogenobaculum sp. Y04AAS1]
          Length = 261

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 136/266 (51%), Gaps = 16/266 (6%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           +IAG+G LP    K A LKN + V    +N+ +    D      P+G    L   L + N
Sbjct: 5   LIAGAGELPEIFRKNA-LKNGDEVFTIGVNDITTIKSDIT---FPIGKLSKLVEFLKEKN 60

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
           + +IV+ G  + + ++    + IK    IS ++  L     ++I+KA I  +E  G+  +
Sbjct: 61  VEQIVMLGKFEHKLSLDPRDYDIK---AIS-ILASLKDRKPSSIVKAFIKFMEEEGLKFL 116

Query: 126 GAHEIVPELLVQV-GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
                + ELL++  G L     +++V  DI    K A+ ++++D+GQ+ V     VVA+E
Sbjct: 117 DPKPYLSELLIEKRGLLNDVELDKNVVEDIEFGAKIAKNIADMDIGQTVVVKQKAVVAVE 176

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            +EGTD  + R  D       +AGK  V++K  ++ QD R D+P++G  T+  + +    
Sbjct: 177 AMEGTDKTILRAFD-------IAGKGIVVIKSARTNQDFRIDVPTVGIDTLNTLKETKAK 229

Query: 245 GIALEAGKSLVLEKELVKKHADEAGI 270
            IA++ GK  VLEKE   K A+  GI
Sbjct: 230 AIAIQKGKVYVLEKEKFIKMANRFGI 255


>gi|34764132|ref|ZP_00145004.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|27886094|gb|EAA23398.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
          Length = 267

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 137/281 (48%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDDEIKKLDNYAEFNVGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   ++ +IV+ G +++R   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDVTKIVMLGKVEKRLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLSGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISLGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           TV+  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TVETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|19703931|ref|NP_603493.1| hypothetical protein FN0596 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|19714103|gb|AAL94792.1| Hypothetical protein FN0596 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 267

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 138/281 (49%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDEEIKKIDNYTEFNIGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   +I +IV+ G ++++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDINKIVMLGKVEKKLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  ++  G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIKLSGIKVLPQSYLMKKFIFETKCYTEKEPDIDDEKTISIGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKR------AGQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           T++  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TIETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|329889369|ref|ZP_08267712.1| hypothetical protein BDIM_10510 [Brevundimonas diminuta ATCC 11568]
 gi|328844670|gb|EGF94234.1| hypothetical protein BDIM_10510 [Brevundimonas diminuta ATCC 11568]
          Length = 279

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 139/276 (50%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAGSG LP  VA+    +  E  I  +          +  ++  + +   +   + 
Sbjct: 6   KLALIAGSGDLPIRVAQRCEAEGREVFIIRLKGFADAHLHRWPGQDFGMAEIGKIVKAMR 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 + +AG ++R P+ + L   +K +  +  +I    S G+ A+L+  + + E  G 
Sbjct: 66  AEGCRAVCLAGYVNR-PDFKTLKPDLKGASLLPGII-AAASKGDDALLRKILSVFEDEGF 123

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V GA +I+   ++  G+LG   P  +   D+  A+  AE   ELD+GQ AV   G V+A
Sbjct: 124 AVEGADDILGGEMLAAGALGHVTPTAEQLADLKKALHIAEKSGELDIGQGAVVCDGLVLA 183

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E  EGTD ML+R+     + R   G + G L K  K  QD+R D+P IG  TV+    A
Sbjct: 184 VEAQEGTDEMLRRVASLPVDLRGSPGFARGALGKAPKPIQDLRVDMPVIGPTTVELAAAA 243

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGI    G+ +V++ E + + AD  G+FV G  R
Sbjct: 244 GLAGIGGFEGRLIVIDHEGLVEAADRLGLFVWGEPR 279


>gi|254459479|ref|ZP_05072895.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206676068|gb|EDZ40555.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 266

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 134/280 (47%), Gaps = 19/280 (6%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEP-VIASVLNECSFDWQDFECREL-PLGDFCVLR 58
           M RL I++G+G LP       RL + +P  I       + D Q     E+        L 
Sbjct: 1   MSRLAILSGNGALPQ------RLADAQPDAILVSFAGVAHDLQ--RASEVHAFEKMGTLF 52

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLR--ISKMIWQLVSGGNAAILKASIDL 116
           + L   N+  IV+AGA+ R P    L  S  D++   ++  +   + GG+ A+L+  I +
Sbjct: 53  ASLKAQNVSEIVMAGAMSRPP----LDPSAFDAVMTGLAPRLIAAMQGGDDALLRLVIAI 108

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            E  G  V GAHEI P L V  G L     +     D+   +   E LS +DVGQ  V  
Sbjct: 109 FEEQGFRVRGAHEIDPTLTVDAGLLCGAALSEITGNDVAKGIAILETLSPMDVGQGVVVE 168

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
            G  + +E ++GTD++L  +     + R +    GV VK  K  QD+R D+P+IG  T+ 
Sbjct: 169 NGLCLGIETLQGTDALLNFVAATPLHLRKM---GGVFVKAPKRGQDLRVDMPTIGPDTIT 225

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            +  AGL+ + + +G  L+LE +   + A +A I V   D
Sbjct: 226 AMKTAGLSTLVIASGAVLLLECDDTIRLAKQANITVFARD 265


>gi|218779639|ref|YP_002430957.1| hypothetical protein Dalk_1792 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761023|gb|ACL03489.1| protein of unknown function DUF1009 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 275

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 135/274 (49%), Gaps = 13/274 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFE-CRELPLGDFCVLRSILHQ 63
           I+AG+G  P   A+AAR    +   A+  NE   D  Q+ +    + +G+   +     Q
Sbjct: 10  IVAGNGQFPLLFARAARKAGMQVYAAAHTNETEEDLAQETDGILWVKIGELQKIMDFFLQ 69

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
            N+ + V+ G I +   + D      D+L +  +   + + G+  +L+A    +E +G+ 
Sbjct: 70  NNVTKAVMLGGITKARLMSDFA---PDALALEALA-SIDATGDDMVLRAVAQAVEKHGIQ 125

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+ A  I+P LL   G      P      DI    +  + +  LD+GQ  +   G V+ +
Sbjct: 126 VIAATSILPHLLAPEGVWTQRQPTEQEAADIKLGHELLQKIGPLDIGQCLILTRGSVICV 185

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD+ ++R  +       L   + V+VKM K  QD R DLP+ GAKT++N+I  G 
Sbjct: 186 EAIEGTDAAIKRAGE-------LEASNAVVVKMPKPNQDHRFDLPAAGAKTIENMIPNGC 238

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
             +AL AG ++V ++E + + AD   I +  I+ 
Sbjct: 239 TALALAAGAAVVFDREAMVELADSHNIAIVAINN 272


>gi|206890962|ref|YP_002247941.1| hypothetical protein THEYE_A0089 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742900|gb|ACI21957.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 269

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 137/280 (48%), Gaps = 24/280 (8%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-----FECRELPLGDFCVLRSI 60
           +IAG G LP  V    + K    VI   L   + D        FE   + +G    +   
Sbjct: 5   VIAGGGCLPLIVTNELK-KRGYKVITVALEGLADDALSNHSDVFES--INIGKAGQIIDF 61

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCF---SIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
           L   N+  +++ G + ++     L F   +IK  +R  KM++     G+  +LK     L
Sbjct: 62  LKNNNVKEVILTGKVPKK-----LIFERKTIKPDMRALKMLFSAKIRGDNELLKLVEKEL 116

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
            + G+ +    E  PEL+   G L    P ++  +DI    K A+ + ELD+GQ+ V   
Sbjct: 117 LTEGIKIAEISEFCPELITPEGVLTRKKPTKEEWKDIEYGFKIAKKIGELDIGQTVVVKE 176

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+A+E IEGTD  + R       GR +  K+ ++VK+ K QQD+R D P+ G  T+  
Sbjct: 177 RSVIAVEAIEGTDETILR------AGRFV--KNSIVVKVSKPQQDLRLDPPAAGVDTIVI 228

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           + KA    +ALEAGK+ ++E++ + + A+E  I V G+ +
Sbjct: 229 MGKANAKILALEAGKTFLIERDKLIEKANEINIIVVGVKQ 268


>gi|291278543|ref|YP_003495378.1| hypothetical protein DEFDS_0110 [Deferribacter desulfuricans SSM1]
 gi|290753245|dbj|BAI79622.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 271

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 132/272 (48%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRSILHQ 63
           ++AG G LP       +    E V  +   E + D      +  +  +G    +   L +
Sbjct: 5   VLAGYGNLPLIAINNLKAMGHEVVTIAFNEEINTDLSGVSDKIYKFSVGQAKKVLDTLEK 64

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  ++ AG I++     +L F   D   + K++  L    +  I+   ++LLE  G++
Sbjct: 65  ERVESVLFAGKINKSLLYSNLKF---DMFSV-KLLMSLKDRKDDTIMLKIVELLEERGIT 120

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+   ++  +LLV+ G L    P      DIL   K A+ +  +D+GQ+ V     V+A+
Sbjct: 121 VLKQTDVFKDLLVEEGVLTKMKPTGQEMEDILFGFKVAKEIGRVDIGQTVVVKNKAVMAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD  ++R      NG       GV+VK+ K  QD+R D+P++G  T++N+     
Sbjct: 181 EAIEGTDEAIKRGCKYAKNG-------GVIVKVSKPCQDLRFDVPTVGIDTLKNIKDNKG 233

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             +ALEA K+ V++K+   K A++  I + GI
Sbjct: 234 KILALEANKTFVVDKDECVKFANKNKIVIVGI 265


>gi|294785776|ref|ZP_06751064.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
 gi|294487490|gb|EFG34852.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
          Length = 267

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 137/281 (48%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      S+     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISLYPIGLFPSVDEEIKKLDNYAEFNIGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   ++ +IV+ G +++R   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDVTKIVMLGKVEKRLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLSGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISLGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           TV+  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TVETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|159044052|ref|YP_001532846.1| hypothetical protein Dshi_1503 [Dinoroseobacter shibae DFL 12]
 gi|157911812|gb|ABV93245.1| conserved hypothetical protein DUF1009 [Dinoroseobacter shibae DFL
           12]
          Length = 265

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 122/218 (55%), Gaps = 12/218 (5%)

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           + +  I  +  AGA+ +RP V+ +      SL +   + +++  G+  +L+  I + E  
Sbjct: 56  MRKAGITEVCFAGAM-QRPKVE-MGKLHPLSLPLVPRLMKVIGDGDDRLLREVIAIFEEA 113

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEAL---SELDVGQSAVSIG 177
           G+ V+GAH+I P LL   G+LG   P+  ++ +   A + AE L     LD+GQ  V  G
Sbjct: 114 GLRVLGAHDIAPGLLAPKGALGDVAPSETLRAE---AARGAEILRVTGPLDIGQGCVVAG 170

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G  +A+E + GTD+ML+ +   R +     G  GVLVK  K  QD+R D+P+IG  TV  
Sbjct: 171 GLCLAIETLPGTDAMLRFVAQTRPD----PGPGGVLVKRAKPGQDLRIDMPAIGPDTVAA 226

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
              AGLAGI L+AG  L+L+++  +  AD AGI + G+
Sbjct: 227 AQAAGLAGIVLQAGHILILDRDATRTAADAAGIAIWGV 264


>gi|83953539|ref|ZP_00962260.1| hypothetical protein NAS141_04928 [Sulfitobacter sp. NAS-14.1]
 gi|83841484|gb|EAP80653.1| hypothetical protein NAS141_04928 [Sulfitobacter sp. NAS-14.1]
          Length = 263

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 128/265 (48%), Gaps = 15/265 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILH 62
           L +IAG G LP  VA A     D P+I +           D   R   LG    L + L 
Sbjct: 2   LALIAGGGGLPQRVAGA---LADAPLICAYEGTTPVGLVPDLVFRLETLG---TLLAELT 55

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + ++   GA+  RP+          +L +  +  Q ++ G+   L+A +D+ ++ G+
Sbjct: 56  ARGVTQVCFCGAV-ARPSFDPSKLDAA-TLPLVPVFQQALAAGDDGALRALVDIFQTAGL 113

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +VV AH++ P+L+ + G L    P+  ++ D          L+ +DVGQ  V   G+V+ 
Sbjct: 114 TVVAAHDLAPDLMAREGVLSQRQPDAQMRDDAARGAALVRCLAPMDVGQCCVVGQGQVMG 173

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E I GTD +L  + D   +       S VL K  KS Q    D+P+IG  T++   +AG
Sbjct: 174 IEAIGGTDHLLSTLPDRARS------ASAVLFKGPKSGQSHLVDMPTIGPDTLRRAHEAG 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADE 267
           LAG+ +EAG  ++LE +     ADE
Sbjct: 228 LAGVVIEAGSVILLEPDACVALADE 252


>gi|260575876|ref|ZP_05843871.1| protein of unknown function DUF1009 [Rhodobacter sp. SW2]
 gi|259021802|gb|EEW25103.1| protein of unknown function DUF1009 [Rhodobacter sp. SW2]
          Length = 268

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 114/212 (53%), Gaps = 4/212 (1%)

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    + R+V AGA+ +RP +    F    +  + +++  +  GG+ A L+A + + E  
Sbjct: 57  LEDSGVTRVVFAGAV-QRPRLDPALFDAATAQMVPRLLGAM-QGGDDAALRAVVGVFEEA 114

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V+GA +I P L+   G +    P    +RD   A +   AL  +DVGQ AV   G  
Sbjct: 115 GFQVLGAADIAPALVPGAGVI-CGQPTPADERDAARAAQIVAALGAVDVGQGAVVAQGLC 173

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E + GTD+ML+ +          A K G+L K  K  QD+R DLP++G +TVQ    
Sbjct: 174 LAVESLPGTDAMLEFVAATAQRPNPAAAK-GLLYKAPKPGQDLRIDLPTLGVQTVQKAAA 232

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           AGLAGI  +AG  +VL+   ++  A+ AG+F+
Sbjct: 233 AGLAGIVWQAGGVIVLQPAAMQAAAEAAGLFL 264


>gi|183221443|ref|YP_001839439.1| hypothetical protein LEPBI_I2061 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189911531|ref|YP_001963086.1| hypothetical protein LBF_2008 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167776207|gb|ABZ94508.1| conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779865|gb|ABZ98163.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 288

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 138/276 (50%), Gaps = 18/276 (6%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCV--LRSI 60
           RL IIAG G LP+   K A L  ++P+   ++ E  F  +  E R +P+    V  +   
Sbjct: 6   RLAIIAGDGELPHIGMKEALLAGEDPLFLGLI-ESDFSPRGQESRTIPVHITQVGKILKT 64

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFS-IKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           + +  I RI++ G + +     DL F  +K  L+   ++ + ++  +  I  A  +  E+
Sbjct: 65  IQKEKISRILMLGKVRK-----DLLFQKLKFDLKALSILARTINRNDYPIFLAIAEEFEA 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            GV V+     +  LL+  G       +    +DI+  M+ AE +++LD+GQ  V     
Sbjct: 120 MGVKVISQKIYLKSLLLPEGRYTPKKFSTQELKDIMFGMEYAEKMADLDIGQMVVVSDES 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSG--VLVKMCKSQQDMRADLPSIGAKTVQN 237
           V+A+E +EGTD  ++R       G +   K G  V+ K  K++QD R DLP+IG  T Q 
Sbjct: 180 VIAVEAVEGTDETIRR-------GGLYTKKKGDAVVCKSPKTKQDERFDLPTIGIHTFQV 232

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           ++++G   + +  G++LV+  + V + A +  +  C
Sbjct: 233 MLESGCKTLCIREGETLVVNPKEVIEFATKHKLNFC 268


>gi|301057977|ref|ZP_07199034.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300447944|gb|EFK11652.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 272

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 137/273 (50%), Gaps = 16/273 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVL---NECSFDWQDFECRELPLGDFCVLRSILH 62
           +IAG G  P  VA AAR K+   V+A       + +   +  E   + LG    L     
Sbjct: 10  LIAGGGQFPLLVADAAR-KHGTRVVAVAHQGETDSALSEKVDEIAWIKLGQLGQLIKTFK 68

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           ++++ + ++AG+I ++       F ++  L+   ++ +L    +  IL++        G+
Sbjct: 69  KFDVTKALMAGSIAKKK-----MFEMRPDLKGLAIMSKLAIFHDDDILRSVTAEFAKEGI 123

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +V +   +P+LL   G L    P ++  +DI    K A+ L  LD+GQS V     V+A
Sbjct: 124 EIVSSTLFLPDLLAPEGCLTKRAPTKNEWKDIRFGWKIAKELGRLDIGQSVVVRKKTVLA 183

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LE I+GTD+ + R       G  LA +  V+VK+ K +QD+R D+P +G +T+  + +  
Sbjct: 184 LEAIDGTDATILR-------GGALAKEKAVVVKVSKPKQDLRFDVPCVGMETIAVMKRVK 236

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            A +A+EAG +L+ ++  +   AD+  I V  +
Sbjct: 237 GAVLAVEAGHTLIFDRSEMVAAADKEKIAVVAV 269


>gi|237741613|ref|ZP_04572094.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|229429261|gb|EEO39473.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
          Length = 267

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 137/281 (48%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDDEIKKLDNYAEFNVGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   ++ +IV+ G +++R   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDVTKIVMLGKVEKRLIFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+    ++ + + +        P+ + ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLSGIKVLPQSYLMKKFIFETKCYTEKEPDFNDEKTISLGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           TV+  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TVETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|329121354|ref|ZP_08249980.1| protein of hypothetical function DUF1009 [Dialister micraerophilus
           DSM 19965]
 gi|327469763|gb|EGF15229.1| protein of hypothetical function DUF1009 [Dialister micraerophilus
           DSM 19965]
          Length = 275

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 141/282 (50%), Gaps = 13/282 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCV--LR 58
           M RL ++AG G LP+   + A+ +  E V  +V+ +     + +  +   +  F +  + 
Sbjct: 1   MARLGLLAGVGTLPFEFVQTAKKQGHEIVCIAVVPDVDTRLRSYSDKYFEINVFKLNKIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQL--VSGGNAAILKASIDL 116
             L + N+  + + G + +   +      I D LR  K++ +L  +   +  I+ A +D 
Sbjct: 61  KTLCEANVKEVTMLGKVTKE-YLYKRKLVIPD-LRTVKILNKLRKLDFKDDTIMLALVDE 118

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G+ V+   + +  L+         +P+ +   DI    K+A+ + ++D+GQ+ V  
Sbjct: 119 LEGSGLKVMDQTKYLKPLMPPPQIFTHAMPSEEQMDDIAFGFKTAKLIGQMDMGQTVVVK 178

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+       C   G  LAGK  V+VK+ K  QD R D+P++G  T+ 
Sbjct: 179 DKAVMAVEAIEGTDA-------CIRRGGKLAGKGAVVVKVAKPNQDPRFDVPAVGLDTLN 231

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            +I+     +A+EA K+L +++  V   ADE  I +  +++E
Sbjct: 232 AMIETKCKVLAIEAEKTLFVDRFDVMDKADEHDIVIVSVNQE 273


>gi|313892335|ref|ZP_07825927.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
 gi|313119194|gb|EFR42394.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
          Length = 275

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 141/282 (50%), Gaps = 13/282 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCV--LR 58
           M RL ++AG G LP+   + A+ +  E V  +V+ +     + +  +   +  F +  + 
Sbjct: 1   MARLGLLAGVGTLPFEFVQMAKKQGHEIVCIAVVPDVDTRLRSYSDKYFEINVFKLNKIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQL--VSGGNAAILKASIDL 116
             L + N+  + + G + +   +      I D LR  K++ +L  +   +  I+ A +D 
Sbjct: 61  KTLCEANVKEVTMLGKVTKE-YLYKRKLVIPD-LRTVKLLNKLRKLDFKDDTIMLALVDE 118

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G+ V+   + +  L+         +P+ +   DI    K+A+ + ++D+GQ+ V  
Sbjct: 119 LEGSGLKVMDQTKYLKPLMPPPQIFTHAMPSEEQMDDIAFGFKTAKLIGQMDMGQTVVVK 178

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+       C   G  LAGK  V+VK+ K  QD R D+P++G  T+ 
Sbjct: 179 DKAVMAVEAIEGTDA-------CIRRGGKLAGKGAVVVKVAKPNQDPRFDVPAVGLDTLN 231

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            +I+     +A+EA K+L +++  V   ADE  I +  +++E
Sbjct: 232 AMIETKCKVLAIEAEKTLFVDRFDVMDKADEHDIVIVSVNQE 273


>gi|237740034|ref|ZP_04570515.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229422051|gb|EEO37098.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 267

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/279 (28%), Positives = 137/279 (49%), Gaps = 24/279 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G LP Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKLPLYFIEEAKNSN-----ISVYPIGLFPSVDEEIKKSDNYAEFNVGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG-NAAILKAS 113
             +   L   +I +IV+ G I+++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLNDITKIVMLGKIEKKLIFENLILD-----KYGEKIMEIVPDKKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  L   G+ V+  +  +  L+ +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFLRLNGIKVLPQNYSMKRLIFEAKCYTERHPDADDEKTISMGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDKAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMSRPQQDMRVDVPVIGLH 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           TV+  I+ G  GI  +A K + L ++   + A++  IF+
Sbjct: 224 TVETAIQNGFKGIVAQAKKMIFLNQKECIELANKNNIFI 262


>gi|110679827|ref|YP_682834.1| hypothetical protein RD1_2597 [Roseobacter denitrificans OCh 114]
 gi|109455943|gb|ABG32148.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 263

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 127/267 (47%), Gaps = 13/267 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +I G G LP  VA A   +    V+     E   D  D   R   LG F    + L +
Sbjct: 2   LALITGRGGLPARVAAAQTARPLVCVLEGFAPE-GLD-ADITFRLEHLGSFI---AQLKE 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +   GAI+R P   D       ++ +   + Q +  G+ A L+A + L E  G  
Sbjct: 57  RGVTSVCFCGAIERPPF--DPAALDGATVPLVPTLMQAMGAGDDAALRAVMALFEQQGFE 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  AH + P++L   G L    P+  ++ DI  A    +ALS +DVGQ  V   G V  +
Sbjct: 115 IAAAHVLAPDILAPEGVLSEAQPDTQMQADIARADDVLQALSPVDVGQGCVVGQGLVWGI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  +       R       VLVK  K+ QDMRADLP+IG  TV+    AGL
Sbjct: 175 ETIGGTDHLLATLPTAVRRAR------AVLVKAPKTGQDMRADLPAIGPDTVEAAGAAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGI 270
           AGI ++AG  ++L+ E     A++ G+
Sbjct: 229 AGIVIQAGAMILLDPEATIAGANKTGL 255


>gi|163747142|ref|ZP_02154498.1| hypothetical protein OIHEL45_12300 [Oceanibulbus indolifex HEL-45]
 gi|161379703|gb|EDQ04116.1| hypothetical protein OIHEL45_12300 [Oceanibulbus indolifex HEL-45]
          Length = 266

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 129/273 (47%), Gaps = 21/273 (7%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSIL 61
           L +IAG G LP  VA A      EP +  V    + D    D   R   LG       + 
Sbjct: 3   LALIAGRGGLPARVAAA----QAEPPLVCVYEGSAPDGLKADLTFRLETLGSI-----LA 53

Query: 62  HQYNIG--RIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           H   +G   + + GAIDR P +      ++ +  + +    L +G N A L+    + E 
Sbjct: 54  HLLGVGIREVCLCGAIDR-PTLDPAKLDMRTAPLVPQFKQALAAGDNGA-LEVIKTIFED 111

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           +G+ VVGA E+VP+LL   G L   +P+  ++RD          L+ LD+GQ+ V    +
Sbjct: 112 HGLRVVGADELVPDLLSDSGVLSRELPDEQMRRDAARGAAVLGGLAALDIGQACVIGREQ 171

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V  +E I GTD +L  + +     R       VL K  K+ Q    DLP+IG  T++   
Sbjct: 172 VYGVETIGGTDHLLATLPEAVGAAR------AVLCKGPKAGQIREIDLPTIGPDTLRAAH 225

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
            AGLAG+ + AG  ++LE++     ADE G+ +
Sbjct: 226 AAGLAGVVVTAGGVMLLERDTCVALADELGLVL 258


>gi|254304239|ref|ZP_04971597.1| hypothetical protein FNP_1910 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324431|gb|EDK89681.1| hypothetical protein FNP_1910 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 267

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 137/281 (48%), Gaps = 24/281 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDEEIKKLDNYAEFNIGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV-SGGNAAILKAS 113
             +   L   +I +IV+ G ++++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLRDITKIVMLGKVEKKLVFENLILD-----KYGEKIMEIVPDNKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLSGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISMGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+K+ + QQDMR D+P IG  
Sbjct: 171 VCRDRAVIAVEGIEGTDETLKR------AGQ-YSDKDNILIKVSRPQQDMRVDVPVIGLN 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           T++  IK G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 224 TIETAIKNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|94971580|ref|YP_593628.1| hypothetical protein Acid345_4554 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553630|gb|ABF43554.1| protein of unknown function DUF1009 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 301

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 136/277 (49%), Gaps = 12/277 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF---ECRELPLGDFCVLR 58
           KRL +IAG+G  P  +  AAR    E V+A++  E   + +         + LG+   L 
Sbjct: 8   KRLGLIAGNGKFPILILDAARAHGAEVVVAAIKEETFPEIEQHGAAAVHWMSLGELSKLI 67

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
               +  +   ++AG +  +     +  SI+   +++K++  L +    +++ A   +L 
Sbjct: 68  ETFQKEGVSEAIMAGQVKHK----QIFSSIRPDWKLAKLLMSLGTRNTDSLIGAVAKVLS 123

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G++++ +  ++  LL + G L T  P      +I      A  LS  D+GQ+ V    
Sbjct: 124 DEGITLLDSTSLLEPLLAKEGVLTTRQPTDQELTNITYGRAVAHHLSRFDIGQTVVIAEA 183

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRI-----LAGKSGVLVKMCKSQQDMRADLPSIGAK 233
             VA+E +EGTD+ + R  +   +  +       G+   +VK+ K  QDMR D+P IG +
Sbjct: 184 ACVAVEAMEGTDATILRAGELLTSPSLGEKPSTLGRELTVVKVAKPNQDMRFDVPVIGLR 243

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
           +V+ + KA    +AL+AGK L+L+ + V   AD AGI
Sbjct: 244 SVETMRKANATCLALDAGKCLLLDGQAVIDAADAAGI 280


>gi|289523521|ref|ZP_06440375.1| putative phosphatidate cytidyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503213|gb|EFD24377.1| putative phosphatidate cytidyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 271

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 135/278 (48%), Gaps = 19/278 (6%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC----SFDWQDFECRELPLGDFCVL 57
           K + +IAG G LP  +A+    K   PV+ S          +  +      L LG    L
Sbjct: 7   KTIALIAGDGQLPLEIARRLTCKGCPPVVYSFGEHAGRLSKYALELVRLSGLSLG---FL 63

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
              +    I  I++AG +   P        ++DS ++ +++ +L S  +  +L   +   
Sbjct: 64  FDDMRSRGIKEIIMAGVV---PKTLMYHQGLQDS-KLRQLLKKLHSRDDHNLLANIVSAF 119

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G  VVG  +++ + L   G +       +   D+    K A+ L  L  GQ+ V   
Sbjct: 120 EVSGFLVVGYRDLISDWLATEGHIAGRYVTEEELDDVNYGRKVAKVLLPLSFGQTLVIHK 179

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             VVA+E +EGTD+ML R       G +  G  G+++KM +  QD R DLP++G KT+QN
Sbjct: 180 RAVVAVEAMEGTDAMLLR------AGSLTRG--GIVLKMMRPDQDERYDLPTVGIKTLQN 231

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +  AGL  +A+EA +++++E +  K++A+   I V G+
Sbjct: 232 MSNAGLKCLAIEADRTIIIEPDEFKRYAESFDIAVLGV 269


>gi|269797600|ref|YP_003311500.1| hypothetical protein Vpar_0537 [Veillonella parvula DSM 2008]
 gi|269094229|gb|ACZ24220.1| protein of unknown function DUF1009 [Veillonella parvula DSM 2008]
          Length = 278

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 137/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   E V+  V+ +   +   +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDIGVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEEVQELTMLGKVTKEILFKGLTFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTAYLKPFMPKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD        C   G  L     ++VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AVMAIEAIEGTDK-------CILRGGELGRGDAIVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   AD  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDMADRHGIVICAVDQEF 271


>gi|320353430|ref|YP_004194769.1| hypothetical protein Despr_1314 [Desulfobulbus propionicus DSM
           2032]
 gi|320121932|gb|ADW17478.1| protein of unknown function DUF1009 [Desulfobulbus propionicus DSM
           2032]
          Length = 283

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 132/272 (48%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSILHQ 63
           +IAG G  P   A+AAR +    V  + +NE + + +D       + LG    +     +
Sbjct: 13  LIAGGGQFPLLFAEAARARGRRVVAIAHVNETAIEIEDRADAVYWVKLGQLGKIIKHFKR 72

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +G  V AG I +     D+   +K     SK+  +L    + AIL+A    +E  G+ 
Sbjct: 73  EGVGETVFAGTITKTRIFHDILPDLKGLSLWSKIDRRL----DDAILRAVAASMEEEGIR 128

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+ +   +  L    G L    P+ +   DI    K A  +  LD+GQ  V     V+A+
Sbjct: 129 VLASTCYLEHLFFPKGLLSRKKPSAEQMEDIRFGWKVAREVGRLDIGQCVVVRDRSVLAV 188

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD+ ++R       G  LAG   V+VK+ K  QD R DLP+ G +T+  +     
Sbjct: 189 EAIEGTDAAIRR-------GGELAGSGAVVVKLKKPNQDFRFDLPATGPRTIDTLAAVKG 241

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           A +A+EAG+SL+ ++  + + AD AG+ V G+
Sbjct: 242 AVLAVEAGQSLLFDRTAMVEAADRAGLVVVGL 273


>gi|322434320|ref|YP_004216532.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX9]
 gi|321162047|gb|ADW67752.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX9]
          Length = 288

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 129/266 (48%), Gaps = 14/266 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-------FECRELPLGDFC 55
           RL +IAG+G  P+ +  AAR    + V+A++  E   +  +            + LG+  
Sbjct: 9   RLGLIAGNGRFPFLLLDAARAHGLDVVVAAIKEETDVEMDERAALDAGVRVHWMSLGELS 68

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASID 115
            L        + R V+AG +  +     +  SI+   R++K++  L +     +L A   
Sbjct: 69  KLIETFRAEGVTRAVMAGQVKHK----QIFSSIRPDWRLAKLLLNLRTRNTDMLLGAVAK 124

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
           +L   G+ ++ +   +  LL  VG +G  +P  D ++DI   M  A  ++  D+GQ+ V 
Sbjct: 125 VLGDEGIELISSTAYLEPLLATVGVMGARMPTEDERKDIEYGMTVARGIAGFDLGQTVVV 184

Query: 176 IGGRVVALEGIEGTDSMLQR---IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGA 232
                VA+E +EGTD+ + R   +     +G     ++  +VK+ K  QDMR D+P +G 
Sbjct: 185 AAQACVAVEAMEGTDATIARAGELFRTLGDGDATLSRALTVVKVAKPNQDMRFDVPVVGV 244

Query: 233 KTVQNVIKAGLAGIALEAGKSLVLEK 258
            T+  +  AG   + +EAG++L+ ++
Sbjct: 245 PTIAAMKDAGATCLCVEAGRTLLFDR 270


>gi|304570500|ref|YP_002502.2| hypothetical protein LIC12578 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 282

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 129/264 (48%), Gaps = 14/264 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M +L I+AG+G LP+   K A L  ++P+  S++ E  F    +E R +P+       L 
Sbjct: 1   MGKLGILAGAGELPHIGMKEALLAGEDPIFFSII-ESDFHVGMYEDRNIPIHIVKIGTLL 59

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +  ++N+ R+++ G + +    ++L F +K    +++MI +     + +I K   D   
Sbjct: 60  KLCKRHNVDRLLLLGKVKKEIIFKNLKFDLKAIALLARMINK----HDYSIFKTVADEFA 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              ++++     +  L +  G        +    DI   M  AE ++ LD+GQ+ V +  
Sbjct: 116 KEKITIISQKTFLQSLFLPEGRFTKKPLTQKELEDIAFGMDYAEKMAGLDIGQTVVVLDK 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTD     +  CR       GK+ V  K  K  QD R DLP++G  T++ +
Sbjct: 176 SVLAVEAVEGTD-----LAICRGGSFAKKGKATV-CKSSKPNQDHRFDLPTVGENTLKTM 229

Query: 239 IKAGLAGIALEAGKSLVLE-KELV 261
            +     +AL  G+++++  KE +
Sbjct: 230 YENNCGTLALRTGETIIVHPKEFI 253


>gi|294782875|ref|ZP_06748201.1| conserved hypothetical protein [Fusobacterium sp. 1_1_41FAA]
 gi|294481516|gb|EFG29291.1| conserved hypothetical protein [Fusobacterium sp. 1_1_41FAA]
          Length = 267

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 136/279 (48%), Gaps = 24/279 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G  P Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSN-----ISVYPIGLFPSVDEEIKKLDNYAEFNVGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG-NAAILKAS 113
             +   L   +I +IV+ G I+++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLNDITKIVMLGKIEKKLIFENLILD-----KYGEKIMEIVPDKKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+  + ++   + +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLNGIKVLPQNYLMKRFIFEAKCYTEKEPDADDEKTISMGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDKAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMSRPQQDMRVDVPVIGLH 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           TV+  I+ G  GI  +A K + L ++   + A++  IF+
Sbjct: 224 TVETAIQNGFKGIVAQAKKMIFLNQKECIELANKNNIFI 262


>gi|254421053|ref|ZP_05034777.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196187230|gb|EDX82206.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 279

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 135/276 (48%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAG G LP  VA     +     I  +    +     +   E  +     +   L 
Sbjct: 6   KLGLIAGGGDLPAAVAARCDAEGRPVFIIRLAGFAAPHLTRWPGAEFGMAQIGAILKALK 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 + +AG ++R P+ + L    K +  +  ++    + G+ A+L+  + + E+ G 
Sbjct: 66  AEACTTVCLAGIVNR-PDFKSLKPDFKGATLLPGIV-AAATQGDDALLRKILSVFEAEGF 123

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V GA +++    +  G+LG   P  D   D+  A+  AE   ELD+GQ AV   G V+A
Sbjct: 124 AVEGADDVLGGETLASGALGAVSPTPDQIADLKKALHVAEKSGELDIGQGAVVCDGLVLA 183

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E  EGTD+ML R+     + R  A    G L K  K  QD+R D+P IG +TV+    A
Sbjct: 184 VEAQEGTDAMLHRVAGLPADLRGSASAPKGALGKAPKPIQDLRVDMPVIGPRTVELAAAA 243

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGIA   G+ +++++  +   AD  G+FV G DR
Sbjct: 244 GLAGIAGVTGRLILIDRPAIVAAADRLGLFVWGEDR 279


>gi|320101871|ref|YP_004177462.1| hypothetical protein Isop_0318 [Isosphaera pallida ATCC 43644]
 gi|319749153|gb|ADV60913.1| protein of unknown function DUF1009 [Isosphaera pallida ATCC 43644]
          Length = 328

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 140/279 (50%), Gaps = 23/279 (8%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           +++ ++AGSG  P   A+AAR +  E     +  E + +     C          + S++
Sbjct: 38  RKIGLLAGSGRFPILFAEAARRQGLEVYCVGIRYEAADELVPL-CARFEWVSVTRMNSMI 96

Query: 62  HQYN---IGRIVVAGAIDRRPNVQDLCFSIKDSLRI-----SKMIWQ-LVSGGNAAILKA 112
             +    I  +V+AG +     ++++ ++    LR+     +   W+ L    +  +L +
Sbjct: 97  QAFQRMGIDEVVMAGKV-----IKNVMYTPWRILRLWPDRRTVRWWRNLPDRKDDTVLLS 151

Query: 113 SIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKR-DILAAMKSAEALSELDVGQ 171
            ID     G+    A +  PELLV  G L +C P   ++R D+    + A+A+  LDVGQ
Sbjct: 152 LIDEFARDGIRFTSALDYCPELLVDHGLL-SCRPLSPLERGDVAFGWRLAKAMGGLDVGQ 210

Query: 172 SAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIG 231
           S        +A+E IEGTD  ++R       G++       LVK+ K QQDMR D+P+IG
Sbjct: 211 SVAVKERAALAVEAIEGTDRCIER------AGQLCKAGGWTLVKVAKPQQDMRFDVPTIG 264

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
             T++N+ +A    +A+EA K+++++++LV   A+  GI
Sbjct: 265 LSTIENLARARARVLAVEAQKTILIDRDLVIARANHYGI 303


>gi|77463267|ref|YP_352771.1| hypothetical protein RSP_2715 [Rhodobacter sphaeroides 2.4.1]
 gi|77387685|gb|ABA78870.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 273

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/274 (34%), Positives = 141/274 (51%), Gaps = 18/274 (6%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL-PLGDFCVLRSI---- 60
           IIAGSG LP ++A+A R   + P++A++        + F    L P   F V R +    
Sbjct: 8   IIAGSGALPRHLAEALRSAGEAPLVAAL--------EGFPPEGLAPDITFRVERLVPFLR 59

Query: 61  -LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L +  + R+V AGA+ R P +    F    +  + ++I  + +G +A  L+A I + E 
Sbjct: 60  ALEEARVARLVFAGAVSR-PRLDPSLFDPLTAQMVPRLIGAMQAGDDA-TLRAVIGIFEE 117

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G SV G  EI P+L+   G L    P+   +RD   A    EA+  +DVGQ AV   G 
Sbjct: 118 EGFSVAGVAEIAPDLVPDAGILWGA-PSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQGL 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
            +A+E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV    
Sbjct: 177 CLAVEALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARAA 235

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
            AGLAG+  EAG  ++L++    + A+EAG+F+ 
Sbjct: 236 AAGLAGLVWEAGGVILLDRAEAVRAAEEAGLFLW 269


>gi|149175417|ref|ZP_01854038.1| hypothetical protein PM8797T_18174 [Planctomyces maris DSM 8797]
 gi|148845685|gb|EDL60027.1| hypothetical protein PM8797T_18174 [Planctomyces maris DSM 8797]
          Length = 297

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 132/285 (46%), Gaps = 25/285 (8%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECS---------FDWQDFECRELPLGDFCV 56
           ++AG+G  P   A+ AR +        +    S         F W       +PL     
Sbjct: 18  LLAGAGRFPIVFAEQARQQGYSVCCLGIFGMASEELTEVCDIFHW-------IPLARIGR 70

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDL-CFSIKDSLRISKMIWQLVSGG--NAAILKAS 113
              +  + ++ RIV+AG I++           +   LR   M ++       +  +L A 
Sbjct: 71  AIKLFQREDVNRIVMAGKIEKTVLFSPFRILKLLPDLRTLHMWYRYAKKDRKDDTLLLAV 130

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I   E   +    A +  PELLV+ G L    P+     DI      A+ + +LD+GQS 
Sbjct: 131 IKEFERDNIFFDSALDFCPELLVKHGFLTKRRPSHSQWEDIKMGWDIAKQMGQLDIGQSI 190

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+E IEGTD  +QR       G++       +VK+ K QQD R D+P++G K
Sbjct: 191 VINDKAVIAVEAIEGTDRAIQR------AGQLCKRGGFTVVKVAKPQQDRRFDVPTVGIK 244

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           T+Q + +AG   +A+E+ ++++++++ V   AD+ GI +  ++ E
Sbjct: 245 TLQTMHEAGGRVLAIESNQTIMIDQKEVADLADKLGIAIVSLNEE 289


>gi|258592397|emb|CBE68706.1| conserved hypothetical protein [NC10 bacterium 'Dutch sediment']
          Length = 266

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 137/277 (49%), Gaps = 17/277 (6%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL---PLGDFCVL 57
           M+RL IIAG G LP   A+ AR++  + V  +V    S D  D E   +    +G    L
Sbjct: 1   MERLGIIAGGGPLPIVAARDARMQGLKVVAVAVEEAASADLAD-EVDAICWVGVGQLGRL 59

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFS-IKDSLRISKMIWQLVSGGNAAILKASIDL 116
            S L +  +   V+ G +       DL FS  K  L      W+L       IL    DL
Sbjct: 60  ISALKREQVTDAVMLGKVP-----LDLLFSRAKIDLAGLLFYWKLKDRRGDTILAGVGDL 114

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           L   G+++      +  +L++ G L    P  + ++DI    + A ++++L +GQ+ V  
Sbjct: 115 LAEEGITLHDCRRFLSSILLRKGVLTARAPRLEEQQDIDFGRELARSMAQLRIGQTVVVK 174

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+ ++R       G  L  +  V+VK+ +  +DMR DLP IG +TV 
Sbjct: 175 RRTVLAVEAIEGTDAAIRR-------GGTLGNREVVVVKVGRPHKDMRFDLPVIGPETVA 227

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
            +  AG   +AL+A ++L+L++E V   AD  G+ + 
Sbjct: 228 ALEDAGATALALDADQTLILDREKVVARADRLGLTIV 264


>gi|24213797|ref|NP_711278.1| hypothetical protein LA_1097 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24194627|gb|AAN48296.1|AE011292_9 conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 282

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 129/264 (48%), Gaps = 14/264 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M +L I+AG+G LP+   K A L  ++P+  S++ E  F    +E R +P+       L 
Sbjct: 1   MGKLGILAGAGELPHIGMKEALLAGEDPIFFSII-ESDFHVGMYEDRNIPIHIVKIGTLL 59

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +  ++N+ R+++ G + +    ++L F +K    +++MI +     + +I K   D   
Sbjct: 60  KLCKRHNVDRLLLLGKVKKEIIFKNLKFDLKAIALLARMINK----HDYSIFKTVADEFA 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              ++++     +  L +  G        +    DI   M  AE ++ LD+GQ+ V +  
Sbjct: 116 KEKITIISQKTFLQSLFLPEGRFTKKPLTQKELEDIAFGMDYAEKMAGLDIGQTVVVLDK 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTD     +  CR       GK+ V  K  K  QD R DLP++G  T++ +
Sbjct: 176 SVLAVEAVEGTD-----LAICRGGSFAKKGKATV-CKSSKPNQDHRFDLPTVGENTLKAM 229

Query: 239 IKAGLAGIALEAGKSLVLE-KELV 261
            +     +AL  G+++++  KE +
Sbjct: 230 YENNCGTLALRTGETIIVHPKEFI 253


>gi|126729716|ref|ZP_01745529.1| hypothetical protein SSE37_04560 [Sagittula stellata E-37]
 gi|126709835|gb|EBA08888.1| hypothetical protein SSE37_04560 [Sagittula stellata E-37]
          Length = 258

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 131/277 (47%), Gaps = 35/277 (12%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILH 62
           L +IAG+G LP  VA A    +   V+   L  C  D   D   R   LG    L   L 
Sbjct: 2   LALIAGTGALPGAVAAA----HGGTVVVCALEHCPPDLPVDRTFRLETLG---TLLRWLR 54

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG-------GNAAILKASID 115
           +  +  + + G++ R P       S+    R+    W LV         G+   L+  I 
Sbjct: 55  RQGVTEVCLCGSVTRPP------VSLA---RVDLWTWPLVPRVLRALRRGDDGALRIFIA 105

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
           L E  G  VV AHE  P LL  VG+ G  VP   V+   L    S    +E D+GQ+ V 
Sbjct: 106 LFEESGFRVVAAHEAAPALLPPVGAWGD-VPAGVVELARLGDTVSDRQAAE-DLGQACVL 163

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV 235
             G V+  EG+EGTD+ML ++ D          + GVL K  K  QD RADLP IG +T+
Sbjct: 164 RDGNVLQREGVEGTDAMLAKLGDA---------EGGVLYKAPKPGQDRRADLPVIGPETL 214

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           +    AGLAGI +EA   +VLE+ LV+    E G+F+
Sbjct: 215 RRAAAAGLAGIVIEAQGVMVLEQPLVRTLIAETGLFL 251


>gi|262067091|ref|ZP_06026703.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291379190|gb|EFE86708.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 267

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 137/279 (49%), Gaps = 24/279 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR------ELPLGDF 54
           M+++ +I G+G LP Y  + A+  N      SV     F   D E +      E  +G  
Sbjct: 1   MEKIGLIVGNGKLPLYFIEEAKNSN-----ISVYPIGLFPSVDEEIKKSDNYAEFNVGHI 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG-NAAILKAS 113
             +   L   +I +IV+ G I+++   ++L        +  + I ++V    +  +L A 
Sbjct: 56  GEIIKYLLLNDITKIVMLGKIEKKLIFENLILD-----KYGEKIMEIVPDKKDETLLFAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I  +   G+ V+  +  +  L+ +        P+ D ++ I   +++A  LS +DVGQ+ 
Sbjct: 111 IGFIRLNGIKVLPQNYSMKRLIFEAKCYTERHPDADDEKTISMGIEAARLLSRVDVGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     V+A+EGIEGTD  L+R       G+  + K  +L+KM + QQDMR D+P IG  
Sbjct: 171 VCRDKAVIAVEGIEGTDETLKRA------GQ-YSDKDNILIKMARPQQDMRVDVPVIGLD 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           T++  IK G  GI  +A + + L ++   + A++  IF+
Sbjct: 224 TLETAIKNGFKGIVAQAKRMIFLNQKECIELANKNNIFI 262


>gi|290968944|ref|ZP_06560479.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
 gi|290780900|gb|EFD93493.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
          Length = 271

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 137/278 (49%), Gaps = 12/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M+++ + AG G LP    +AA+    E V+ +++     +  +      E+ +     + 
Sbjct: 1   MEKVGLFAGVGRLPVEFVRAAKTSGHETVVIALVPGTDPELAEAADVYYEINVAKLDKVI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             + +  + ++ + G + +    + L F      R  K++  L +  +  I+ A ++ L 
Sbjct: 61  KTMRRAGVTKVTMIGKVTKELLFKGLSFP---DFRAMKLLATLHNRKDDTIMLAIVEELA 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V    E +  L+   G L    P+    +DI     +A+A+ +LD+GQ+ V    
Sbjct: 118 KDGLEVADQTEYLKALMPSCGVLTRRQPSEAEWQDIRFGAATAKAMGKLDIGQTVVVKRQ 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+       C   G  LA   GV+VK+ K +QD R D+P++G  TV+ +
Sbjct: 178 AVMAVEAIEGTDA-------CIRRGGTLAQGDGVVVKVAKPKQDWRFDMPTVGKATVEAM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           + +G   +A+EA K+L +E+E V   A +  + +C ++
Sbjct: 231 VASGCTVLAMEADKTLFVEQEEVLALAAKHKLCICAVN 268


>gi|116625259|ref|YP_827415.1| hypothetical protein Acid_6204 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228421|gb|ABJ87130.1| protein of unknown function DUF1009 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 272

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 136/276 (49%), Gaps = 12/276 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLR 58
           M R  +IAG+G  P    ++AR    E V+ ++  E S + +     C  + +G    L 
Sbjct: 1   MIRYGMIAGNGRFPLLALESARQLGYEIVVIALQEEASKEVEALAARCYWVSIGQLGRLI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            I  Q  I  +++ G +        +  +I+   R+ K++  L S     ++   I +L+
Sbjct: 61  EICQQEGISEVMMCGQVKH----AKIFSNIRPDWRLVKLLAMLPSKNTDGLIGGVIRVLQ 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ +  +  ++  +L   G++     +++   DI    + A AL+  DVGQS      
Sbjct: 117 DEGIQLRDSTMLLKPMLATAGAMTRRKADKEEGVDIDYGRRVANALAGFDVGQSVAICDR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             VA+E +EGTD+ML+R     N      G+   LVK+ + ++ +  D+P +G  T+  +
Sbjct: 177 ACVAVEAMEGTDAMLRRAATLVN------GRRMALVKVARRREHLLFDVPVVGLDTIPVM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            + G   +A+EAG++L+L+KE + + AD AGI + G
Sbjct: 231 RETGTTVLAVEAGRTLMLDKEKMLETADAAGIAIVG 266


>gi|282850047|ref|ZP_06259429.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282580236|gb|EFB85637.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 278

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 136/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   E V+  V+ +   +   +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDIGVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEEVEELTMLGKVTKEILFKGLTFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTVYLKPFMPKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDK-------CILRGGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   AD  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDMADRHGIVICAVDQEF 271


>gi|149200512|ref|ZP_01877524.1| hypothetical protein LNTAR_23869 [Lentisphaera araneosa HTCC2155]
 gi|149136400|gb|EDM24841.1| hypothetical protein LNTAR_23869 [Lentisphaera araneosa HTCC2155]
          Length = 272

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 135/279 (48%), Gaps = 20/279 (7%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKN--DEPVIASVLNECSFDWQ---DFECRELPLGDFCV 56
           K+L IIAG G  P+ + + AR KN  D+  +A++  + S D +   D      P G    
Sbjct: 5   KQLGIIAGRGHYPFLILREAR-KNGVDKIAVAAIQGDASEDLEQESDAMAWVYP-GQINR 62

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
                 +  I   V+ G +  +P+   L   +K  LR   M+ +L       +  A  + 
Sbjct: 63  TIKFFQKQGITEAVMVGQV--KPS--RLFTGLKPDLRTLFMLGKLKERNADTLFSAVCNE 118

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            +  G++++ A   + E L   G L     ++   RD   A   A+ +S +D+GQS V  
Sbjct: 119 FQKSGITILSAITYLDEHLAGEGLLNNVKADKSRLRDAEYAFSVAKEVSRMDIGQSVVVK 178

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLV-KMCKSQQDMRADLPSIGAKTV 235
            G ++A+EG EGTD  + R       G +  G+ GV V K+ K   DMR D+P IG +TV
Sbjct: 179 RGTILAVEGFEGTDKAIIR------GGEL--GRGGVTVCKVTKPDHDMRFDVPCIGMRTV 230

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            ++I+A    + +EA ++L +EKE V +  D A I V G
Sbjct: 231 DSLIQAKARTLVVEAKRTLFIEKERVLEALDRAKISVIG 269


>gi|114764261|ref|ZP_01443489.1| hypothetical protein 1100011001356_R2601_25051 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543209|gb|EAU46226.1| hypothetical protein R2601_25051 [Roseovarius sp. HTCC2601]
          Length = 261

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 128/279 (45%), Gaps = 24/279 (8%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILH 62
           L +IAG G LP  VA A     + P+I ++          D   R   LG F      L 
Sbjct: 2   LALIAGQGALPRAVADAC---PERPLICALEPHMPEGLAVDRSFRIETLGSFL---HWLR 55

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  + RI + G + R P ++      +  L +      L  G + A L+  I LLE  G 
Sbjct: 56  KRGVTRICMVGRVAR-PEIRLTQLDWRTVLMLPAFRRALKRGDDGA-LRIVIGLLEGAGF 113

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSE---LDVGQSAVSIGGR 179
            VVGAHE  P+LL   G L    P      DI AA    +   E    D GQ+ V   G 
Sbjct: 114 EVVGAHEAAPDLLPPSGVLTQVQPG---AADIGAARLGDQVSREQGARDFGQACVIRDGA 170

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A E   GTD+M+  +          A   GVL K  K  QD RADLP +G +T +  +
Sbjct: 171 VLAREDEAGTDAMIDSLE---------AAAGGVLYKAEKPGQDHRADLPVVGPRTAEGAV 221

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +AGL+GI L AG  + +++  + +  D AG+F+   +R+
Sbjct: 222 RAGLSGIVLSAGGVMTVDRPAMIEALDAAGLFLWVRERD 260


>gi|325111096|ref|YP_004272164.1| hypothetical protein Plabr_4571 [Planctomyces brasiliensis DSM
           5305]
 gi|324971364|gb|ADY62142.1| protein of unknown function DUF1009 [Planctomyces brasiliensis DSM
           5305]
          Length = 304

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 81/283 (28%), Positives = 139/283 (49%), Gaps = 17/283 (6%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC---RELPLGDFCVLRSILH 62
           ++AG+G  P   AK A+ +        V+   S +  ++ C     +PL           
Sbjct: 25  LLAGAGRFPILFAKEAQKQGYSVHAMGVIGMASDELPEY-CDVYSPVPLARIGQAIRWFK 83

Query: 63  QYNIGRIVVAGAIDRRPNVQD-LCFSIKDSLRISKMIWQLVSGGNA---AILKASIDLLE 118
           ++ + ++V+AG I++    Q    + +   +R   M W   +  N     +L A I   E
Sbjct: 84  RHRVEQMVMAGKIEKVVLFQSKRLWRLLPDMRTIHM-WMRYARENKKDDTLLLAVIREFE 142

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              +    A +  PELLVQ G L    PN    +DI      A+ +  LDVGQ+ +    
Sbjct: 143 RDQIHFASALDFCPELLVQHGFLTRRKPNAAQWKDICFGWDLAKEMGRLDVGQTVIVNDT 202

Query: 179 RVVALEGIEGTDSMLQRIVD-CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
            V+A+E IEGTD  + R  + C+  G         +VK+ K QQD R D+P+IG +T+++
Sbjct: 203 AVIAIEAIEGTDKAILRAGELCKRGG-------FTVVKVAKPQQDYRFDVPTIGVQTLRS 255

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           + +AG   +A+EAG++++L++  V + AD+ GI +  ++ E A
Sbjct: 256 MHEAGGRVLAVEAGQTIILDEPEVVELADKLGISIVSLNSEEA 298


>gi|126737633|ref|ZP_01753363.1| hypothetical protein RSK20926_18367 [Roseobacter sp. SK209-2-6]
 gi|126721026|gb|EBA17730.1| hypothetical protein RSK20926_18367 [Roseobacter sp. SK209-2-6]
          Length = 262

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 124/269 (46%), Gaps = 13/269 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G+LP  VA  ARL   E  +   L     D  D E     L  F      L  
Sbjct: 2   LALIAGRGLLPKEVA--ARLP--ERALICALAGSEPDCVDAEI-TFRLEHFGSFLERLKA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA+ R P +         +L +       ++ G+   L+A + +LE  G +
Sbjct: 57  AGVTEVCLAGAVTR-PQIDPTAIDAA-TLPLVPAFQAALAAGDDGALRAVMAILEQAGFT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  AHE  P+LL+  G      P      D     +   A+S  D+GQS      + +A+
Sbjct: 115 LRAAHEAAPDLLMGEGVFTRVQPGELDHADAARGAEIVAAMSAADIGQSCAVRACQAIAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E   GTD ML  +   R +G     + G++ K  K  QD RADLP+IG +TV     AGL
Sbjct: 175 ENAFGTDWMLHSL-SARPDG-----EGGLMFKAPKPGQDRRADLPTIGPETVAAAATAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
           +GI LEAG  LVL +E V    D  G+F+
Sbjct: 229 SGIVLEAGGVLVLNQEEVIAACDRHGLFL 257


>gi|260886280|ref|ZP_05897543.1| conserved hypothetical protein [Selenomonas sputigena ATCC 35185]
 gi|330839736|ref|YP_004414316.1| protein of unknown function DUF1009 [Selenomonas sputigena ATCC
           35185]
 gi|260863999|gb|EEX78499.1| conserved hypothetical protein [Selenomonas sputigena ATCC 35185]
 gi|329747500|gb|AEC00857.1| protein of unknown function DUF1009 [Selenomonas sputigena ATCC
           35185]
          Length = 268

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 139/280 (49%), Gaps = 17/280 (6%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLR 58
           M+++ ++AG G LP   A+AA+    E    S+L     +  +   + R + +     + 
Sbjct: 1   MEKIGLLAGVGRLPVVCAQAAKALGIEVSAVSLLAGTDKELAEVASDHRAINVAQLGAII 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFS---IKDSLRISKMIWQLVSGGNAAILKASID 115
             L +  + ++ + G + +     +L F+    +  +R+ +++  L    +  I+ A + 
Sbjct: 61  DYLKERGVTKVTLLGKVTK-----ELLFAGSHEQPDMRMMQLLMSLPDKKDDTIMLAFVK 115

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
            L   G+       ++  L+   G+L    P  + + D+  A+  A+ +  LD+GQ+AV 
Sbjct: 116 ELAKEGLEAFDQTALLKTLMPPAGTLTKREPTAEERADMEMALAMAKEIGRLDIGQTAVV 175

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV 235
               V+ALE IEGTD+       C   G  L+G    + K  K QQDMR D+P+IG  T+
Sbjct: 176 KAKAVMALEAIEGTDA-------CIRRGGELSGGGAAVGKAAKPQQDMRFDVPAIGTATI 228

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +++I AG   +A+EAG+ LV+++  V   ADE GI +  I
Sbjct: 229 ESMIAAGAKALAIEAGRVLVVDQAKVAALADENGITIAAI 268


>gi|83942320|ref|ZP_00954781.1| hypothetical protein EE36_14807 [Sulfitobacter sp. EE-36]
 gi|83846413|gb|EAP84289.1| hypothetical protein EE36_14807 [Sulfitobacter sp. EE-36]
          Length = 263

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/265 (29%), Positives = 128/265 (48%), Gaps = 15/265 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILH 62
           L +IAG G LP  VA A     D P+I +         + D   R   LG    L + L 
Sbjct: 2   LALIAGGGGLPQRVAGA---LADAPLICAYEGTTPVGLEPDLVFRLETLG---TLLAELT 55

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             N+ +    GA+  RP+          +L +  +  + ++ G+   L+A +D+ ++ G+
Sbjct: 56  ARNVTQACFCGAV-ARPSFDPSKLDAA-TLPLVPVFQKALAAGDDGALRALVDIFQTAGL 113

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +VV AH++ P+L+ +   L    P+  ++ D          L+ +DVGQ  V   G+V+ 
Sbjct: 114 TVVAAHDLAPDLMARERVLSQRQPDAQMRDDAARGAALVRCLAPMDVGQCCVVGQGQVMG 173

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E I GTD +L  + D     R+    S VL K  K  Q    D+P+IG  T++   +AG
Sbjct: 174 IEAIGGTDHLLSTLPD---RARL---ASAVLFKGPKPGQSHLVDMPTIGPDTLRRAHEAG 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADE 267
           LAG+ +EAG  ++LE +     ADE
Sbjct: 228 LAGVVIEAGSVILLEPDACVALADE 252


>gi|303230965|ref|ZP_07317708.1| conserved hypothetical protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302514347|gb|EFL56346.1| conserved hypothetical protein [Veillonella atypica ACS-049-V-Sch6]
          Length = 278

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 138/281 (49%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS--FDWQDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   + V+ SV+ +     + +      + +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHMLGHQVVVISVVPDTDPILEKEADAFYNISVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEGVTELTMLGKVTKEILYKGLSFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G SV+     +   + +VG L    P  +  +DI    + A+ + +LD+GQ+ V    
Sbjct: 118 REGFSVLDQTVYLKPFMPKVGVLTKRQPTEEQWQDICFGFELAKQMGKLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDK-------CILRGGELGRGEAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ +++E V + A+   I +C +D+ F
Sbjct: 231 IDSGCNVLAVEAEKTIFVQQEDVLEMANRHNIIICAVDQAF 271


>gi|302383595|ref|YP_003819418.1| hypothetical protein Bresu_2486 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194223|gb|ADL01795.1| protein of unknown function DUF1009 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 281

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 135/276 (48%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAG G LP+ +A+    +     I  +          +      + +   +   L 
Sbjct: 7   KLGLIAGGGELPHAIARRCDEEGRPLFIVRLDGFADHHLDRWPGATFGMAEIGGILKALK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           Q     + +AG + R P+ + L   +K +  +  +I    + G+ A+L+  + + E+ G 
Sbjct: 67  QQGCAAVCLAGTVSR-PDFKRLKPDLKGASVLPGII-AAATKGDDALLRKILSVFETEGY 124

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V GA +I+    +  G+LG   P  +   D+  A+  AE   ELD+GQ AV   G V+A
Sbjct: 125 GVEGADDILGGETLPGGALGAITPTPEHLSDLKKALHVAEKAGELDIGQGAVVCDGLVLA 184

Query: 183 LEGIEGTDSMLQRIVDCRNNGR-ILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E  EGTD+ML R+ +   + R   + + G L K  K  QD+R D+P IG +TV+    A
Sbjct: 185 VEAQEGTDAMLSRVAELPADLRGSPSARKGALGKAPKPIQDLRVDMPVIGTRTVEMAAAA 244

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGI       ++++++ +   AD  G+FV G  R
Sbjct: 245 GLAGIGGLTDHLILIDRKSIIDTADRLGLFVWGETR 280


>gi|168698124|ref|ZP_02730401.1| hypothetical protein GobsU_01282 [Gemmata obscuriglobus UQM 2246]
          Length = 266

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 97/173 (56%), Gaps = 6/173 (3%)

Query: 103 SGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAE 162
           +  + ++L   ID   + G+  V A ++ PELLV  G L    P +  +RDI    + A 
Sbjct: 94  ANNDDSLLLGLIDEFRAEGLECVSALDLCPELLVPEGVLTKRHPTKSEQRDIAFGWELAR 153

Query: 163 ALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQD 222
            +  LDVGQS +     V+A+E IEGTD  ++R       G + +    V++K+ K +QD
Sbjct: 154 EMGRLDVGQSVMIRERAVLAVEAIEGTDMAIRR------AGELCSRGGFVVIKLAKPEQD 207

Query: 223 MRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            R D+P++G +T++ + +AG   +A+EAG+++V+++      A++ GI +  +
Sbjct: 208 KRFDVPTVGTQTIETMHRAGATALAIEAGRTIVIDQAATVALAEKYGITITSL 260


>gi|289548057|ref|YP_003473045.1| hypothetical protein Thal_0283 [Thermocrinis albus DSM 14484]
 gi|289181674|gb|ADC88918.1| protein of unknown function DUF1009 [Thermocrinis albus DSM 14484]
          Length = 260

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 138/276 (50%), Gaps = 20/276 (7%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           ++ +IAGSG LPY   K+A+ K +E  +  V +    D Q  E   LPLG    L   L 
Sbjct: 2   KICLIAGSGSLPYIFLKSAQEKGEEVFVVGVRHVT--DIQAHET--LPLGKVGSLVKTLE 57

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFS---IKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           +  I  IV+ G  + +     L FS     D L + +++ +        ++K  +  LES
Sbjct: 58  RRGIKHIVMLGKFEHK-----LLFSHLLTLDELAV-RILRKSPDKRPQTLIKTMMQELES 111

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G   +     + ++L   G +    P+     D L  M  A+AL+++DVGQ+ V     
Sbjct: 112 MGFQFLDPRPYLEDILAPSGVINRVRPSDSAMEDGLFGMPIAKALADMDVGQTIVVKEKS 171

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VV++E +EGT   ++R       GRI  GK   ++K+ +  QD R D+P++G +T++ + 
Sbjct: 172 VVSVEAMEGTQETIER------AGRI-GGKGCRVIKVARKNQDFRIDVPTVGPQTLELMR 224

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           K     + LEA K  +++KE + + AD+ GI + G+
Sbjct: 225 KIKADALFLEANKVYMVDKEKMLRLADKWGIAIYGL 260


>gi|303230233|ref|ZP_07317001.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515159|gb|EFL57133.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 278

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 137/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS--FDWQDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   + V+  V+ +     + +      + +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHMLGHQVVVIGVVPDTDPILEKEADSFYNISVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEGVTELTMLGKVTKEILYKGLSFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G SV+     +   + +VG L    P  +  +DI    + A+ + +LD+GQ+ V    
Sbjct: 118 REGFSVLDQTVYLKPFMPKVGVLTKRQPTEEQWQDICFGFELAKQMGKLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDK-------CILRGGELGRGEAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ +++E V + A+   I +C +D+ F
Sbjct: 231 IDSGCNVLAVEAEKTIFVQQEDVLEMANRHNIIICAVDQAF 271


>gi|332558145|ref|ZP_08412467.1| hypothetical protein RSWS8N_03800 [Rhodobacter sphaeroides WS8N]
 gi|332275857|gb|EGJ21172.1| hypothetical protein RSWS8N_03800 [Rhodobacter sphaeroides WS8N]
          Length = 273

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 142/274 (51%), Gaps = 20/274 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL-PLGDFCVLRSI---- 60
           IIAGSG LP ++A+A R   + P++A++        + F    L P   F V R +    
Sbjct: 8   IIAGSGALPRHLAEALRSAGEAPLVAAL--------EGFPPEGLAPDIIFRVERLVPFLR 59

Query: 61  -LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L +  + R+V AGA+ R P +    F    +  + ++I  +   G+ A L+A I + E 
Sbjct: 60  ALEEAGVSRLVFAGAVSR-PRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIFEE 117

Query: 120 YGVSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
            G SV G  +I P+L+   G L GT  P+   +RD   A    EA+  +DVGQ AV   G
Sbjct: 118 EGFSVAGVAKIAPDLVPGAGILCGT--PSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQG 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV   
Sbjct: 176 LCLAVEALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARA 234

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             AGLAG+  EAG  ++L++    + A+EAG+F+
Sbjct: 235 AAAGLAGLVWEAGGVILLDRAEAVRAAEEAGLFL 268


>gi|84516081|ref|ZP_01003441.1| hypothetical protein SKA53_04083 [Loktanella vestfoldensis SKA53]
 gi|84509777|gb|EAQ06234.1| hypothetical protein SKA53_04083 [Loktanella vestfoldensis SKA53]
          Length = 292

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 136/298 (45%), Gaps = 48/298 (16%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP   A   RL  + P++ ++         D   R   LG F    + L  
Sbjct: 2   LALIAGTGDLPP--ALLVRLP-ERPLVCALQGFAPQITPDITFRLEHLGSFL---ADLAA 55

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAI-------LKASIDL 116
             + RI +AGA+ +RP +        D  +I      LV+G  AA+       L+  I +
Sbjct: 56  RGVTRICMAGAV-KRPAI--------DPAQIDAATLPLVAGLQAALAKGDDGTLRGVIAI 106

Query: 117 LESYGVSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
           LE+ G +VV AH++ P+LL   G L G   P   ++ D +   ++  A+ + D+GQ+ + 
Sbjct: 107 LENAGFAVVAAHDLAPDLLPAAGVLAGRVTPQ--LRLDAVLGEQTIAAMGQADIGQACLV 164

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRN-----------------------NGRILAGKSGV 212
             G V+A E   GTD+M+ R     +                       +G  +  +  V
Sbjct: 165 RLGHVIAREDQAGTDAMIARFAPAGDPLWGSVDLVGDLLGTAAEWLSGADGVPVDARGAV 224

Query: 213 LVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
           L K  K  QD RADLP IG  T +  + AGL+ I +EAG  +VL+   V    D AG+
Sbjct: 225 LFKAPKPAQDRRADLPVIGPDTARGAVAAGLSAIVVEAGGVIVLDLPQVIATLDRAGV 282


>gi|291288192|ref|YP_003505008.1| hypothetical protein Dacet_2290 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885352|gb|ADD69052.1| protein of unknown function DUF1009 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 265

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 123/264 (46%), Gaps = 13/264 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQ 63
           +IAG G LP   AK       E VI ++  E + D         ++ +     +  +L  
Sbjct: 5   LIAGYGELPLIAAKNLIKDGHELVIIALYEEVTADLGSLGVTVEKVSVTQVGKIIKLLKN 64

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
            N  R++ AG +++     DL F     L   K++  L +  +  I+      L + G+ 
Sbjct: 65  NNSDRVLFAGKVNKSLLFSDLKFD----LTAMKLLATLPNRKDDTIMDVICHELNANGIE 120

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+   E +  L +  G      P++    DI   ++ A  L  LD+GQ+ V     V+AL
Sbjct: 121 VMEQSEALYPLYLGKGIYSKKKPSKVQMEDIEFGLEVARELGRLDIGQTVVVKNKAVMAL 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E IEGTD  + R       G  LAGK  V+VK  K  QD R D+P++G  T++N+     
Sbjct: 181 EAIEGTDKAVVR-------GCSLAGKGAVIVKCAKPSQDKRFDIPTVGVDTLKNIADNNG 233

Query: 244 AGIALEAGKSLVLEKELVKKHADE 267
             IA+EAG + V++ +   ++ADE
Sbjct: 234 KVIAVEAGTTFVVDVDSCVRYADE 257


>gi|325295063|ref|YP_004281577.1| hypothetical protein Dester_0878 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065511|gb|ADY73518.1| protein of unknown function DUF1009 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 264

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 134/275 (48%), Gaps = 20/275 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-----CRELPLGDFCVLRSI 60
           ++AG G LP    K+A+ K+   +  S+    S + + +       +   LG F  LR+ 
Sbjct: 5   LLAGKGELPLEFLKSAKEKDIRTITFSLEGITSPEVERYSDKVIWIKPFKLGKF--LRT- 61

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  I  I + G ++ +  +    F     L+    I  L       I+K  I  +E+ 
Sbjct: 62  LKKEEIREIAILGKVEHKNAISLSGFD----LKALTFIASLRDRKPETIIKGIISEIENI 117

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV V+   + +  L  + G +   + ++ +K D    MK A+ ++ LD+GQ+ V     V
Sbjct: 118 GVRVIEPTKYLLHLFQEPGIICGELTDK-LKEDAEFGMKIAKEIASLDIGQTVVVKDKTV 176

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+EGIEGTD  ++R       G  LAGK  ++ K  +  QDMR D+P++GAKT++ + K
Sbjct: 177 IAVEGIEGTDKCIER-------GAELAGKGFIVCKAARKNQDMRVDVPTVGAKTIELIGK 229

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
                +  EA K+ +L KE   + + + GI V  +
Sbjct: 230 LKGRALIFEANKTFLLNKEEAVRLSRKYGITVIAV 264


>gi|284105034|ref|ZP_06386163.1| protein containing DUF1009 [Candidatus Poribacteria sp. WGA-A3]
 gi|283830157|gb|EFC34417.1| protein containing DUF1009 [Candidatus Poribacteria sp. WGA-A3]
          Length = 274

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 135/272 (49%), Gaps = 13/272 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRSILHQ 63
           +IAG+G  P   A+ AR         +   E + + +    R   + +G F  +   L  
Sbjct: 12  LIAGNGRFPVIFAENARKLGFRVSAVAHHGETAPELEQVVDRMHWVRIGQFGKVIQALKY 71

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + + V+ G + +      L   ++   R      +L S  +  IL+A  D LE  G++
Sbjct: 72  DGVEQAVMLGGMKK----THLFSGVRPDFRAMAFFAKLKSWKDDHILRAIADDLEDEGIT 127

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  +   +  L+V  G+L    P+R  + ++      A+ +  +D+GQ  V     +VA+
Sbjct: 128 IRESTFGLSNLVVPEGTLTRRGPSRKERENVSYGWSIAKEIGRMDIGQCVVVKDRVIVAV 187

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E +EGTD  ++R       GR +A    V+VK CK QQD+R DLP++G +T+  + +   
Sbjct: 188 EAVEGTDETIRR------GGR-MARSGAVVVKCCKPQQDLRFDLPAVGPRTIDVMDEVKA 240

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + +ALEA K+++L++E + + A +AGI + G+
Sbjct: 241 SVLALEAHKTIMLDREEMLEKAHQAGIVIIGV 272


>gi|294677173|ref|YP_003577788.1| hypothetical protein RCAP_rcc01636 [Rhodobacter capsulatus SB 1003]
 gi|294475993|gb|ADE85381.1| protein of unknown function DUF1009 [Rhodobacter capsulatus SB
           1003]
          Length = 247

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 113/214 (52%), Gaps = 6/214 (2%)

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    I R+  AGA+ +RP ++   F  + +  + +++  + +G +A  L+A I L E +
Sbjct: 37  LADRGIRRVCFAGAM-QRPKLEPELFDARTAALVPRLLGAMRAGDDA-TLRAVIALFEDW 94

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
              V+GA EI P L+   G L   V ++D + D   A +   AL  +DVG+     G   
Sbjct: 95  DFEVIGADEIAPALVPGDGLLCGSVGDQD-QLDAARAAEIVAALGAVDVGRGGGPPG-LC 152

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           + +E + GTD++L  +   R  G +   K+GV  K  K  QD R DLP++G +TV  V  
Sbjct: 153 LGVEALPGTDALLDFVAAHR--GLVPMPKAGVFFKAPKPGQDRRIDLPALGPQTVARVAA 210

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AGL GI  EAG  L+L++      A+ AGIF+ G
Sbjct: 211 AGLCGIVFEAGGVLLLDRAATIAAAEAAGIFLWG 244


>gi|158522849|ref|YP_001530719.1| hypothetical protein Dole_2839 [Desulfococcus oleovorans Hxd3]
 gi|158511675|gb|ABW68642.1| protein of unknown function DUF1009 [Desulfococcus oleovorans Hxd3]
          Length = 273

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 124/279 (44%), Gaps = 45/279 (16%)

Query: 6   IIAGSGMLPYYVAKAARLKND-----------EPVIASVLNECSFDWQDFECRELPLGDF 54
           +IAG G  P   A+AA+               +P I   ++  ++         L +G  
Sbjct: 5   LIAGGGCFPLLFARAAKAAGHRVYAVAYTGQADPAIQEAVDAAAW---------LNVGQV 55

Query: 55  CVLRSILHQYNIGRIVVAGAI-------DRRPNVQDLCFSIKDSLRISKMIWQLVSGGNA 107
             L     ++ +   V+ G +       D +P+   L F           I  L    + 
Sbjct: 56  EHLLGFFSRHQVTDTVIMGWVRKTVMFSDFQPDATALAF-----------IAGLTETHDD 104

Query: 108 AILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSEL 167
            +L++   LLE  G+ V  +  ++P +L   G      P      DI    + A+ +  L
Sbjct: 105 LLLRSFAGLLEENGLRVRASTFLLPHILAGEGCWTKTKPTAGQWSDISLGWRIAKEIGRL 164

Query: 168 DVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADL 227
           DVGQ  V   G V+A+E IEGTD+ + R       GR L G   V+VK+CK  QD+R D+
Sbjct: 165 DVGQCVVVQKGSVLAVEAIEGTDAAIAR------GGR-LGGGDAVVVKVCKPNQDLRFDI 217

Query: 228 PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHAD 266
           P++G +TV+ +   G   +A+EAG+S+V +K  +   AD
Sbjct: 218 PAVGMETVKTMQSTGAKVLAVEAGRSVVFDKPEMVSFAD 256


>gi|327543221|gb|EGF29655.1| protein containing DUF1009 [Rhodopirellula baltica WH47]
          Length = 320

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 102/181 (56%), Gaps = 13/181 (7%)

Query: 96  KMIWQLVSGG-----NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDV 150
           K  W  + G      +  +L A ID  E++ + +  A ++ PELL + G L    P+  +
Sbjct: 125 KTFWPCLFGARRDARDDRLLGAVIDTYENHAMKICSATDLAPELLAKTGQLTRRKPSSAI 184

Query: 151 KRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD-CRNNGRILAGK 209
           + DI A  + A+ +  LD+GQ+     G ++A+E IEGTD+ + R  + CR  G      
Sbjct: 185 QSDISAGWQIAKTMGGLDIGQAITIKDGTIIAVEAIEGTDACIARTGELCRRGG------ 238

Query: 210 SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAG 269
              LVK+ K  QDMR D+P+IG +T+Q V +AG A IA+EAGK+++L+ E   + AD  G
Sbjct: 239 -WTLVKVSKPDQDMRFDVPTIGPQTIQRVHEAGGAAIAIEAGKTILLDSEETIQLADRLG 297

Query: 270 I 270
           I
Sbjct: 298 I 298


>gi|312879635|ref|ZP_07739435.1| protein of unknown function DUF1009 [Aminomonas paucivorans DSM
           12260]
 gi|310782926|gb|EFQ23324.1| protein of unknown function DUF1009 [Aminomonas paucivorans DSM
           12260]
          Length = 282

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 126/277 (45%), Gaps = 25/277 (9%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNE----CSFDWQDFECRELPLGDFCVLRSIL 61
           ++AG G LP  +A+    +   PV+ S+         F W       L   D     + +
Sbjct: 18  LVAGEGTLPLEIARRLTDRGTPPVVYSLRENVGALSKFAWDVVVLSRL---DLASTLADM 74

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               I R+++AG + +    Q             +++  L    + ++L A +   E   
Sbjct: 75  KGRGIRRVLLAGVVPKTLLYQPAMLDAG----ARELVAGLAVRDDHSLLAALVQAFERLD 130

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V G   ++ +L+   G       + + + D+   M+ A  L  L  GQ+ V     VV
Sbjct: 131 LRVEGYRHLIEDLMAPSGEFAGRPLSEEERADVAYGMEVARVLLPLSFGQTVVVHRRSVV 190

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAG---KSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
           A+E +EGTD+ L R           AG   K G +VKM +  QD R DLP++G +T+ ++
Sbjct: 191 AVEAMEGTDAALLR-----------AGSLCKGGTVVKMMRVDQDDRYDLPTVGPRTLHHM 239

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +AGL  +A+E G+++VLE E  ++ A   GI V G+
Sbjct: 240 ARAGLRCLAVEVGRTIVLEPEAFRETARAEGIAVTGV 276


>gi|309390187|gb|ADO78067.1| protein of unknown function DUF1009 [Halanaerobium praevalens DSM
           2228]
          Length = 276

 Score = 92.0 bits (227), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 129/259 (49%), Gaps = 14/259 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP--LGDFCVLR 58
           M +  +IAG G LP   A+ A+   ++ ++  +  E + ++ D +C      L     + 
Sbjct: 1   MSKKALIAGWGKLPRIWAEKAQAAAEDFIVIRIAEEITAEFSDLDCSSYTVNLTQLGKIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL +  I  ++  G I +     D     +   ++ K++ QL +  +  IL A    + 
Sbjct: 61  EILAEEKIEEVIWLGKIQKAHLFADF----RPDQKLQKLLEQLPNLNDDTILMALALEII 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + G++++    ++ + L + G L   V   ++K D++ A ++A  L   D+GQ+A+   G
Sbjct: 117 NIGINILPQTYLLADQLAKAGVLAGEV-KAELKSDLIFAFETAINLGRFDIGQTAIVKNG 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD  +QR       G ++A       K  K +QD+R D+P++G KT++ +
Sbjct: 176 AVLALEAIEGTDQAIQRAAKYGGPGLVMA-------KCSKKEQDLRFDIPTVGLKTLEQL 228

Query: 239 IKAGLAGIALEAGKSLVLE 257
             A    + +EA ++ +L+
Sbjct: 229 AAAEARALIVEADQTFILD 247


>gi|32476481|ref|NP_869475.1| hypothetical protein RB10538 [Rhodopirellula baltica SH 1]
 gi|32447026|emb|CAD78932.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 326

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 102/181 (56%), Gaps = 13/181 (7%)

Query: 96  KMIWQLVSGG-----NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDV 150
           K  W  + G      +  +L A ID  E++ + +  A ++ PELL + G L    P+  +
Sbjct: 131 KTFWPCLFGARRDARDDRLLGAVIDTYENHAMKICSATDLAPELLAKTGQLTRRKPSSAI 190

Query: 151 KRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD-CRNNGRILAGK 209
           + DI +  + A+ +  LD+GQ+     G ++A+E IEGTD+ + R  + CR  G      
Sbjct: 191 QSDISSGWQIAKTMGGLDIGQAITIKDGTIIAVEAIEGTDACIARTGELCRRGG------ 244

Query: 210 SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAG 269
              LVK+ K  QDMR D+P+IG +T+Q V +AG A IA+EAGK+++L+ E   + AD  G
Sbjct: 245 -WTLVKVSKPDQDMRFDVPTIGPQTIQRVHEAGGAAIAIEAGKTILLDSEETIQLADRLG 303

Query: 270 I 270
           I
Sbjct: 304 I 304


>gi|114797181|ref|YP_760484.1| hypothetical protein HNE_1780 [Hyphomonas neptunium ATCC 15444]
 gi|114737355|gb|ABI75480.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 282

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 138/282 (48%), Gaps = 9/282 (3%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  +A+ A        +  +        + F+   + LG+   +   L  
Sbjct: 5   LGLIAGLGELPVAIAENAVATGQGVYVLRLKGFEEPGLEKFQGSIVGLGEIGAVVDRLKA 64

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
                +V AG +  RP+ ++L   ++    + ++I +    G+ A+L+  +   E +G  
Sbjct: 65  AGCKEVVFAGNVS-RPDFKNLKLDLRGIALLPRVIAE-ARKGDDALLRVLVTEFEKHGFH 122

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+G+     +L+   G +    P+  + +D+    K A A   LD+GQ  V   G V+A+
Sbjct: 123 VIGSDAAHAQLIAPGGLIAGPAPSESMLQDVETGAKVAAAAGALDIGQGCVVCDGLVLAV 182

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKS----GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           E  EGTD ML+R   C      + G+     GVLVK  K  Q+ R DLP+ G  TV+   
Sbjct: 183 EAQEGTDEMLRR---CAGLPEAIRGQPEARRGVLVKRPKPVQERRIDLPTTGVSTVELAA 239

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
            AGLAGIA+E G +L+L + L+++ A E GIF+ G   E  +
Sbjct: 240 AAGLAGIAIEQGGALMLNRPLMEQRAAELGIFIFGFPAELGL 281


>gi|126462141|ref|YP_001043255.1| hypothetical protein Rsph17029_1373 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103805|gb|ABN76483.1| protein of unknown function DUF1009 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 273

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 141/274 (51%), Gaps = 20/274 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL-PLGDFCVLRSI---- 60
           IIAGSG LP ++A+A R   +  ++A++        + F    L P   F V R +    
Sbjct: 8   IIAGSGDLPRHLAEALRSAGEALLVAAL--------EGFPPEGLAPDITFRVERLVPFLR 59

Query: 61  -LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L +  + R+V AGA+ R P +    F    +  + ++I  +   G+ A L+A I + E 
Sbjct: 60  ALEEAGVSRLVFAGAVSR-PRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIFEE 117

Query: 120 YGVSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
            G SV G  EI P+L+   G L GT  P+   +RD   A    EA+  +DVGQ AV   G
Sbjct: 118 EGFSVAGVAEIAPDLVPDAGILCGT--PSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQG 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV   
Sbjct: 176 LCLAVEALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARA 234

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             AGLAG+  EAG  ++L++    + A+EAG+F+
Sbjct: 235 AAAGLAGLVWEAGGVILLDRAEAVRAAEEAGLFL 268


>gi|313894592|ref|ZP_07828155.1| conserved hypothetical protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313440782|gb|EFR59211.1| conserved hypothetical protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 278

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 133/281 (47%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC--SFDWQDFECRELPLGDFCVLR 58
           M ++ +IAG G LP    +AA +   E V+  V+ +   +   +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGALPVEFMRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDISVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L    +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKNEGVVELTMLGKVTKEILFKGLSFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG      P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTVYLKPFMPKVGVFSKAQPTEEQWADICFGFELAKQMGGLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDK-------CILRGGELGRGEAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   A+  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDMANRHGIVICAVDQEF 271


>gi|269120957|ref|YP_003309134.1| hypothetical protein Sterm_2350 [Sebaldella termitidis ATCC 33386]
 gi|268614835|gb|ACZ09203.1| protein of unknown function DUF1009 [Sebaldella termitidis ATCC
           33386]
          Length = 268

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 134/285 (47%), Gaps = 24/285 (8%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECREL------PLGDF 54
           M ++ II G+G LP    + A  K  E     V     FD  D + +E        +   
Sbjct: 1   MNKIAIITGAGKLPTLFLEEAVDKGYE-----VYPIYLFDGVDNKIKEYANSVKYSIAQV 55

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFS-IKDSLRISKMIWQLVSGGNAAILKAS 113
             +   L    I ++++ G +++     +L FS +K  L  +K++    +  +  IL A 
Sbjct: 56  GKIIKYLKSKEISKLIMLGKVEK-----NLIFSNLKFDLVATKILMSTRNKKDKNILMAI 110

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
           I+ LE  G+ V+  + ++   + +           D  + I   +++A  L+ +D GQ+ 
Sbjct: 111 INHLEKEGIEVLPQNFLMDRYMAKEVEYTRRKALPDDMKTIEIGIEAARMLTAIDAGQTV 170

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAK 233
           V     VVALEG+EGTD  ++R  +        AGK  ++VKM +  QD R D+P+IG  
Sbjct: 171 VVKNESVVALEGVEGTDKTIERAGEY-------AGKDCIVVKMARPNQDYRIDIPTIGID 223

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           TV+   +    GI +E+   L +++E V   AD+  IF+ GI  E
Sbjct: 224 TVKKAAEIKAKGIVIESEHMLFIDQEEVINFADKNKIFIKGIKYE 268


>gi|294793360|ref|ZP_06758505.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
 gi|294455791|gb|EFG24156.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
          Length = 261

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 110/219 (50%), Gaps = 10/219 (4%)

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E  
Sbjct: 46  LKKEEVQELTMLGKVTKEILFKGLTFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIERE 102

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V     V
Sbjct: 103 GFKVLDQTAYLKPFMPKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHKAV 162

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++I 
Sbjct: 163 MAIEAIEGTDK-------CILRGGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSMID 215

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           +G   +A+EA K++ ++++ V   AD  GI +C +D+EF
Sbjct: 216 SGCKVLAVEAEKTIFVQQQDVLNMADRHGIVICAVDQEF 254


>gi|114569943|ref|YP_756623.1| hypothetical protein Mmar10_1393 [Maricaulis maris MCS10]
 gi|114340405|gb|ABI65685.1| protein of unknown function DUF1009 [Maricaulis maris MCS10]
          Length = 280

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/274 (31%), Positives = 137/274 (50%), Gaps = 11/274 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNE-CSFDWQDFECRELPLGDFCVLRSIL 61
           +L +IAG G LP  + +A   +  +PV   VL      D+   +   L +G+   +   L
Sbjct: 8   KLGLIAGGGDLPLEILRA---QAGKPVFVVVLKGFADRDYGGADSVSLSVGEIGGIIKAL 64

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSG--GNAAILKASIDLLES 119
                  I  AG + R P+++ L    +  + + +    L +G  G+ A+++  +D  E 
Sbjct: 65  RGAGCDAICFAGYVTR-PDLKSLKMDARGLIMVPR---ALAAGRKGDDAVIRVVVDEFER 120

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G +VVGA  ++ +  +  G LG        + D   AM  A  +  LD+GQ AV  GG 
Sbjct: 121 AGFAVVGADSLLGQDGLPAGCLGDAAAVEAHRDDAGKAMMVAAEIGRLDIGQGAVVAGGV 180

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNV 238
           V+A+E  EGT++ML+R+       R  A +  GVL K  K  Q+ R DLP+IG  TV+  
Sbjct: 181 VLAVEAQEGTNAMLERVAGLPAPIRGDASRRLGVLAKRPKPIQERRVDLPTIGVGTVERC 240

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             AGLAGI LEA  +L++++  V+      G+FV
Sbjct: 241 AAAGLAGIVLEADGALIVDRAGVEGALKRHGLFV 274


>gi|91202217|emb|CAJ75277.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 277

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 135/274 (49%), Gaps = 13/274 (4%)

Query: 7   IAGSGMLPYYVAKAARLKNDEPVIA-SVLNECSFDWQDFECRELPLG--DFCVLRSILHQ 63
           +AG+G  P   AK A+  N+ PVIA ++  E S +   +  +   +G      L  I  Q
Sbjct: 1   MAGNGRFPILFAKGAK-NNNVPVIAVAIEGETSPEVGQYVEKLYWIGVAQIGKLIKIFKQ 59

Query: 64  YNIGRIVVAGAIDRRPNVQDL-CFSIKDSLRISKMIWQLVSG-GNAAILKASIDLLESYG 121
            N+ + V+AG + +      L    +   LR   + ++ V    +  +L A  D L   G
Sbjct: 60  ENVSKAVMAGGLTKGNMFSSLRNLRLLPDLRTINLWYKNVKRRDDQTLLGAVADELLKDG 119

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + +  +   VP+LL + G L    P      DI  A+  A+ +++  +GQ  V     V+
Sbjct: 120 IELQSSTLYVPQLLAKKGILTKKNPTDREMEDIYFAVPLAKEIAKHGIGQCIVVKEKVVL 179

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  EGTD  ++R       G  L     V++K+CK   D R D+P++G  T++ + ++
Sbjct: 180 AVEAFEGTDEAIRR-------GGKLGRSDVVVIKVCKQNFDPRFDIPTVGLDTIKTLKES 232

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             + +ALEAG++++L+ E     AD+AGI V GI
Sbjct: 233 SASVLALEAGRTIILDIEETLAEADKAGISVIGI 266


>gi|283782060|ref|YP_003372815.1| hypothetical protein Psta_4307 [Pirellula staleyi DSM 6068]
 gi|283440513|gb|ADB18955.1| protein of unknown function DUF1009 [Pirellula staleyi DSM 6068]
          Length = 300

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 93/168 (55%), Gaps = 6/168 (3%)

Query: 108 AILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSEL 167
            ++   +D     G+ +  A +  PELLV+ G L    P+     DI    + A+ +  +
Sbjct: 129 TLMNVVVDEFARDGIELAPATDFSPELLVKHGLLTRRKPSAAELADIRYGWQVAKEMGRI 188

Query: 168 DVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADL 227
           D+GQS    G  VVA+E IEGTDS ++R       G++       +VK+ K QQDMR D+
Sbjct: 189 DIGQSVAVKGRVVVAVEAIEGTDSCIRR------AGQLCPQGGFTVVKVAKPQQDMRFDV 242

Query: 228 PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           P+IG  T++ +I AG   +A+EAGK+++L++  V   A++ G+ +  +
Sbjct: 243 PTIGKLTIETMIAAGAKVLAIEAGKTILLDEPEVAALANKHGLSIISL 290


>gi|319789883|ref|YP_004151516.1| protein of unknown function DUF1009 [Thermovibrio ammonificans
           HB-1]
 gi|317114385|gb|ADU96875.1| protein of unknown function DUF1009 [Thermovibrio ammonificans
           HB-1]
          Length = 256

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 83/142 (58%), Gaps = 7/142 (4%)

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV V      +  LL+  G +    P+ +V  D+   M+ A+ ++ LD+GQ+ V     V
Sbjct: 113 GVKVANPESYLKRLLLTKGEIIGKPPSEEVLEDLKFGMEIAKEIASLDIGQTVVVKNKTV 172

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+EGIEGTD       +C   G  LAGK  V+ K  + +QDMR D+P++G KTV+ +  
Sbjct: 173 IAVEGIEGTD-------ECIKRGAALAGKGFVVCKAARREQDMRVDVPTVGIKTVKLIET 225

Query: 241 AGLAGIALEAGKSLVLEKELVK 262
            G  G+A+EAGK+ +L++E V+
Sbjct: 226 LGGKGLAVEAGKTYLLDRERVE 247


>gi|302038338|ref|YP_003798660.1| hypothetical protein NIDE3039 [Candidatus Nitrospira defluvii]
 gi|300606402|emb|CBK42735.1| conserved protein of unknown function, DUF1009 [Candidatus
           Nitrospira defluvii]
          Length = 280

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 135/285 (47%), Gaps = 31/285 (10%)

Query: 2   KRLLIIAGSGMLP-----------YYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP 50
           +R+ +IAG+G  P           Y V+  A     +P +A  ++   +         + 
Sbjct: 15  QRIGLIAGNGRFPIIFADNAKRLGYSVSAVAHEGETDPELARHVDHIHW---------IK 65

Query: 51  LGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAIL 110
           +G F  L   L    + R V+ G I +      +  +++   R   +  +L+   +  IL
Sbjct: 66  IGQFGKLIEALKGDGVQRAVMLGGIKK----THIFSTVRPDFRALALAAKLIHLKDDDIL 121

Query: 111 KASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVG 170
           +   + +E  G+ +  +   +  +LV+ G+L    P++    DI       + +  LD+G
Sbjct: 122 RRVAEEIEQEGIQICESTFGLEGILVEEGTLTRREPSKKEWEDIRYGWDVGKQIGALDIG 181

Query: 171 QSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSI 230
           Q  V     +VA+E +EGTD  ++R       G  LA    V+VK CK QQD+R DLP++
Sbjct: 182 QCVVVKDRVIVAVEAVEGTDGAIRR-------GGELAHGGAVVVKRCKPQQDLRFDLPAV 234

Query: 231 GAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           G +T++ +     + +ALEAG+ ++L+++     A+ AGI + G+
Sbjct: 235 GPRTIEVMESVKASVLALEAGRGILLDRDDTIAKANRAGIAIIGM 279


>gi|221639131|ref|YP_002525393.1| hypothetical protein RSKD131_1032 [Rhodobacter sphaeroides KD131]
 gi|221159912|gb|ACM00892.1| Hypothetical Protein RSKD131_1032 [Rhodobacter sphaeroides KD131]
          Length = 273

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 140/270 (51%), Gaps = 12/270 (4%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQ 63
           IIAGSG LP ++A+A R    E ++ + L   S +    D   R   L  F  LR+ L  
Sbjct: 8   IIAGSGALPRHLAEALR-SAGEALLVAALEGFSPEGLAPDITFRVERLVPF--LRA-LEA 63

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
            ++ R+V AGA+ R P +    F    +  + ++I  +   G+ A L+A I + E  G S
Sbjct: 64  ESVTRLVFAGAVSR-PRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIFEEEGFS 121

Query: 124 VVGAHEIVPELLVQVGSLGTC-VPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           V G  EI P+L+   G L  C  P+   +RD   A    EA+  +DVGQ AV   G  +A
Sbjct: 122 VAGVAEIAPDLVPDAGIL--CGAPSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQGLCLA 179

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV     AG
Sbjct: 180 VEALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARAAAAG 238

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           LAG+  EAG  ++L++    + A+EAG+F+
Sbjct: 239 LAGLVWEAGGVILLDRAEAVRAAEEAGLFL 268


>gi|312897545|ref|ZP_07756965.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310621397|gb|EFQ04937.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 274

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 136/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS--FDWQDFECRELPLGDFCVLR 58
           M ++ ++AG G LP    +AA     E ++ SV+ + +     +     E+ +     + 
Sbjct: 4   MGKVGLLAGVGNLPVEFLRAAHQMGHEVIVISVVPDTAAALKTEADAYYEINVAKLDKII 63

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + + F      R  K++ +L +  +  I+ A +D L 
Sbjct: 64  KTLLREGVTDVTMIGKVTKEILFKGIKFP---DFRAVKLLAKLRNRKDDTIMLAIVDELA 120

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              + V      +  L+   G L    P  + K DI    ++A+A+  +D+GQ+ V    
Sbjct: 121 KDNLVVADQTAYLKPLMPPPGVLTKRNPTEEEKEDIRFGFETAKAMGGMDIGQTVVVKHK 180

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+       C   G  L      +VK+ K  QD+R D+P++G +T+ ++
Sbjct: 181 AVMAIEAIEGTDA-------CIRRGGALGRGGACVVKVAKPNQDVRFDVPAVGKQTLLSM 233

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I++G   +A+EA K+L +E+E V   ADE  I +C +D  +
Sbjct: 234 IESGCTLLAMEAHKTLFVEQEEVLALADEHRICICAVDESY 274


>gi|114768807|ref|ZP_01446433.1| hypothetical protein OM2255_03735 [alpha proteobacterium HTCC2255]
 gi|114549724|gb|EAU52605.1| hypothetical protein OM2255_03735 [alpha proteobacterium HTCC2255]
          Length = 282

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 142/285 (49%), Gaps = 21/285 (7%)

Query: 4   LLIIAGSGMLPYYVAKAARLKN-DEPVIASVLNECSFDWQDFE-CRELPL--GDF---CV 56
           L I+AG+G LP  + +  +  N D  +I        F+  D    ++LP+    F     
Sbjct: 6   LAIVAGAGDLPIQIVEHCKNNNIDFKII-------HFEGVDLHWLKQLPVINAKFEKPNA 58

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
           L + L+     ++V AGA+ +RP +  L F  K  L+I+  +   +  G+   LK   ++
Sbjct: 59  LFASLNDCGCNQVVFAGAM-KRPKLNPLKFDAK-FLKIASKLLPALKKGDDTTLKIIAEI 116

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            E  G  ++   +I+  + V  G      P+ +   D++   +    +S+ D+GQ+ V  
Sbjct: 117 FEKEGFEIIATDKILKNIFVPEGVFTKKNPSENDLIDVMRGFEILNIISKADIGQACVIA 176

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKS---GVLVKMCKSQQDMRADLPSIGAK 233
            G  + +E I+G+D++++     + N   L  +S   GV +K  K  QD R D+P++G +
Sbjct: 177 QGLCLGIETIQGSDALIKFAGQSKKN--YLNDESDGKGVFIKSPKLNQDKRIDVPTVGVE 234

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           T++ + +AGL+G+A++A    +++K      A++ GIF+  +  +
Sbjct: 235 TIRTIAEAGLSGLAIKADCVQMIDKNACIDTANQLGIFITSVSSD 279


>gi|223935930|ref|ZP_03627845.1| protein of unknown function DUF1009 [bacterium Ellin514]
 gi|223895531|gb|EEF61977.1| protein of unknown function DUF1009 [bacterium Ellin514]
          Length = 361

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 138/281 (49%), Gaps = 47/281 (16%)

Query: 6   IIAGSGMLPYYVAKAAR-----------LKND-EPVIASVLNECSFDWQDFECRELPLGD 53
           IIAG+  LP   A+ AR            +N+ +P +A +++E    W       L +G 
Sbjct: 94  IIAGNRSLPLIFARQARSMGIKKLVAVGFENETDPKLAELVDELI--W-------LRVGQ 144

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKAS 113
              + S      + + V+ G I  +       F ++  LR   ++++L       I  A 
Sbjct: 145 LSKMISAFTDRGVTQCVMVGQISPKN-----LFDLRPDLRAMTLLFKLKEKNAHTIFGAI 199

Query: 114 IDLLESYGVSVVGAHEIVP--ELLVQVGS--LGTCVPNRDVKRDILAAMKSAEALSELDV 169
            + L+  GV ++   E +P  E L+  G   LG  + + D + D+    K A+ +S L+V
Sbjct: 200 ANELKKDGVELI---EAIPWLEPLMPAGEFRLGPKLSS-DQQADLAFGYKIAKEISRLEV 255

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSG--VLVKMCKSQQDMRADL 227
           GQ  V   G V+A+EG EGTD  L R       G  LAGK G  + VK+ K + D+R D+
Sbjct: 256 GQIVVVKNGTVLAVEGFEGTDKCLAR-------GGELAGKDGGAIAVKVAKEKHDLRFDI 308

Query: 228 PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE----LVKKH 264
           P IG +T++  + A ++ +ALEAG++L+LE E    L +KH
Sbjct: 309 PCIGPQTLETCVAARVSVLALEAGRTLLLEPEVCEQLARKH 349


>gi|294795179|ref|ZP_06760313.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
 gi|294453971|gb|EFG22346.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
          Length = 261

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 109/219 (49%), Gaps = 10/219 (4%)

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E  
Sbjct: 46  LKKEEVQELTMLGKVTKEILFKGLTFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIERE 102

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V      
Sbjct: 103 GFKVLDQTAYLKPFMPKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHKAA 162

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++I 
Sbjct: 163 MAIEAIEGTDK-------CILRGGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSMID 215

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           +G   +A+EA K++ ++++ V   AD  GI +C +D+EF
Sbjct: 216 SGCKVLAVEAEKTIFVQQQDVLDMADRHGIVICAVDQEF 254


>gi|254440125|ref|ZP_05053619.1| hypothetical protein OA307_4995 [Octadecabacter antarcticus 307]
 gi|198255571|gb|EDY79885.1| hypothetical protein OA307_4995 [Octadecabacter antarcticus 307]
          Length = 266

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 84/270 (31%), Positives = 126/270 (46%), Gaps = 15/270 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASV---LNECSFDWQDFECRELPLGDFCVLRSILH 62
           +IAG G LP  +A   R +    +I  +   ++E   D+         LG F    + L 
Sbjct: 5   LIAGLGGLPTALAATLRAQGRTVIICEMRGFVSEVDGDFHRIAFSFETLGTFL---AALK 61

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              +  + +AGA+ +RP V D       +L +   +   ++ G+   L A + L E  G 
Sbjct: 62  TAGVTDVCMAGAV-QRPKV-DPSLIDGATLPLVPRLMAAMAKGDNGTLSAIVALFEEQGF 119

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +VVGAH+I PELL   G + T V   +    I AA  +   + +LD GQ+ +     V+A
Sbjct: 120 AVVGAHDIAPELLPMSG-VHTQVAPPNFTTGIAAAQVALADMGQLDQGQAVLLRRSHVIA 178

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
            E   GT +ML  +   R NG   AG +  L K  K  Q+MR D+P IG  T     +AG
Sbjct: 179 REDDRGTAAMLDDL-QTRGNG---AGVT--LFKAPKPNQNMRVDMPLIGPDTALQAAEAG 232

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           LAGI +  G  +VL+   V    D   +F+
Sbjct: 233 LAGIVITHGGVMVLDLPEVISILDAHAMFL 262


>gi|15606496|ref|NP_213876.1| hypothetical protein aq_1276 [Aquifex aeolicus VF5]
 gi|2983714|gb|AAC07277.1| putative protein [Aquifex aeolicus VF5]
          Length = 305

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 126/271 (46%), Gaps = 16/271 (5%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC-RELPLGDFCVLRSILHQY 64
           +IAG G LP    K+A  K  E +   V         DFEC  ++  G    L  +L + 
Sbjct: 46  LIAGKGKLPLEFKKSAVQKGYEVITIGVEG-----ITDFECDYKVSFGKVGKLIKLLEKE 100

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
               +V+ G  + +  + DL       ++I   + +        ++K  +D +E  G   
Sbjct: 101 EAYSLVMLGKFEHKLALTDLFHFDLTGIQI---LSRAKDKRPETLIKTFMDYMEKRGFKF 157

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           +     +  +L + G +    P+     + L A + A+ ++ LDVGQ+ V     VVA+E
Sbjct: 158 IDPKPFLEGILAEKGPMTKKEPDNKTLEEALWAFEIAKTIASLDVGQTIVVKDKAVVAVE 217

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            +EGT   ++R       G  +AGK   ++K+ +  QD R D+P++G  T++ + + G  
Sbjct: 218 AMEGTQETIRR-------GGKIAGKGCTVIKVARRNQDYRIDVPTVGEDTLRVMKEVGAK 270

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            + LE GK  +++KE   K AD  GI V GI
Sbjct: 271 ALFLEEGKVFIVDKENFLKEADRLGICVYGI 301


>gi|284049019|ref|YP_003399358.1| protein of unknown function DUF1009 [Acidaminococcus fermentans DSM
           20731]
 gi|283953240|gb|ADB48043.1| protein of unknown function DUF1009 [Acidaminococcus fermentans DSM
           20731]
          Length = 273

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 128/263 (48%), Gaps = 18/263 (6%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRS 59
           K L +++G G LP  V + A+      V  +++     D +        + +G    +  
Sbjct: 3   KTLGVLSGVGHLPVDVVRGAKKAGYRTVAIALVPGTHEDLEKEADVFHAINIGKVGKIFK 62

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFS---IKDSLRISKMIWQLVSGGNAAILKASIDL 116
            L Q  +  + + G +      +++ +S   +    +  K++  L    +  I+ A +  
Sbjct: 63  TLKQEGVDEVTMIGKV-----TKEILYSGGILVPDWQAIKILMSLPDRHDDTIMNALVAK 117

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G+ V+     + +L+ Q G L    P  +   D+      A+ +  LD+GQ+ V  
Sbjct: 118 LEDMGIHVMDQTLFLTDLMPQEGVLSKRQPTPEEWEDMKYGFAMAKKIGGLDIGQTVVVK 177

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              ++A+E IEGTD+ + R       G++  GK  ++ K  K  QD R D+P +G KTV+
Sbjct: 178 NKAIMAVEAIEGTDACILR------GGKL--GKGAIVAKTAKPAQDNRFDMPGVGVKTVE 229

Query: 237 NVIKAGLAGIALEAGKSLVLEKE 259
           ++I++G AGI +EAG++L++E+E
Sbjct: 230 SMIESGCAGIVMEAGRTLLVERE 252


>gi|288818397|ref|YP_003432745.1| hypothetical protein HTH_1086 [Hydrogenobacter thermophilus TK-6]
 gi|288787797|dbj|BAI69544.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
 gi|308751989|gb|ADO45472.1| protein of unknown function DUF1009 [Hydrogenobacter thermophilus
           TK-6]
          Length = 260

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 128/273 (46%), Gaps = 14/273 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           ++ +IAG G LP    K A  K  E     V    +     F    LPLG    L  +L 
Sbjct: 2   KVCLIAGWGELPAIFQKEASKKGIEVFTVGVKGITT----AFADEYLPLGHVGKLIKLLE 57

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  I +IV+ G  + R       F   DS+ +S ++ +        I+ + I  LE  G 
Sbjct: 58  REGIKKIVMLGKFEHRLIFSH--FFTFDSIALS-ILRKAKDKRPQTIITSFIQELEKRGF 114

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
             +     +  +L + G +G   P+ +   D L     A+ ++ LD+GQ+ V     VV+
Sbjct: 115 EFIDPKPYLESILAKSGKIGFLEPSPEAMEDGLWGFSIAKEIASLDIGQTIVVKNKSVVS 174

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGT   ++R       G+ LAGK+  ++K+ +  QD R D+P+IG  TVQ V K  
Sbjct: 175 VEAMEGTQEAIER------AGK-LAGKNCRVIKVARRSQDFRIDVPTIGPLTVQAVKKIK 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
              I LEAGK  +L+ E     A E+GI + G+
Sbjct: 228 GDAIFLEAGKIYMLDMEKTISLAKESGIALYGL 260


>gi|292669899|ref|ZP_06603325.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648696|gb|EFF66668.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 267

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 140/279 (50%), Gaps = 16/279 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC--RELPLGDFCVLR 58
           M++L ++AG G LP   A+AAR +  E    ++L +   + Q+     R + +G    + 
Sbjct: 1   MEKLGLLAGVGHLPAACARAARAQGYEVHAIALLPDVDPELQEAASVYRAISIGSIAEIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFS--IKDSLRISKMIWQLVSGGNAAILKASIDL 116
           + L Q  I ++ + G + +     +L F+  I+    +  M+ QL +  +  I+   +  
Sbjct: 61  AYLRQEEIKKVTMIGKVTK-----ELLFTGAIQPDEMLRGMLMQLPNQNDDTIMMMFVGA 115

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           L   GV+ +    ++  L+   G L + +P    + D+   ++ A  +  LD+GQ+AV  
Sbjct: 116 LMKIGVTPLDQTALIRPLMPAAGILTSRLPTDAERADMEYGLQMAREIGRLDIGQTAVVK 175

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+ALE IEGTD+       C   G  LAG   V+ K  K QQD R D+P++G  T++
Sbjct: 176 NRAVMALEAIEGTDA-------CIRRGGALAGGGAVVAKAAKPQQDSRFDVPTVGLDTIE 228

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +++ A  + + LEA K+L ++KE     A+  GI +  +
Sbjct: 229 SLVAAKASALVLEADKTLFIDKERAVALAEANGITIAAM 267


>gi|196228849|ref|ZP_03127715.1| protein of unknown function DUF1009 [Chthoniobacter flavus
           Ellin428]
 gi|196227130|gb|EDY21634.1| protein of unknown function DUF1009 [Chthoniobacter flavus
           Ellin428]
          Length = 271

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 141/288 (48%), Gaps = 37/288 (12%)

Query: 2   KRLLIIAGSGMLPYY------------VAKAARLKNDEPVIASVLNECSFDWQDFECREL 49
           K L IIAG+G+ P              +A AA     +P + +++++   +W       +
Sbjct: 5   KTLAIIAGNGVYPQAMARAARAAGVSRLAVAAFQNETDPALTALVDQV--EW-------M 55

Query: 50  PLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNA-A 108
            +G    + + L +      V++G I  + N+ DL   IK  + ++++  +     NA +
Sbjct: 56  RVGQLGKMLNFLQKSGASHAVMSGQIHPK-NLFDLRPDIKALIVLARLKRR-----NAES 109

Query: 109 ILKASIDLLESYGVSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALSEL 167
           I  A  D ++S GV ++ A   + E L   G + G  +  RD + D+      A+  S L
Sbjct: 110 IFGAIADEMKSVGVELLPATTYMEEHLAPAGLIAGPKLKTRD-EEDLHYGFHIAKESSRL 168

Query: 168 DVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADL 227
           D+GQ+ V   G V+A+E  EGT++ ++R       G  L  K  ++VK+ K  QD R D+
Sbjct: 169 DIGQTVVVKNGTVLAVEAFEGTNAAIKR-------GGELGRKDAMMVKVSKPNQDFRFDV 221

Query: 228 PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           P IG  T++   +A L  I +EAG +L+LEKE +   A E  I + G+
Sbjct: 222 PVIGPLTLEAAREARLRAIGVEAGYTLLLEKEKLAALAQEHRISIFGL 269


>gi|238019679|ref|ZP_04600105.1| hypothetical protein VEIDISOL_01553 [Veillonella dispar ATCC 17748]
 gi|237863720|gb|EEP65010.1| hypothetical protein VEIDISOL_01553 [Veillonella dispar ATCC 17748]
          Length = 278

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 136/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLN--ECSFDWQDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   E V+  V+   + +   +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHVLGHEVVVIGVVPDVDPALKAEADAFYDIGVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEGVEELTMLGKVTKEILFKGLTFP---DLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTVYLKPFMPKVGVLSKTQPTDEQWADICFGFELAKQMGGLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD        C   G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDK-------CILRGGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   A+  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDLANRHGIVICAVDQEF 271


>gi|189219872|ref|YP_001940513.1| hypothetical protein Minf_1861 [Methylacidiphilum infernorum V4]
 gi|189186730|gb|ACD83915.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 280

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 128/279 (45%), Gaps = 23/279 (8%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP-------LGDFCV 56
           L IIAG G+ P  VA+AA+       +  + + C     D +   L        +G    
Sbjct: 17  LGIIAGRGVYPILVAEAAKKAG----VEKIYSVCFVSETDQKMESLSTTVEWIRVGQLSK 72

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
           +     +  + R ++AG +          F ++  L+   ++ +L      ++  A  + 
Sbjct: 73  MLQFFKKNEVKRAIMAGGV-----APSHLFELRPDLKTLLLLAKLKERNAHSLFGAIAEE 127

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  GV ++ A   + + LV  G  G     +    D+    + A+ ++ LD+GQS V  
Sbjct: 128 LEKIGVLLLKATTFLEDQLVPSGHFGGPQIKKRFWGDVEFGFRIAKEIARLDIGQSVVVK 187

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
            G V+++E  EGTD  ++R       G  L     +LVK+ K  QD R D+P IG KT+ 
Sbjct: 188 NGTVLSVEAFEGTDETMKR-------GGELGKGGAMLVKVSKPDQDFRFDVPVIGLKTID 240

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             ++ G+  I  E+ K+LVLEK  V + AD++ I + G 
Sbjct: 241 AALRYGIGVIVCESEKTLVLEKGKVIEMADQSKISLVGF 279


>gi|163782369|ref|ZP_02177367.1| hypothetical protein HG1285_06265 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882402|gb|EDP75908.1| hypothetical protein HG1285_06265 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 261

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 132/273 (48%), Gaps = 20/273 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYN 65
           +IAG G LP    + A  + +E  +  V         D     LP+G    L  +  +  
Sbjct: 5   LIAGKGRLPEVFREEAVKRGEEVFVVGVKGITDIKTDDL----LPVGKVGKLIKLFRKKG 60

Query: 66  IGRIVVAGAIDRRPNVQDLCFS--IKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           + R+V+ G  + R     L ++  ++  L+   ++ +      A+++KA + +LE  G  
Sbjct: 61  VDRVVMLGKFEHR-----LIYTSILQFDLKAFSVLRKAKDRRPASVVKAFMKVLEEEGFE 115

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
            +     + ELL + G++G   P+ +V  D L     A+ ++ELD+GQ+ V     VVA+
Sbjct: 116 FIDPRPYLEELLAEEGTMGRREPSEEVMEDGLFGFIIAKEVAELDIGQTIVVKDKAVVAV 175

Query: 184 EGIEGT-DSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           E +EGT +++L+         R+        VK+ +  QD R D+P++G +T++ +  A 
Sbjct: 176 EAMEGTQETILRGGRLGGKGVRV--------VKVARKNQDFRIDVPTVGVETLEALKTAK 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
              + LEAGK  V++KE   + AD   I V G+
Sbjct: 228 ADALFLEAGKVYVVDKEKFLRGADRLNISVVGL 260


>gi|294102482|ref|YP_003554340.1| protein of unknown function DUF1009 [Aminobacterium colombiense DSM
           12261]
 gi|293617462|gb|ADE57616.1| protein of unknown function DUF1009 [Aminobacterium colombiense DSM
           12261]
          Length = 270

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 90/170 (52%), Gaps = 8/170 (4%)

Query: 106 NAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALS 165
           + A+L   +  +E  G+ V G  +I+ +LL   G +     +    +D+         L 
Sbjct: 103 DHALLSRIVRTIEKTGIKVAGYRQILSDLLTPEGQVSARGLSDQEAKDVAYGCSILFHLL 162

Query: 166 ELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRA 225
            L  GQS V   G VVA+E +EGTD+MLQR       G ++ G  G ++KM ++ QD R 
Sbjct: 163 PLSFGQSIVIHSGAVVAVEAMEGTDAMLQR------AGTLVHG--GSVIKMMRADQDERF 214

Query: 226 DLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           D+P +G  T+  + KAG   +ALEAG++L+LEKE   + A    I V G+
Sbjct: 215 DIPVVGTHTLHMMEKAGQTCLALEAGRTLMLEKEAFLELAARLNIAVVGV 264


>gi|227825143|ref|ZP_03989975.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226905642|gb|EEH91560.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 276

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 131/281 (46%), Gaps = 12/281 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRS 59
           K L ++AG G LP  V + A+      V  +++ E   D          + +G    + S
Sbjct: 4   KTLGVLAGVGHLPVDVVRGAKQAGYRTVAIALVPETHEDLPKEADVFYAINIGKVGKIFS 63

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    +  + + G + +    +     I D  +  K++  L    +  I+ A +  LE 
Sbjct: 64  TLKNEGVSEVTMIGKVTKEILYKGGIL-IPD-WQAVKLLMSLPDRHDDTIMNALVAKLEE 121

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+     +  ++ + G L    P      D+    + A+ +  LD+GQ+ V     
Sbjct: 122 MGIHVMDQTLFLKHIMPEEGVLSRRKPTDKEWEDMKYGFRMAKKIGGLDIGQTVVVKDMA 181

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++A+E IEGTD+ ++R       G +  G+  ++ K  K  QD R D+P +G KT++++I
Sbjct: 182 IMAVEAIEGTDACIKR------GGSL--GRGAIVAKTAKPAQDHRFDVPGVGVKTMESMI 233

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           ++G AGI +E G++L +E+E     A+E  + V  +  E A
Sbjct: 234 ESGCAGIVMETGRTLFVEREQALALANEHNLVVVSMSEETA 274


>gi|171913838|ref|ZP_02929308.1| hypothetical protein VspiD_21705 [Verrucomicrobium spinosum DSM
           4136]
          Length = 278

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 127/275 (46%), Gaps = 31/275 (11%)

Query: 4   LLIIAGSGMLPYYVAKAARLKN-DEPVIASVLNEC---------SFDWQDFECRELP-LG 52
           + +IAG+G+ P    +AAR    D  V+A  ++E          +  W  F   +L  + 
Sbjct: 10  IALIAGNGVYPETFVRAARKAGVDRLVVAGFVDETRPSLEGSVDAMAW--FRVGQLSKMI 67

Query: 53  DFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKA 112
            F     + H   +G+I      D RP+++ L    +   R ++ ++    GG A     
Sbjct: 68  AFFKKEGVKHVVMVGQIAPKNLFDLRPDLRLLMMLARLKRRNAETLF----GGIA----- 118

Query: 113 SIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQS 172
             D ++  G+ ++ A   + E +   G +    P +    D       A+A S+LD+GQ+
Sbjct: 119 --DEMKKDGIELLPATTFLEEFMPAAGHVAGPNPKKRRWEDAEYGFTIAKASSKLDIGQT 176

Query: 173 AVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGA 232
            V   G V+A+E  EGT+  ++R       G  L   S  +VK+ K  QDMR D+P +G 
Sbjct: 177 VVVRNGTVLAVEAFEGTNEAIKR-------GGALGKGSATMVKVSKPNQDMRFDVPVVGP 229

Query: 233 KTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADE 267
            T+     AG+  IA+EAG +L+L++  V +   E
Sbjct: 230 DTISTAAAAGVDVIAVEAGMTLILDQSEVFRRCAE 264


>gi|254455326|ref|ZP_05068755.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082328|gb|EDZ59754.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 261

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 119/231 (51%), Gaps = 11/231 (4%)

Query: 42  QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQL 101
           +D     + +G F  + +++ + N  +++ AG I  +P    L   +K    +  +I + 
Sbjct: 39  KDVNSHRISIGKFGNIINLIKEKNSNKVLFAGKI-AKPKFSSLRLDLKGIYYMPSVI-KA 96

Query: 102 VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSA 161
              G+AAI+K+ I +L++ G+ V+ +     EL ++ G+     PN +    I   +   
Sbjct: 97  SKLGDAAIIKSIIKILDNEGIKVISSIYFNKELALKAGNYSKLKPNINELNSIKKGVVYF 156

Query: 162 EALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQ 221
           + L  LD  Q+ +     ++A EG +GT  ML ++    N         G+L+K+ K +Q
Sbjct: 157 KKLKSLDHVQAIIVKNNSILATEGKQGTKKMLSKLNKNSN---------GILIKLPKPKQ 207

Query: 222 DMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           D+R DLP+IG  T+++  K GL GI L++ +++ L+K+     A++  IF+
Sbjct: 208 DLRMDLPTIGINTLKDCKKFGLKGIVLKSKQNIFLDKDKCINFANKNKIFI 258


>gi|291532177|emb|CBL05290.1| Uncharacterized protein conserved in bacteria [Megamonas
           hypermegale ART12/1]
          Length = 196

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 104/198 (52%), Gaps = 10/198 (5%)

Query: 81  VQDLCFSIKDSLRISKMIWQLVS---GGNAAILKASIDLLESYGVSVVGAHEIVPELLVQ 137
            +++ FS +  L  ++MI  L S     +  ++ A +  L   G++      ++  ++ +
Sbjct: 6   TKEILFSGQHELPDARMIALLSSLKDRSDDTMMLAFVAELAKEGITTFDQTMLLKMIMPK 65

Query: 138 VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIV 197
            G L    P      D+    K A+AL  LD+GQ+ V     V+ALE IEGTD+      
Sbjct: 66  KGVLTKRQPTERENLDMEFGFKMAKALGGLDIGQTVVVKDKAVMALEAIEGTDA------ 119

Query: 198 DCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
            C   G  LA  + V+ K+ K  QD R D+P++G KT++++I+   +G+ +EAG++L+++
Sbjct: 120 -CILRGGKLACGNAVVAKVAKPAQDNRFDMPAVGVKTIESMIEVKASGLVIEAGRTLIVD 178

Query: 258 KELVKKHADEAGIFVCGI 275
           +E V   ADE  I +  +
Sbjct: 179 REKVLSLADENAITIVAM 196


>gi|260424776|ref|ZP_05733251.2| conserved hypothetical protein [Dialister invisus DSM 15470]
 gi|260403153|gb|EEW96700.1| conserved hypothetical protein [Dialister invisus DSM 15470]
          Length = 287

 Score = 82.0 bits (201), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 144/286 (50%), Gaps = 22/286 (7%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-----FECRELPLGDFC 55
           M+ + ++AG G+LP    +AA ++  + V  +V+       ++     +E     L    
Sbjct: 14  METVGLLAGIGILPVEFIEAAHIQGYKVVCIAVIPGVEKKLKEKADAYYEISVFKLNK-- 71

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASID 115
           V++++L +  +  + + G + +    +D    +   LR  K++ +L    N      +++
Sbjct: 72  VIKTLLSE-GVQEVTMLGKVTKEWLYKD---HVIPDLRALKVLNRL-RKKNFKDDTITLE 126

Query: 116 LLESYG---VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQS 172
           L+E  G   +SV+   + +  L+          P  +   D+    K+A+A+  +D+GQ+
Sbjct: 127 LVEELGKDGISVLDQTKYLKPLMPGPQIFTKRRPTENEMLDVAFGFKAAKAIGGMDLGQT 186

Query: 173 AVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGA 232
            V     V+A+E IEGTD+       C   G +LA    V+VK  K  QD+R D+P++G 
Sbjct: 187 VVIKDQAVMAVEAIEGTDA-------CIRRGGMLARGGAVVVKTAKPDQDLRFDVPAVGL 239

Query: 233 KTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +T+ ++++ G   +A+EA ++L +EK  V K AD AGI +  +++E
Sbjct: 240 ETLHSMMETGCKVLAIEAYRTLFVEKTSVLKEADCAGIAILSVEQE 285


>gi|45601659|gb|AAS71139.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 260

 Score = 82.0 bits (201), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 114/239 (47%), Gaps = 14/239 (5%)

Query: 26  DEPVIASVLNECSFDWQDFECRELPLG--DFCVLRSILHQYNIGRIVVAGAIDRRPNVQD 83
           ++P+  S++ E  F    +E R +P+       L  +  ++N+ R+++ G + +    ++
Sbjct: 4   EDPIFFSII-ESDFHVGMYEDRNIPIHIVKIGTLLKLCKRHNVDRLLLLGKVKKEIIFKN 62

Query: 84  LCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGT 143
           L F +K    +++MI    +  + +I K   D      ++++     +  L +  G    
Sbjct: 63  LKFDLKAIALLARMI----NKHDYSIFKTVADEFAKEKITIISQKTFLQSLFLPEGRFTK 118

Query: 144 CVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNG 203
               +    DI   M  AE ++ LD+GQ+ V +   V+A+E +EGTD  +     CR   
Sbjct: 119 KPLTQKELEDIAFGMDYAEKMAGLDIGQTVVVLDKSVLAVEAVEGTDLAI-----CRGGS 173

Query: 204 RILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE-KELV 261
               GK+ V  K  K  QD R DLP++G  T++ + +     +AL  G+++++  KE +
Sbjct: 174 FAKKGKATV-CKSSKPNQDHRFDLPTVGENTLKTMYENNCGTLALRTGETIIVHPKEFI 231


>gi|225164360|ref|ZP_03726625.1| protein of unknown function DUF1009 [Opitutaceae bacterium TAV2]
 gi|224801040|gb|EEG19371.1| protein of unknown function DUF1009 [Opitutaceae bacterium TAV2]
          Length = 291

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 128/277 (46%), Gaps = 20/277 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD----WQDFECRELPLGDFCVLRSIL 61
           +++G G+ P  VA++ R       + +   E   +    + + E R + +G    +   +
Sbjct: 29  LLSGKGLYPQLVARSIRAAGIPLRLVAFDEETPQELIATFPEAERRTILVGQLGKMLKAI 88

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +   G  ++AG I  R     L   +   L+   ++ +L       I  A    +E+ G
Sbjct: 89  RELRAGYALMAGQITPR----RLFKGLHPDLKALAILARLKRRNAETIFGAIASEIEALG 144

Query: 122 VSVVGAHEIVPELLVQVGSL--GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           V ++ A   +   L   G +  G     R+    +   +  A   + LD+GQ  V   G 
Sbjct: 145 VRLLDARCFIDAHLATPGVMTRGKFPIERE---SVDHGLHIARECARLDIGQGCVVRKGT 201

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E  EGTD ML+R+ + + +         V VK+ K+ QD R D+P  G +T++N+ 
Sbjct: 202 VLAVEAYEGTDPMLRRVGEFKTD-------EAVFVKVVKTAQDYRFDVPCFGLQTLENMH 254

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            +G+   A+EAG+ ++L+K  V   A E GI + G++
Sbjct: 255 ASGIKAAAIEAGRVIILDKPAVLARAHELGISLLGVE 291


>gi|114778068|ref|ZP_01452968.1| hypothetical protein SPV1_05682 [Mariprofundus ferrooxydans PV-1]
 gi|114551674|gb|EAU54227.1| hypothetical protein SPV1_05682 [Mariprofundus ferrooxydans PV-1]
          Length = 273

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 132/288 (45%), Gaps = 40/288 (13%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE------------- 48
           +R+ +IAG G  P  +A+A             LNE  F+      RE             
Sbjct: 7   RRIGLIAGYGHFPLELAQA-------------LNETGFEVHVVAAREETSKEIEALVAST 53

Query: 49  --LPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGN 106
             L +G    +     +  + ++V+AG + +      L  + +  L   K + +L    +
Sbjct: 54  CWLHVGQIGGMIKAFKKAGVDQVVMAGKVRK----LHLFRNFRPDLTAMKGLLRLKDRRD 109

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSE 166
            +IL    +LL   G++++        +L   G L      + +  DI      A+A++ 
Sbjct: 110 DSILNTIAELLAEAGLTLIDQTRYAGAMLASEGLLAGPAAAKRMP-DIRFGFTHAKAIAG 168

Query: 167 LDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRAD 226
           LD+GQ+ V     V+A+E IEGTD  + R       G + +GK+ V +K+ K  QD+R D
Sbjct: 169 LDIGQTIVVQDQAVLAVEAIEGTDEAITR------GGSLGSGKAAV-IKVAKPNQDLRFD 221

Query: 227 LPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           +P++G  T+  +  +G   +A+EA K+L++E++  ++ A   GI V G
Sbjct: 222 VPAVGPDTLATMHASGCTLLAVEAEKTLIIERQRFRELAASYGISVYG 269


>gi|218515875|ref|ZP_03512715.1| hypothetical protein Retl8_20421 [Rhizobium etli 8C-3]
          Length = 106

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 61/92 (66%), Gaps = 4/92 (4%)

Query: 3  RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
          RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11 RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAIIGIGDFAALDGLLN 70

Query: 63 QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRI 94
          +Y IGR+V++G++ RRP  ++    ++ +LRI
Sbjct: 71 RYGIGRVVMSGSVRRRPEWRE----VRPTLRI 98


>gi|269792896|ref|YP_003317800.1| hypothetical protein Taci_1287 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100531|gb|ACZ19518.1| protein of unknown function DUF1009 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 269

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 124/275 (45%), Gaps = 21/275 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNEC----SFDWQDFECRELPLGDFCVLRSIL 61
           +IAG G LP  +A+      + PVI S   +      +  +      L LG   +    +
Sbjct: 5   LIAGEGDLPVEIARRLTDLGEPPVIYSFREKAGGISKYALEVVSLHRLDLGGTLM---DM 61

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               + R+ +AG + +    Q          R+  ++  L    + ++L A +   E  G
Sbjct: 62  ASRGVQRVYMAGVVPKTLLYQPAMLD----QRVKDLVEGLRDRDDHSLLGAVVRAFEEAG 117

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V    +++ +L+  +G +    P      D+   +  A  +  L  GQ+ V     VV
Sbjct: 118 MEVRSYRDLILDLMAPLGHVAGPEPFPWQLSDVEYGVSVARRIVGLSFGQTVVVHRRSVV 177

Query: 182 ALEGIEGTDSMLQRIVD-CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           A+E +EGTD+ L R    CR          G +VKM ++ QD R D+P++G  T++ +  
Sbjct: 178 AVEAMEGTDATLLRAGSLCRG---------GTVVKMMRADQDERYDIPTVGPHTLKRMAS 228

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           A L  +A+EAG++++LE ++    A   GI V G+
Sbjct: 229 ASLKCLAVEAGRTIILEPQVFVPMAQSEGICVLGV 263


>gi|255264780|ref|ZP_05344122.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255107115|gb|EET49789.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 301

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/303 (28%), Positives = 136/303 (44%), Gaps = 40/303 (13%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF----DWQDFECRELPLGDFCVLRS 59
           L + AG G LP  V  A  ++   PV+   + +       + +  + R   LG    L +
Sbjct: 2   LALFAGQGSLPGLVMDA-MVRAGTPVVLCEMEQFPVKGLGETKRLQYRLEGLGP---LLA 57

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    +  +  AGAI R P+V DL      S  + + +      G+ A+L+  +++ E 
Sbjct: 58  ALEAEGVTDVCFAGAISR-PDV-DLTKVDAVSAPLVQRLVGAFGQGDDALLREVLEIFED 115

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  V  AHE+ P LL + G L    P    + D   A+    A+   DVGQ+ V  GG+
Sbjct: 116 RGFVVRAAHELAPMLLPEAGVLTRVQPIETHENDADKAVAVVAAMGVADVGQACVVSGGQ 175

Query: 180 VVALEGIEGTDSMLQRIVDCRNN--------------------GRILAG----------K 209
           V+A+E I GT  ML+ ++  + +                       L+G          K
Sbjct: 176 VLAIEAIPGTAWMLRSLIVPKEDAPSGPIGWAFDMVAVTVSDWAEWLSGINGQRDPALPK 235

Query: 210 SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAG 269
            G+L K  K  QD R DLP+IG +TV    +AGL GI +EAG  +V++     K ++  G
Sbjct: 236 GGILFKAPKPDQDRRIDLPTIGPETVMLAAEAGLDGIVIEAGGVMVIDAPQCVKISNGVG 295

Query: 270 IFV 272
           +F+
Sbjct: 296 LFL 298


>gi|153003992|ref|YP_001378317.1| hypothetical protein Anae109_1125 [Anaeromyxobacter sp. Fw109-5]
 gi|152027565|gb|ABS25333.1| protein of unknown function DUF1009 [Anaeromyxobacter sp. Fw109-5]
          Length = 271

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 125/284 (44%), Gaps = 26/284 (9%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC---------SFDWQDFECRELPL 51
           M  + +IAG G  P   A++AR      V  +  +E          +  W       + L
Sbjct: 3   MATIGLIAGGGRFPILFAESARRAGHRVVAVAHRSETDPALEGAVDALTW-------VKL 55

Query: 52  GDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILK 111
           G    +   L      + V+ GAI ++    D        LR+   +  + S  N  +L+
Sbjct: 56  GQVGHILDALRAGGATQSVMLGAITKKRFFTDAMLDAT-GLRVLARVG-IRSDDN--LLR 111

Query: 112 ASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQ 171
           A    LE  GV +      + + L   G LG   P  + + D    ++ A  +  LD+GQ
Sbjct: 112 AMARFLEEEGVPITDPTPYLRDRLAPEGVLGRHQPTDEERADAAYGLELARGIGRLDLGQ 171

Query: 172 SAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIG 231
           + V      +A+E +EGTD+ ++R       G +      V+ K  K  QD R DLP++G
Sbjct: 172 TVVVKERVALAVEALEGTDACIRR------GGELARSGGFVVAKAVKPNQDRRFDLPAVG 225

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             TV  + +AG   +A+EAG +LV++ E +   AD+A I + GI
Sbjct: 226 PDTVDTLREAGGRVLAVEAGATLVMDLERMVARADKARIVLMGI 269


>gi|87307079|ref|ZP_01089225.1| hypothetical protein DSM3645_01460 [Blastopirellula marina DSM
           3645]
 gi|87290452|gb|EAQ82340.1| hypothetical protein DSM3645_01460 [Blastopirellula marina DSM
           3645]
          Length = 301

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 83/157 (52%), Gaps = 8/157 (5%)

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
             + G+  V A +  P+LLV+ G L     ++    D+      A+A+   D GQS    
Sbjct: 132 FSNKGIEFVPATDYAPDLLVKFGQLAGKPLSKKQLSDVQYGWDLAKAIGLFDTGQSVAIK 191

Query: 177 GGRVVALEGIEGTDSMLQRIVD-CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV 235
               +ALE +EGTD  ++R    CR+ G         +VK+ K QQDMR D+P+IG  T+
Sbjct: 192 AQMALALEAVEGTDECIRRAGQLCRSGGF-------TIVKVAKPQQDMRFDVPTIGVGTI 244

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           + + ++G   + +EA K++++++  V   A++ GI +
Sbjct: 245 ETMAESGAVTLVIEADKTIIVDEPAVIALANKLGITI 281


>gi|323140923|ref|ZP_08075836.1| hypothetical protein HMPREF9443_00601 [Phascolarctobacterium sp.
           YIT 12067]
 gi|322414661|gb|EFY05467.1| hypothetical protein HMPREF9443_00601 [Phascolarctobacterium sp.
           YIT 12067]
          Length = 268

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 129/284 (45%), Gaps = 31/284 (10%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLR-- 58
           M+ L +++G G LP  VA++A+      V   V+             ELP G   V    
Sbjct: 1   MEVLGVLSGVGHLPVEVARSAKELGYHVVAVGVVPGID--------EELP-GSVDVYYDI 51

Query: 59  ---------SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAI 109
                    S L +  + ++ + G + +   V      I   LR  K++  +    +  I
Sbjct: 52  NIGKIGKIISTLKKNKVTKVTMIGKVTK--EVLYKAGRIVPDLRAIKILATIPDRKDDTI 109

Query: 110 LKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDV 169
           + A +  LE  G+ V+    ++  LL   G L    P      D+    + A+A+  LD+
Sbjct: 110 MNAIVKELEDEGIEVMDQTLLIKPLLPPPGVLTKRKPTEAELADMEFGFEMAKAIGGLDI 169

Query: 170 GQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLV-KMCKSQQDMRADLP 228
           GQ+ V     V+A+E IEGTD+       C   G  L GK GV+V K  K +QD R D+P
Sbjct: 170 GQTVVVKNRAVMAVEAIEGTDA-------CILRGGFL-GKGGVIVAKAAKPKQDQRFDIP 221

Query: 229 SIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
             G  T++++I AG  G  +EAG +++ E+E V   ADE  I +
Sbjct: 222 GFGTTTIESMIHAGATGAVIEAGNTIIPEREKVIALADEHNITI 265


>gi|121535891|ref|ZP_01667688.1| protein of unknown function DUF1009 [Thermosinus carboxydivorans
           Nor1]
 gi|121305510|gb|EAX46455.1| protein of unknown function DUF1009 [Thermosinus carboxydivorans
           Nor1]
          Length = 267

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 131/280 (46%), Gaps = 18/280 (6%)

Query: 1   MKRLLIIAGSGMLPYYVAKAAR---LKNDEPVIASVLNECSFDWQDFECRELPLGDFCVL 57
           MK + ++AG G LP   A+AAR          +   +++      D +   + +G+   +
Sbjct: 1   MKTIGLLAGVGRLPVEFARAARGMGFTVIAVAVVGGVDDELAAAAD-KLYTIGIGEVGKI 59

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFS--IKDSLRISKMIWQLVSGGNAAILKASID 115
            + L    +  + + G +      ++L FS  ++   R  +++  L    +  I+ A + 
Sbjct: 60  INTLKAEGVKEVTMLGKV-----TKELMFSGAVRLDERAQRLLAGLKDNSDDTIMLAFVR 114

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
            L + G+ V+     +  L+   G+L    P    + D+      A  +  LD+GQ+ V 
Sbjct: 115 ELAAEGIGVLDQTAFIRSLMPAPGTLTKREPTPAERADMEFGYAMARQIGGLDIGQTVVV 174

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTV 235
               V+A+E IEGTD+       C   G  L      + K+ K  QDMR D+P++G  T+
Sbjct: 175 KNKAVMAVEAIEGTDA-------CIRRGGALGRGGVTVAKVAKPNQDMRFDVPAVGVGTL 227

Query: 236 QNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + +I+AG   + +EAGK+LV+++E V   AD+  I +  +
Sbjct: 228 EAMIEAGATALVIEAGKTLVVDRERVVALADQHNITIVAM 267


>gi|330814020|ref|YP_004358259.1| hypothetical protein SAR11G3_01045 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487115|gb|AEA81520.1| hypothetical protein SAR11G3_01045 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 184

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 97/178 (54%), Gaps = 12/178 (6%)

Query: 94  ISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRD 153
           + K+I  L  G + A L   I+ L+   + VV   + +PELL +       +  +D  RD
Sbjct: 4   LPKIILSLKKGDSHA-LDFVINYLKLINMKVVSCTKYLPELLAENFVNKFKLSKQD-SRD 61

Query: 154 ILAAMKSAEALSE-LDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC--RNNGRILAGKS 210
           I         +++  DVGQS +   G V+ +E  EGTD M+ +      + N ++    S
Sbjct: 62  IEKGKAILNHVNKKYDVGQSIIVNKGLVIGIEAAEGTDEMILKSSSIMKKINKKM---PS 118

Query: 211 GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK----ELVKKH 264
           GVL+K+ K  QD+R DLP+IG  T++N IK GL GIAL+  +++ L++    +L+KK+
Sbjct: 119 GVLIKVPKKIQDLRVDLPTIGYDTIRNCIKIGLRGIALKKNQNIFLDQTKSSDLIKKN 176


>gi|182415681|ref|YP_001820747.1| hypothetical protein Oter_3873 [Opitutus terrae PB90-1]
 gi|177842895|gb|ACB77147.1| protein of unknown function DUF1009 [Opitutus terrae PB90-1]
          Length = 281

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 133/285 (46%), Gaps = 28/285 (9%)

Query: 2   KRLLIIAGSGMLPYYVAKAAR--------LKNDEPVIASVLNECSFDWQDFECRELPLGD 53
           + L +IAG G+ P  VA AAR        +  DE        E    + D + R L +G 
Sbjct: 15  RPLALIAGQGLYPQLVAAAARHAGVPLKLIAFDE----ETRPELIASFADADRRTLLVGQ 70

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKAS 113
              +  +L +++ G  ++AG I  R     L   +   L+  +++  L       I  A 
Sbjct: 71  LGKMLKMLREFDAGYALMAGQISPR----RLFRGLHPDLKAVRLLASLKRRNAETIFGAI 126

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILA-AMKSAEALSELDVGQ 171
              +E  G++++ A   + + L   G + G   P   + RD +   +  A   + LD+GQ
Sbjct: 127 AAEIEGLGITLLDARSFLDDQLATAGCMTGRSFP---IDRDYVEHGVHIARECARLDIGQ 183

Query: 172 SAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIG 231
             V   G V+A+E  EGTD ML+R    + +       + + VK  K+ QD R D+P  G
Sbjct: 184 GCVVRKGTVLAVEAYEGTDEMLRRAGAFKTD-------AALFVKTVKAGQDYRFDVPCFG 236

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            +T++ + +AG+A  ALEAG+ ++L++  V   A   GI + G +
Sbjct: 237 QRTLETMREAGIAAAALEAGRVIMLDRPAVLAQARTWGINLLGFE 281


>gi|294054921|ref|YP_003548579.1| protein of unknown function DUF1009 [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614254|gb|ADE54409.1| protein of unknown function DUF1009 [Coraliomargarita akajimensis
           DSM 45221]
          Length = 286

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 128/280 (45%), Gaps = 22/280 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-----QDFECRELPLGDFCVLRSI 60
           +IAG G  P   A+  R       + S   E   D+     +D E  ++ +G    +   
Sbjct: 20  LIAGKGRYPILTAERIRSAGIPLRVISFAGETDPDFVASIPRD-EHIQIKVGQLGKMLKS 78

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +      ++AG I  R   + L   +K +LRI   +  L       I  A    +E+ 
Sbjct: 79  LQKLGCAYALMAGQITPRRLFKGLHPDLK-ALRI---LNSLKIKNAETIFGAIASEIEAI 134

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNR-DVKRD-ILAAMKSAEALSELDVGQSAVSIGG 178
            + ++ A   + +   Q+ S G     +  V +D I   M+ A  L++LDVGQ AV   G
Sbjct: 135 NIQMLDARAFLDD---QMASPGIMTQGKLKVTQDAIDHGMQIARGLADLDVGQGAVVRKG 191

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A E  EGTD ML+R  + + +  I A       K  K  QD R D+P  G++T++ +
Sbjct: 192 TVIAAEAYEGTDPMLRRAGEFKTDDLIFA-------KTVKRVQDYRFDVPVFGSRTLEVM 244

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            +AG+    LE+GK ++L+KE + + A    I + G   E
Sbjct: 245 KEAGIETAVLESGKVIMLDKEALLQEAKRMKISLIGFSAE 284


>gi|86157513|ref|YP_464298.1| hypothetical protein Adeh_1086 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774024|gb|ABC80861.1| protein of unknown function DUF1009 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 268

 Score = 71.6 bits (174), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 129/277 (46%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M  + +IAG G  P   A++AR      V  +  +E   +   Q      + LG    L 
Sbjct: 1   MATIGLIAGGGRFPLLFAESARRAGHRVVAVAHKSETDPELAKQVDAITWVKLGQIGHLL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L      + V+ G+I ++    D   ++ D+  + +++ ++    +  +L+A    LE
Sbjct: 61  EGLRAGGASQCVMLGSITKKRFFAD---AMLDATGV-RVLARVAVRSDDNLLRAMARFLE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV++      + + L   G LG   P  +   D    ++ A  +  LD+GQ+ V    
Sbjct: 117 EEGVAITDPTPFLADRLAPEGVLGRHQPTPEELEDARYGLELARGIGRLDLGQTVVVKDR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E +EGTD+ ++R       G +      V+ K  K  QD R DLP++G  TV ++
Sbjct: 177 VALAVEALEGTDACIRR------GGELARSGGFVVAKAVKPHQDRRFDLPAVGPDTVVSL 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +A    +A+EAG +LV++   + + AD+A I + G+
Sbjct: 231 REARGRLLAVEAGATLVMDLPRMVELADKAKIVLLGL 267


>gi|197121556|ref|YP_002133507.1| hypothetical protein AnaeK_1145 [Anaeromyxobacter sp. K]
 gi|220916320|ref|YP_002491624.1| protein of unknown function DUF1009 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196171405|gb|ACG72378.1| protein of unknown function DUF1009 [Anaeromyxobacter sp. K]
 gi|219954174|gb|ACL64558.1| protein of unknown function DUF1009 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 268

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 128/278 (46%), Gaps = 14/278 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M  + +IAG G  P   A++AR      V  +  +E   +   Q      + LG    L 
Sbjct: 1   MATIGLIAGGGRFPLLFAESARRAGHRVVAVAHKSETDPELAKQVDAITWVKLGQIGHLL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L        V+ G+I ++    D   ++ D+  + +++ ++    +  +L+A    LE
Sbjct: 61  EGLRAGGATECVMLGSITKKRFFAD---AMLDATGV-RVLARVAVRSDDNLLRAMARFLE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV++      + + L   G LG   P  +   D    ++ A  +  LD+GQ+ V    
Sbjct: 117 EEGVAITDPTPFLTDRLAPEGVLGRHQPTPEELEDARYGLELARGIGRLDLGQTVVVKDR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSG-VLVKMCKSQQDMRADLPSIGAKTVQN 237
             +A+E +EGTD+       C   G  LA   G V+ K  K  QD R DLP++G  TV +
Sbjct: 177 VALAVEALEGTDA-------CIRRGGELAKSGGFVVAKAVKPHQDRRFDLPAVGPDTVVS 229

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + +A    +A+EAG +LV++   + + AD+A I + G+
Sbjct: 230 LREARGRLLAVEAGATLVMDLPRMVELADKAKIVLLGL 267


>gi|317051793|ref|YP_004112909.1| hypothetical protein Selin_1623 [Desulfurispirillum indicum S5]
 gi|316946877|gb|ADU66353.1| protein of unknown function DUF1009 [Desulfurispirillum indicum S5]
          Length = 266

 Score = 70.5 bits (171), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 120/266 (45%), Gaps = 21/266 (7%)

Query: 6   IIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRSILHQ 63
           II G G        A R K        +  E + +  D   R  ELP+     +      
Sbjct: 8   IICGQGDFARLAIDAYRQKGYRTFAVVLREENTMEVADKADRSMELPIEKIGRIIRFFRD 67

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           + +  ++ AG + ++  V    F+   ++R+ +   +     +A+++   +  LE  G  
Sbjct: 68  HGVTDLLFAGKVHKKV-VYRTIFTDITAMRLLR---RFKDHRDASMMNVIMYFLEEEGFR 123

Query: 124 VVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           ++   + + ELL   G + G   P  D+ RDI    + A  L++ ++GQ+   +   VVA
Sbjct: 124 ILPQTQYLEELLAPKGVIWGKIEP--DLARDIQYGYRIARMLADEEIGQTVAVLREAVVA 181

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
            E +EGTD  + R  +          +   +VK+ +++QD+R D+P +G +TV   ++A 
Sbjct: 182 AEALEGTDRTIVRAGEL--------ARDTTIVKVERTRQDLRFDVPVVGLETVTWAVQAR 233

Query: 243 LAGIALEAGKSLVLEKE----LVKKH 264
              +A+EA K    ++E    L +KH
Sbjct: 234 CRCLAMEAEKVFFFQREESIALARKH 259


>gi|310816022|ref|YP_003963986.1| hypothetical protein EIO_1560 [Ketogulonicigenium vulgare Y25]
 gi|308754757|gb|ADO42686.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 261

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 99/219 (45%), Gaps = 29/219 (13%)

Query: 26  DEPVIASVLNECSFDWQDFECRELPLGDFCV-----LRSILHQYNIGRIVVAGAIDRRPN 80
           D P +   +    FD    +  +LP   F V     L + L    +  + +AGAI RRP 
Sbjct: 23  DRPFLLCEMAGFPFD----DMADLPRHTFRVEQIGTLLADLRAKGVTEVCLAGAI-RRPA 77

Query: 81  VQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGS 140
                     +  ++++   +  G +A +L+A + + E  G  V GAH++ P LL + G 
Sbjct: 78  FDPAAIDAATAPILARLAPAMAQGDDA-LLRAVVGVFEGAGFIVRGAHDLAPALLPKAGV 136

Query: 141 LGTCV--PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD 198
           LG     P+ D  R        A +    DVGQ+ V   G+V+A+E   GTD ML     
Sbjct: 137 LGRVQLRPDGDATRAAAVHDALAAS----DVGQALVVRRGQVLAIEASFGTDFMLD---- 188

Query: 199 CRNNGRILAGKSG--VLVKMCKSQQDMRADLPSIGAKTV 235
                  + G++G  +  K  K+ QD+R DLP +G  TV
Sbjct: 189 ------TMEGRAGGALFYKAPKAGQDLRIDLPVVGPDTV 221


>gi|91761964|ref|ZP_01263929.1| hypothetical protein PU1002_01826 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91717766|gb|EAS84416.1| hypothetical protein PU1002_01826 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 261

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 113/231 (48%), Gaps = 11/231 (4%)

Query: 42  QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQL 101
            D     + +G F  + +++ +    +++ AG I  +P    L   +K  +     I + 
Sbjct: 39  NDINSNRISIGKFGKIINLIKEKKSKKVLFAGKI-AKPKFSTLRLDLK-GIYYMPSILKA 96

Query: 102 VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSA 161
              G+AAI+KA I +L++  + V+ +    PEL V+ G+      N+     I   +   
Sbjct: 97  AKLGDAAIIKAIIKILDNEKIKVLSSVFFNPELTVKRGNYTKLKANKSDINSIKMGITYF 156

Query: 162 EALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQ 221
             L  LD  Q+ +     ++A+E  +GT  ML ++              G+L+K+ K +Q
Sbjct: 157 NKLKSLDHVQAIIVKNDTIIAIEDHQGTKKMLSKLKKKS---------EGILIKLPKKKQ 207

Query: 222 DMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           D+R DLP+IG +T+++  K GL GI L++ K++ L+K      A++  IFV
Sbjct: 208 DLRMDLPTIGLQTLKDCKKYGLKGIVLKSKKNIFLDKAKSIAFANKNKIFV 258


>gi|71083615|ref|YP_266334.1| hypothetical protein SAR11_0918 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062728|gb|AAZ21731.1| Protein of unknown function (DUF1009) [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 261

 Score = 67.4 bits (163), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 111/231 (48%), Gaps = 11/231 (4%)

Query: 42  QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQL 101
            D     + +G F  +  ++ +    +++ AG I  +P    L   +K  +     I + 
Sbjct: 39  NDINSNRISIGKFGKIIDLIKEKKSKKVLFAGKI-AKPKFSTLRLDLK-GIYYMPSILKA 96

Query: 102 VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSA 161
              G+AAI+KA I +L++  + V+ +    PEL V+ G+      NR     I   +   
Sbjct: 97  AKLGDAAIIKAIIKILDNEKIKVLSSVFFNPELTVKRGNYTKLKANRKDINSIKMGITYF 156

Query: 162 EALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQ 221
             L  LD  Q+ +     ++A+E  +GT  ML ++              G+L+K+ K +Q
Sbjct: 157 NKLKSLDHVQAIIVKDNTILAIEDQQGTKKMLSKLK---------KKSEGILIKLPKKKQ 207

Query: 222 DMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           D+R DLP+IG +T+++  K GL GI L + K++ L+K      A++  IFV
Sbjct: 208 DLRMDLPTIGLQTLKDCKKYGLKGIVLRSKKNIFLDKAKCIAFANKNKIFV 258


>gi|255624344|ref|XP_002540464.1| conserved hypothetical protein [Ricinus communis]
 gi|223495547|gb|EEF21920.1| conserved hypothetical protein [Ricinus communis]
          Length = 88

 Score = 62.0 bits (149), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 1/86 (1%)

Query: 192 MLQRIVDCRNNGR-ILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEA 250
           ML+R+ D     R       GVL K  K  Q+ + DLP+IG  T+Q   +AGLAG+  EA
Sbjct: 1   MLRRVADLPQAIRGCPEAPKGVLAKAPKPIQETKVDLPTIGVATIQRAARAGLAGVVGEA 60

Query: 251 GKSLVLEKELVKKHADEAGIFVCGID 276
           G+ L+++++ V   AD+ G+FV G++
Sbjct: 61  GRLLIVDRDQVIACADDLGLFVYGVE 86


>gi|329850629|ref|ZP_08265474.1| hypothetical protein ABI_35380 [Asticcacaulis biprosthecum C19]
 gi|328840944|gb|EGF90515.1| hypothetical protein ABI_35380 [Asticcacaulis biprosthecum C19]
          Length = 346

 Score = 58.9 bits (141), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 43/69 (62%)

Query: 206 LAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHA 265
           +A + GVL K+ K  QD+R D+P+IG  T+++   +GL+GI   AG  LV++K      A
Sbjct: 275 IAHRKGVLAKLAKPIQDLRLDMPTIGVSTIEDAAASGLSGIVARAGHLLVVDKTATHARA 334

Query: 266 DEAGIFVCG 274
            E G+F+ G
Sbjct: 335 AELGVFLYG 343


>gi|254443489|ref|ZP_05056965.1| conserved hypothetical protein [Verrucomicrobiae bacterium DG1235]
 gi|198257797|gb|EDY82105.1| conserved hypothetical protein [Verrucomicrobiae bacterium DG1235]
          Length = 278

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%), Gaps = 7/97 (7%)

Query: 161 AEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQ 220
           A+ ++ LDVGQ  V   G V+A+E  EGTD ML+R    + +  I        VK  K +
Sbjct: 171 AQEMARLDVGQGVVVRKGTVLAVEAFEGTDPMLKRAGTFKTDQLIF-------VKTVKRE 223

Query: 221 QDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           QD R D+P  G +T++ + +  +    L+AG  +++E
Sbjct: 224 QDYRFDVPVFGLRTLEIMAEQNIRTAVLKAGDVIMVE 260


>gi|218678928|ref|ZP_03526825.1| hypothetical protein RetlC8_08599 [Rhizobium etli CIAT 894]
          Length = 68

 Score = 53.1 bits (126), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%)

Query: 3  RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
          RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +
Sbjct: 11 RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAVVGIGDFAALDGL 68


>gi|23011424|ref|ZP_00051785.1| hypothetical protein Magn03006056 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 201

 Score = 42.4 bits (98), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 15/145 (10%)

Query: 2   KRLLIIAGSGMLPYYVA---KAARLKNDEPVIASVLNECSFDWQDFECRE---LPLGDFC 55
           + L ++AG+G LP  VA    AAR     P    VL    F  +    R    + L D  
Sbjct: 6   RPLALVAGTGRLPELVAASLDAAR----RPF--RVLAVRGFTERAMRRRADAVVDLLDIP 59

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASID 115
               IL ++    ++ AG + R P+   L  +   ++R   ++  L +GG+  +L+A + 
Sbjct: 60  GTLRILKEWAPAAVIPAGGVAR-PSPAAL-LNAAHAVRNRDLLKSL-AGGDDRLLRAVLS 116

Query: 116 LLESYGVSVVGAHEIVPELLVQVGS 140
           LLE  G  V+G HE+ P+LL +VG+
Sbjct: 117 LLEENGHRVLGVHEVAPDLLGRVGT 141


>gi|18252653|gb|AAL66378.1|AF461795_6 unknown [Bartonella henselae]
          Length = 93

 Score = 40.4 bits (93), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%)

Query: 3  RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
          R  IIAG+G+LP  +A+        P +  + +E       +E  EL + +   L  IL 
Sbjct: 13 RTAIIAGNGVLPITIAQELEKNGQNPFLVLLRDEADALLYRYEHCELSIVELARLVKILK 72

Query: 63 QYNIGRIVVAGAIDRRP 79
             I  IV+AG + RRP
Sbjct: 73 AAEICNIVLAGGVKRRP 89


>gi|16079014|ref|NP_389837.1| hydrolase [Bacillus subtilis subsp. subtilis str. 168]
 gi|221309855|ref|ZP_03591702.1| hypothetical protein Bsubs1_10801 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314178|ref|ZP_03595983.1| hypothetical protein BsubsN3_10727 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319101|ref|ZP_03600395.1| hypothetical protein BsubsJ_10658 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323374|ref|ZP_03604668.1| hypothetical protein BsubsS_10772 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|81815810|sp|O34842|MHQD_BACSU RecName: Full=Putative hydrolase MhqD
 gi|2415393|gb|AAB72061.1| YodD [Bacillus subtilis]
 gi|2529480|gb|AAB81172.1| YolF [Bacillus subtilis subsp. subtilis str. 168]
 gi|2634348|emb|CAB13847.1| putative hydrolase [Bacillus subtilis subsp. subtilis str. 168]
          Length = 200

 Score = 38.1 bits (87), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%)

Query: 19  KAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRR 78
           + + L+N  P     L+E  FD +D   R   L DF    +  HQ+N GR++  G  +  
Sbjct: 44  RGSVLENGMPRFFKRLSEGVFDEKDLVVRTRELKDFIDEAAETHQFNRGRVIAVGYSNGA 103

Query: 79  PNVQDLCFSIKDSLR 93
                L F  KD L+
Sbjct: 104 NIAASLLFHYKDVLK 118


>gi|291414368|ref|XP_002723432.1| PREDICTED: NLR family, pyrin domain containing 11 [Oryctolagus
           cuniculus]
          Length = 1102

 Score = 38.1 bits (87), Expect = 1.3,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 85  CFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTC 144
           C SI   L +SK +  L           S++ L+++GV V+    + P   +Q   L  C
Sbjct: 794 CSSIGRVLLLSKTLKHL---------DLSVNFLQNHGVLVLTLPLMFPTCKLQELELSGC 844

Query: 145 VPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRI 196
             N DV RDI +A+ + + L  L++G + +   G  +  E +      L+ I
Sbjct: 845 FFNGDVCRDIASAIVNNQNLRSLELGSNYLGDAGVTLLCEALRHPSCKLENI 896


>gi|321311601|ref|YP_004203888.1| putative hydrolase [Bacillus subtilis BSn5]
 gi|320017875|gb|ADV92861.1| putative hydrolase [Bacillus subtilis BSn5]
          Length = 200

 Score = 38.1 bits (87), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%)

Query: 19  KAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRR 78
           + + L+N  P     L+E  FD +D   R   L DF    +  HQ+N GR++  G  +  
Sbjct: 44  RGSVLENGMPRFFKRLSEGVFDEKDLVVRTRELKDFIDEAAETHQFNRGRVIAVGYSNGA 103

Query: 79  PNVQDLCFSIKDSLR 93
                L F  KD L+
Sbjct: 104 NIAASLLFHYKDVLK 118


>gi|149924001|ref|ZP_01912385.1| hypothetical protein PPSIR1_06556 [Plesiocystis pacifica SIR-1]
 gi|149815130|gb|EDM74682.1| hypothetical protein PPSIR1_06556 [Plesiocystis pacifica SIR-1]
          Length = 345

 Score = 37.4 bits (85), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 53/111 (47%), Gaps = 16/111 (14%)

Query: 81  VQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGS 140
           V DL   I+      K  WQ V+ GNAA  +A+ +L    G  + GA E         G 
Sbjct: 228 VSDLDVYIRSGFGEDKAGWQRVALGNAASGEANDEL----GARIQGAAE---------GE 274

Query: 141 LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI---GGRVVALEGIEG 188
            G  +P  D+   + AA++ +   S+LD+ Q+A++I   GGR    +  EG
Sbjct: 275 GGWQLPRIDIGNAVEAALEESALASDLDILQAAITIHSQGGRQAYRDRAEG 325


>gi|150391405|ref|YP_001321454.1| fructose-1,6-bisphosphate aldolase, class II [Alkaliphilus
           metalliredigens QYMF]
 gi|149951267|gb|ABR49795.1| fructose-1,6-bisphosphate aldolase, class II [Alkaliphilus
           metalliredigens QYMF]
          Length = 309

 Score = 37.0 bits (84), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 93  RISKMI--WQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDV 150
           +IS ++  + LV  G + +L   +++   YG ++ GA  +  E+L Q  SLG C  N D 
Sbjct: 198 KISSLLPNFPLVLHGASTVLPEFVEMCNQYGGNIPGAQGVPEEMLTQAASLGVCKINIDT 257

Query: 151 KRDILAAMKSA 161
             D+  AM +A
Sbjct: 258 --DLRLAMTAA 266


>gi|117925240|ref|YP_865857.1| 50S ribosomal protein L11P methyltransferase [Magnetococcus sp.
           MC-1]
 gi|117608996|gb|ABK44451.1| [LSU ribosomal protein L11P]-lysine N-methyltransferase
           [Magnetococcus sp. MC-1]
          Length = 299

 Score = 36.6 bits (83), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 153 DILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGV 212
           D L+  ++  ++ +L  G   ++I  R + +  +  TD+    +   + NGR+    SG+
Sbjct: 151 DRLSLQQTPVSMLDLGTGSGILAIAARKLGIPHVIATDNDPIAVATAQENGRLNGIVSGL 210

Query: 213 LVKMCKS-QQDMRADL--PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHA 265
            V++C +  QD+ A L   +I A  +Q ++K GL G  L+   +L+L   L  + A
Sbjct: 211 EVRLCDTVPQDVTAQLITANILAPVIQAMLKQGLKG-CLQPKGTLLLSGILAGEQA 265


>gi|194337753|ref|YP_002019547.1| tRNA modification GTPase TrmE [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194310230|gb|ACF44930.1| tRNA modification GTPase TrmE [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 473

 Score = 35.8 bits (81), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 56/134 (41%), Gaps = 14/134 (10%)

Query: 108 AILKASIDLLESYGVSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALS- 165
           A L   IDLL++  +  +            V  + GT     D  R++L  ++S   L  
Sbjct: 129 AFLNGRIDLLQAEAIGEMIHARTESAFRTAVTQMQGTLSLRLDAMRELL--LRSCALLEL 186

Query: 166 ELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRA 225
           ELD  +  V    R    E + G    L R+VD   +GR+L  K GV   +        A
Sbjct: 187 ELDFSEEDVEFQSRTQLQEELAGLQEELHRLVDSYQHGRLL--KEGVATVI--------A 236

Query: 226 DLPSIGAKTVQNVI 239
            LP+ G  T+ NV+
Sbjct: 237 GLPNAGKSTLLNVL 250


>gi|308807120|ref|XP_003080871.1| Ran GTPase-activating protein (ISS) [Ostreococcus tauri]
 gi|116059332|emb|CAL55039.1| Ran GTPase-activating protein (ISS) [Ostreococcus tauri]
          Length = 930

 Score = 35.4 bits (80), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 122 VSVVGAHEIVPEL-LVQVGSLG-TCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           ++  GA E + EL L +   L  T   + D  RD+  A+ + + L+ +  G     IGGR
Sbjct: 92  LATSGALEGLEELSLAETPELAETPRSDDDEMRDVFEALVTVKGLNLMRCG-----IGGR 146

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQ 221
           V ALE   GT +   R V+ R+NG + A  +  L++ C++ +
Sbjct: 147 VWALERAMGTKTATCRSVNLRDNG-LDADDARALIRACEANE 187


Searching..................................................done


Results from round 2




>gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040445|gb|ACT57241.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 281

 Score =  351 bits (902), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI
Sbjct: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY
Sbjct: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV
Sbjct: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK
Sbjct: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
Sbjct: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281


>gi|315121985|ref|YP_004062474.1| hypothetical protein CKC_01175 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495387|gb|ADR51986.1| hypothetical protein CKC_01175 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 281

 Score =  340 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 233/281 (82%), Positives = 257/281 (91%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           MKRLLIIAGSG+LPYYVAKAARL NDEPVIASVLNECSFDW+DFE + LPLGD CVLRSI
Sbjct: 1   MKRLLIIAGSGILPYYVAKAARLNNDEPVIASVLNECSFDWKDFESQALPLGDLCVLRSI 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L+QYNIGRIVVAGAI RRP++QDLCFSIKDS +I K+IWQLVSGG+AAILKA ID LE Y
Sbjct: 61  LNQYNIGRIVVAGAISRRPSIQDLCFSIKDSFKIPKLIWQLVSGGDAAILKAVIDFLEGY 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GVSVVGAHE+VP+LL Q GSLG+C+P + +KRDI +AMKSAEALS+LD+GQSAVS+GGRV
Sbjct: 121 GVSVVGAHEVVPDLLTQKGSLGSCIPTKGIKRDIFSAMKSAEALSDLDIGQSAVSVGGRV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEGIEGTDSMLQRIVDCR NG+IL GKSGVLVKM KSQQDMRADLPSIG  TVQNVIK
Sbjct: 181 VALEGIEGTDSMLQRIVDCRKNGKILVGKSGVLVKMFKSQQDMRADLPSIGLMTVQNVIK 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGL+GIALE GKSL+LEK+LVKK ADEAGIF+ GIDREF I
Sbjct: 241 AGLSGIALEYGKSLILEKDLVKKSADEAGIFIYGIDREFKI 281


>gi|242279985|ref|YP_002992114.1| hypothetical protein Desal_2519 [Desulfovibrio salexigens DSM 2638]
 gi|242122879|gb|ACS80575.1| protein of unknown function DUF1009 [Desulfovibrio salexigens DSM
           2638]
          Length = 279

 Score =  319 bits (819), Expect = 2e-85,   Method: Composition-based stats.
 Identities = 91/280 (32%), Positives = 142/280 (50%), Gaps = 14/280 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRS 59
           + + +IAG G  P  VAK A  + +  V        +F+  ++     EL LG    L S
Sbjct: 6   ETIGLIAGGGQFPLLVAKGAAAQGNRVVAVFFKGHSNFEVSEYTDASVELKLGQLNKLIS 65

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 + ++V+AG I++   +      I+   R +K++++L + G+  +L+A     E 
Sbjct: 66  FFKNNGVSKVVMAGTINKPKAL-----DIRPDFRAAKLLFKLATKGDDVLLRAIASEFEV 120

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ VVG HE  P+LL   G L    PN     D+    K A  L  LD+GQ  V   G 
Sbjct: 121 EGMEVVGPHEYAPDLLTPSGFLTKRKPNDVESGDLAFGWKIARELGRLDIGQCVVVREGI 180

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V A+E IEGTD+ ++R       G  L GK   +VK+ K  Q+ R D+PSIG KT+Q + 
Sbjct: 181 VTAVEAIEGTDAAVKR-------GCELGGKGCCIVKVFKPGQEKRVDMPSIGLKTIQGMK 233

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           + G   + +EAGKSL  + +   + AD+ GI + G+++E 
Sbjct: 234 ELGATCLGVEAGKSLFFDLDESVQFADKYGITIVGLNQEL 273


>gi|222085868|ref|YP_002544399.1| hypothetical protein Arad_2233 [Agrobacterium radiobacter K84]
 gi|221723316|gb|ACM26472.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 293

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 143/278 (51%), Positives = 192/278 (69%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAGSG LP YVA+AAR   ++PVI ++ NE   DW  F+   L +G+F  L ++  
Sbjct: 11  RLAIIAGSGFLPAYVAEAARQAGEDPVILALTNEADRDWSAFDHATLGVGNFAGLEAVFR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y I R+V++G + RRP  +++  + +    +   I  L+SGG+ A+L+  I L+E+ GV
Sbjct: 71  RYGIDRVVMSGGVARRPAWREIHPTWRVIKELPSTIRTLLSGGDNAVLQMVIRLIEAGGV 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL   G LG   P+++  RDI    K+A+AL  LDVGQ AVS+GGRVVA
Sbjct: 131 RVVGAHEIAPDLLATTGPLGKLSPSKEDLRDIAQGAKAADALGLLDVGQGAVSVGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD M++R+   R  GRI   + GVLVK+CK QQD+RADLPSIG  TV N  KAG
Sbjct: 191 LEGAEGTDQMIERVAGLRAEGRISTRRRGVLVKLCKPQQDVRADLPSIGVSTVLNAKKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           LAG+A+EAG++LVLE++ V   ADEAG+F+CGIDR  +
Sbjct: 251 LAGVAVEAGRALVLERDAVIAAADEAGLFICGIDRGLS 288


>gi|209549193|ref|YP_002281110.1| hypothetical protein Rleg2_1594 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534949|gb|ACI54884.1| protein of unknown function DUF1009 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 293

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 139/277 (50%), Positives = 192/277 (69%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+D++   + +GDF  L  +L 
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEDYDHAVIGIGDFAALDGLLS 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y +GR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGVGRVVMSGSVARRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P+ + +RDI  A ++A+ L  LDVGQ A+SIGGRVVA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGATTPSEEDRRDIRRAAEAADMLGRLDVGQGAISIGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI   + G LVK+CK QQD+RADLP+IG  T+ N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISPRRRGALVKLCKPQQDIRADLPAIGVSTILNAKKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           L GIA+EAG+SLVL++  V K ADEAG+FVCGIDR  
Sbjct: 251 LGGIAVEAGRSLVLDRPAVIKAADEAGLFVCGIDRGL 287


>gi|86357545|ref|YP_469437.1| hypothetical protein RHE_CH01924 [Rhizobium etli CFN 42]
 gi|86281647|gb|ABC90710.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 293

 Score =  315 bits (809), Expect = 4e-84,   Method: Composition-based stats.
 Identities = 140/277 (50%), Positives = 189/277 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++  E    W+ ++   + +GDF  L  + +
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKEESDPRWEGYDHAVIGIGDFAALEGLFN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y +GR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGVGRVVMSGSVRRRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  + +RDI  A  +AE L  LDVGQ AVSIGGRVVA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGAAAPGEEDRRDISQAANAAETLGRLDVGQGAVSIGGRVVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG  T+ N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISPRRRGVLVKLCKPQQDIRADLPAIGVATILNAAKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAGIA+EAG+SLVL++  V   ADEAG+FVCGIDR  
Sbjct: 251 LAGIAIEAGRSLVLDRAAVISAADEAGLFVCGIDRGL 287


>gi|150396361|ref|YP_001326828.1| hypothetical protein Smed_1142 [Sinorhizobium medicae WSM419]
 gi|150027876|gb|ABR59993.1| protein of unknown function DUF1009 [Sinorhizobium medicae WSM419]
          Length = 295

 Score =  315 bits (808), Expect = 5e-84,   Method: Composition-based stats.
 Identities = 134/277 (48%), Positives = 186/277 (67%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AAR + + P I ++  E   DW  F+     +GDF  +     
Sbjct: 14  RLAIIAGAGALPHHVAEAARRQGENPFIIALSREADADWTGFDHTVCAIGDFAAISHTFE 73

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP  +D+  ++K   ++ ++   L+SGG+ A+L+  I+L+E+ G 
Sbjct: 74  AEKIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLMSGGDDAVLRMVIELIEASGA 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL  VG LG   P  + +RDI A + +A AL  LDVGQ AV++GGRVVA
Sbjct: 134 HVIGAHEVVPGLLADVGPLGRHAPTDEDQRDIRAGIAAANALGALDVGQGAVAVGGRVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ D R +GRI   + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 194 LEGAEGTDAMLARVSDLRKDGRISVRRRGVLVKLCKPQQDERADLPSIGPSTVAEAHAAG 253

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAGIA+EAG++LVLE+  + + AD +G+FV GI+R  
Sbjct: 254 LAGIAIEAGRALVLERTRLVEAADRSGMFVLGIERNL 290


>gi|116251988|ref|YP_767826.1| hypothetical protein RL2232 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256636|emb|CAK07724.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 293

 Score =  314 bits (806), Expect = 8e-84,   Method: Composition-based stats.
 Identities = 142/277 (51%), Positives = 195/277 (70%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGFLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAVIGIGDFAALEGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y IGR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRTLMKMPATIRTLLSGGDDRVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LGT +P  + +RDI  A ++AE L  LDVGQ AV+IGGR+VA
Sbjct: 131 RVVGAHEIAPDLLAAVGPLGTAIPGEEDRRDISRAAEAAEMLGRLDVGQGAVAIGGRIVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML+R+ D R  GRI   + G LVK+CK QQD+RADLP+IG  TV N  KAG
Sbjct: 191 LEGLEGTDEMLERVADLRAAGRISPRRRGALVKLCKPQQDIRADLPAIGVSTVLNARKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAG+A+EAG+SLVL++  V K ADEAG+FVCGIDR  
Sbjct: 251 LAGVAVEAGRSLVLDRAAVIKAADEAGLFVCGIDRGL 287


>gi|222148851|ref|YP_002549808.1| hypothetical protein Avi_2512 [Agrobacterium vitis S4]
 gi|221735837|gb|ACM36800.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 290

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 136/274 (49%), Positives = 199/274 (72%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAGSGMLP YVA+AAR   ++P I  + NE    W  F+   + +GD   L S++ 
Sbjct: 7   RLAIIAGSGMLPVYVAEAARAAGEDPFILPLKNEADQRWDGFQSAVIGVGDMAGLSSLIK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           ++ I R+V++G + +RPN +++  +++  +++   +  L+SGG+ A+LK  I L+ES G 
Sbjct: 67  RHGIKRVVMSGGVKKRPNFKEIHVNLRFLVKLPFAVKTLLSGGDDAVLKMVIQLIESQGC 126

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL ++G LG+  P  D +RDI AA K+A+AL  LDVGQ AVS+GGR+VA
Sbjct: 127 RVVGAHEIAPQLLAELGPLGSSRPTDDDRRDIAAAAKAADALGRLDVGQGAVSVGGRIVA 186

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD MLQR+ + R+ GRI + +SGVLVK+CK QQD+RADLP+IG  T++N  +AG
Sbjct: 187 LEGVEGTDRMLQRVAELRSEGRISSRRSGVLVKLCKPQQDIRADLPTIGQSTIENAARAG 246

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           L+GIA++AG++L+L+++   + AD AGIF+ GI+
Sbjct: 247 LSGIAVQAGRALLLQRQETLRQADAAGIFISGIE 280


>gi|241204515|ref|YP_002975611.1| hypothetical protein Rleg_1787 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858405|gb|ACS56072.1| protein of unknown function DUF1009 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 293

 Score =  312 bits (801), Expect = 3e-83,   Method: Composition-based stats.
 Identities = 140/277 (50%), Positives = 193/277 (69%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAVIGVGDFAALEGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y IGR+V++G++ RRP  +++  +++  +++  +I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRTLMKMPAVIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  + +RDI  A  +AE L  LDVGQ AV+IGGR+VA
Sbjct: 131 RVVGAHEIAPDLLAYVGPLGAAAPGEEDRRDIRRAADAAEMLGRLDVGQGAVAIGGRIVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML+R+   R  GRI   + G LVK+CK QQD+RADLP+IG  TV N  KAG
Sbjct: 191 LEGLEGTDEMLERVAGLRAAGRISPRRRGALVKLCKPQQDIRADLPAIGVSTVLNARKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAG+A+EAG+SLVL++  V K ADEAG+FVCGIDR  
Sbjct: 251 LAGVAVEAGRSLVLDRAAVIKAADEAGLFVCGIDRGL 287


>gi|190891618|ref|YP_001978160.1| hypothetical protein RHECIAT_CH0002021 [Rhizobium etli CIAT 652]
 gi|190696897|gb|ACE90982.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 293

 Score =  311 bits (798), Expect = 7e-83,   Method: Composition-based stats.
 Identities = 142/277 (51%), Positives = 194/277 (70%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRPWEGYDHAIIGIGDFAALDGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +Y IGR+V++G++ RRP  +++  +++  +++   I  L+SGG+  +L+  I L+E  G 
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRILMKVPAAIRTLLSGGDDTVLQMVIRLIEGNGR 130

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            VVGAHEI P+LL  VG LG   P  D +RDI  A ++AE L  LDVGQ AVSIGGR+VA
Sbjct: 131 RVVGAHEIAPDLLASVGPLGAVAPGEDDRRDINRAAEAAETLGRLDVGQGAVSIGGRIVA 190

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML R+   R  GRI A + GVLVK+CK QQD+RADLP+IG  TV N  KAG
Sbjct: 191 LEGLEGTDEMLDRVAGLRAAGRISARRRGVLVKLCKPQQDVRADLPAIGLSTVLNAGKAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           LAGIA+EAG+SLVL++  V + AD AG+FVCG+DR+ 
Sbjct: 251 LAGIAVEAGRSLVLDRAAVIRAADGAGLFVCGLDRDL 287


>gi|297568837|ref|YP_003690181.1| protein of unknown function DUF1009 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924752|gb|ADH85562.1| protein of unknown function DUF1009 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 281

 Score =  309 bits (793), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 89/282 (31%), Positives = 139/282 (49%), Gaps = 13/282 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M +L IIAG G  P  VAKAAR    E V+ +   E   +  +    C+ + LG    L 
Sbjct: 4   MTKLGIIAGGGQFPLLVAKAARDNGRETVVVAHRGESWPELAEVADHCQWVKLGQLQKLL 63

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           +  H++ +   V+AG I +    +     I    +   +  ++ +  + AIL+A   LL 
Sbjct: 64  NFFHRHGVTECVLAGTITKTRMFR----DIWPDFKALALWRRIDARQDDAILRALAGLLA 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V  +   +  LL   G LG   P+     DI    + A  +  LD+GQ  V    
Sbjct: 120 DEGIQVAPSTLYLQNLLFPRGVLGQKKPDEQQWEDIRFGWRIARQVGALDIGQCVVVRDR 179

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ ++R       G  LAG+  V+VK+ K  QD R DLP+IG +T+  +
Sbjct: 180 AVLAVEAIEGTDAAIKR-------GGELAGELAVVVKVRKPNQDFRFDLPAIGPRTISGM 232

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
            +   A +A+EAG++L+ + E   + AD AGI + G+  E  
Sbjct: 233 SEVKAAVLAVEAGQALLFDPEETVRLADRAGIAILGLSEEEG 274


>gi|319404361|emb|CBI77961.1| phosphatidate cytidyltransferase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 290

 Score =  309 bits (792), Expect = 3e-82,   Method: Composition-based stats.
 Identities = 107/271 (39%), Positives = 160/271 (59%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+    +   P +  +  E      D+E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPTVVAQELEKRGQNPFLVLLRGEADMALYDYEHCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  I++AG + +RP++  L      +L +   +++ +  G+  +L+A I +LE YG 
Sbjct: 73  AAEIHNIILAGGVKKRPSLLQLRPDW-TTLSVLSKLFKALRSGDDTLLRAFIRILEDYGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHE+VP+LL     +L     N     DIL A ++A +L  LD+GQ+AV+I GRVV
Sbjct: 132 CVIGAHEVVPDLLAPIEFNLTVQRANSKQNADILLAAEAARSLGRLDIGQAAVAIDGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  +GTD+ML+R+ + R   +I+  + GVLVK  K QQD R DLPSIG  TV N  K+
Sbjct: 192 AVEDSKGTDNMLKRVQEMRERQKIVP-QGGVLVKCVKPQQDHRVDLPSIGPTTVINAAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 251 GLSGIAVEAKKSLILSLEKTIEEANKRSLFI 281


>gi|116751168|ref|YP_847855.1| hypothetical protein Sfum_3750 [Syntrophobacter fumaroxidans MPOB]
 gi|116700232|gb|ABK19420.1| protein of unknown function DUF1009 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 649

 Score =  308 bits (791), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 134/274 (48%), Gaps = 13/274 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           +R+ +IAGSG  P   A AAR    E V      E       +  E   L LG    + +
Sbjct: 14  ERIGLIAGSGQFPLLFAHAARQAGVEVVALGFQGETDPALSKYVNEFHMLKLGQLSRMIN 73

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  I R  +AGAI++      +        R  K +  L +  + ++L+A  D LES
Sbjct: 74  AFRRAGITRAAMAGAINKTKLYTRIRPDW----RAVKFLNSLRNKKDDSLLRAFADELES 129

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ +  +   +P LL   G L    PN   + DI+   K A+ +  LD+GQ  V     
Sbjct: 130 EGIKIEPSTMFLPSLLAPEGILTRRKPNHREQVDIVFGWKMAKVIGGLDIGQCLVVKNQA 189

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGI+GTDS + R       G  L  +  ++VK+ K  QD+R D+P++G  T++ + 
Sbjct: 190 VLAVEGIDGTDSTILR-------GGRLCREGAIIVKVSKPIQDLRFDVPAVGYDTIETMK 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +     +A+EAGK+L+ ++E +   AD AGI + 
Sbjct: 243 RVKARVLAVEAGKTLMFDREKMIDAADAAGISIL 276


>gi|319407365|emb|CBI81012.1| phosphatidate cytidyltransferase [Bartonella sp. 1-1C]
          Length = 290

 Score =  308 bits (790), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 102/271 (37%), Positives = 159/271 (58%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+    +   P +  +  E      D+E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPTVVAQELEKRGQNPFLVLLRGEADMTLYDYEHCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  +++AG + +RP++  L      +L     +++ +  G+  +L+A I +LE YG 
Sbjct: 73  AAEIHNVILAGGVKKRPSLLQLRPDW-TTLSALSKLFKALRSGDDTLLRAFIRILEDYGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHE+VP+LL     ++     N     DI+ A ++A +L  LD+GQ+AV++ G+VV
Sbjct: 132 CVIGAHEVVPDLLAPIEFNVTVQRANSKQNADIILAAEAARSLGRLDIGQAAVAVDGQVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  +GTD+ML+R+ + R   +I+  + GVLVK  K QQD R DLPSIG  TV N  K+
Sbjct: 192 AVEDSKGTDNMLRRVQEMRERQKIVP-QGGVLVKCVKPQQDYRVDLPSIGPTTVINAAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 251 GLSGIAVEAKKSLILSLEKTIEEANKRSLFI 281


>gi|319408405|emb|CBI82060.1| phosphatidate cytidyltransferase [Bartonella schoenbuchensis R1]
          Length = 290

 Score =  305 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 107/276 (38%), Positives = 166/276 (60%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAG+G+LP  VA+A   +  +P +  + +E      ++E  EL +G+   L   L 
Sbjct: 13  RVAIIAGNGILPVAVARALEERGQKPFLVLLRDEADAALYNYEHCELSIGELARLFKTLK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  I  +++AG + +RP +  L       L + K +++ +  G+ ++LKA I ++E++G 
Sbjct: 73  KAAICNVILAGGVKKRPTLLQLRPDWTTLLALPK-LFKALGSGDDSLLKACIRVIEAHGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHE++P+LL     +L +    +    DI  A K+   L +LDVGQ+AV+I GRVV
Sbjct: 132 QVIGAHEVLPDLLAPIEFNLTSRRATQKENVDIQLAAKATRLLGQLDVGQAAVAINGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD ML+R+ + R   +I   K GVLVK  K QQD R DLPSIG  TV NV K+
Sbjct: 192 ALEGAEGTDDMLRRVHEMRERKQIPL-KGGVLVKSAKPQQDHRVDLPSIGPTTVINVAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL GIA+EA +SL+L  +   + A++  +F+   ++
Sbjct: 251 GLVGIAVEANRSLILSLKETIEEANKHSLFIETFEK 286


>gi|319899033|ref|YP_004159126.1| phosphatidate cytidyltransferase [Bartonella clarridgeiae 73]
 gi|319402997|emb|CBI76552.1| phosphatidate cytidyltransferase [Bartonella clarridgeiae 73]
          Length = 285

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 103/271 (38%), Positives = 155/271 (57%), Gaps = 4/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+    +   P I  +  E       ++  EL + +   L  +L 
Sbjct: 9   RTAIIAGNGVLPIVVAQELEKRGQNPFIVLLRGEADVALYSYQHCELSIVELARLFKVLK 68

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  +++AG + +RP++  L      +L     +++ +  G+  +LKA I ++E  G 
Sbjct: 69  ATEIHNVILAGGVKKRPSLLQLRPDW-TTLSALSKLFKALRSGDDTLLKAFIRVVEDRGF 127

Query: 123 SVVGAHEIVPELLVQVGS-LGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL  +   L           DIL A+++A  L  LD+GQ+AV+I GRVV
Sbjct: 128 CVVGAHEVVPDLLAPIECNLTLQSATPKQSADILLAIEAARLLGRLDIGQAAVAIDGRVV 187

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  +GTD+ML+R+ + R    +   + GVLVK  K QQD R DLPSIG  TV NV K+
Sbjct: 188 AVEDSKGTDNMLKRVQEIRERQHLP--QGGVLVKCAKPQQDYRVDLPSIGPTTVINVAKS 245

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 246 GLSGIAVEAKKSLILSLEKTIEEANKHSLFI 276


>gi|296122606|ref|YP_003630384.1| hypothetical protein Plim_2359 [Planctomyces limnophilus DSM 3776]
 gi|296014946|gb|ADG68185.1| protein of unknown function DUF1009 [Planctomyces limnophilus DSM
           3776]
          Length = 294

 Score =  303 bits (778), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 79/282 (28%), Positives = 138/282 (48%), Gaps = 11/282 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC--RELPLGDFCVLRS 59
           +R+ ++AG+G  P   A+AA+ +  + V   V    S +  +     +E PL  F     
Sbjct: 11  QRVGLLAGAGRFPISFAEAAKKQGIKVVCVGVAGMASPELAEHCHIYQEGPLARFGYAMK 70

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLC-FSIKDSLRISKMIWQLV--SGGNAAILKASIDL 116
           +  ++ + R+++AG I++    Q    F +    R  +M +     +  +  IL A I  
Sbjct: 71  VFKRHRVDRLIMAGKIEKTVLFQSWRIFRLLPDFRTLRMWYSFATSNRKDDTILLAVIRE 130

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            E        A +  PELLV+ G L    P     RDI      A+ +  LDVGQS V  
Sbjct: 131 FERDNFHFDSALDYCPELLVKHGFLTRRKPTDAQWRDIRFGWSLAKEMGRLDVGQSVVVN 190

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD  ++R  +    G         +VK+ K  QD R D+P+IG +T++
Sbjct: 191 DMAVIAVEAIEGTDRCIRRAAELCRRG------GFTVVKVAKPNQDRRFDVPTIGIQTIR 244

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            + +AG   +A+EAG+++++++    + AD+ GI +  ++ +
Sbjct: 245 TMHEAGGRVLAVEAGQTIIIDEPEAVELADKLGIAIVSLNAD 286


>gi|299134989|ref|ZP_07028180.1| protein of unknown function DUF1009 [Afipia sp. 1NLS2]
 gi|298589966|gb|EFI50170.1| protein of unknown function DUF1009 [Afipia sp. 1NLS2]
          Length = 284

 Score =  303 bits (777), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 96/276 (34%), Positives = 149/276 (53%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ +A +   +   PV   +   C      ++      +G F  +   L 
Sbjct: 11  VGLIAGGGVLPFALADSLLAQGRTPVFIGLKGFCDPQRIVNYRHHWFSVGQFGSIMKALR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     I   G +  RP  +DL F    ++R+   I + + GG+  IL A+  + E  G 
Sbjct: 71  EEGCSDITFIGNLV-RPAFKDLRFDWL-AMRLIPRILKGLRGGDDHILSATARVFEDGGF 128

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+G  ++ P+LL+  G L    P+     D     +   A+S  DVGQ+ V I G VV+
Sbjct: 129 RVLGVRDLAPDLLMPSGCLTHAQPDAASLNDAAKGREVLRAISPFDVGQAVVVIDGHVVS 188

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E I GTD++L RI + R +GR+ A    GVLVK  K  QD+R DLP++G +T++ V +A
Sbjct: 189 IEDIAGTDALLVRIKELRESGRLRAKPGRGVLVKAPKQGQDLRLDLPALGPQTIRGVAEA 248

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGIA+ AG S+V E + + + AD AGIFV G++ 
Sbjct: 249 GLAGIAVMAGHSVVAEPQAMVEAADNAGIFVVGLES 284


>gi|319405833|emb|CBI79465.1| phosphatidate cytidyltransferase [Bartonella sp. AR 15-3]
          Length = 290

 Score =  302 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 108/271 (39%), Positives = 155/271 (57%), Gaps = 3/271 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAGSG+LP  VA+    +   P +  +  E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGSGVLPRVVAQELEKRGQNPFLVLLRGEADVALYSYEYCELSIVELARLFKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  +++AG + +RP++  L         +SK+   L S G+  +L++ I +LE  G 
Sbjct: 73  ATEIRNVILAGGVKKRPSLLQLRADWATLSALSKLFKALRS-GDDTLLRSFIRILEDRGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHEIVP+LL      L           DIL A+++A  L  LD+GQ+AV+I GRVV
Sbjct: 132 CVIGAHEIVPDLLAPIEFDLTVQRATPKQNADILLAVEAARMLGRLDIGQAAVAIDGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  EGTD+ML+R+ + R   +I+  + GVLVK  K QQD R DLPSIG  TV N  K+
Sbjct: 192 AVEDAEGTDNMLKRVQEMREKQQIVP-QGGVLVKCVKPQQDYRVDLPSIGPTTVINAAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           GL+GIA+EA KSL+L  E   + A++  +F+
Sbjct: 251 GLSGIAVEAKKSLILSLEKTIEEANKRSLFI 281


>gi|325292748|ref|YP_004278612.1| hypothetical protein AGROH133_05895 [Agrobacterium sp. H13-3]
 gi|325060601|gb|ADY64292.1| hypothetical protein AGROH133_05895 [Agrobacterium sp. H13-3]
          Length = 293

 Score =  302 bits (775), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 132/278 (47%), Positives = 186/278 (66%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL I+AGSG LP +VA AAR   + P I  + ++  FDW  F+   + +GD   L  +L 
Sbjct: 6   RLAIVAGSGQLPLHVAAAAREMGENPFIVQLRDDSQFDWSGFDNAVISVGDVAGLGRLLR 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  + R+V++GA+ RRP  +++  +I   L++  ++  L+S G+ A+L+  I ++ + G 
Sbjct: 66  ENQVDRVVLSGAVARRPEWREIRPTIGILLKLPSIVRTLLSSGDDAVLQMVIKVIGTLGA 125

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHEI P LL   G  G   P  D  RDI  A ++A AL  LDVGQ AV++GGR+VA
Sbjct: 126 KVIGAHEIAPGLLATTGPFGAHKPAEDDLRDIRKAAQAALALGTLDVGQGAVAVGGRIVA 185

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD+ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG +TV+N  KAG
Sbjct: 186 LEGVEGTDAMLARVAALRAEGRISTRRKGVLVKLCKPQQDIRADLPTIGVETVENAHKAG 245

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           LAGIA+EAG++LVL+++ + K AD+AGIFVCGID    
Sbjct: 246 LAGIAVEAGRALVLDRDEMLKAADQAGIFVCGIDTSLG 283


>gi|256831136|ref|YP_003159864.1| hypothetical protein Dbac_3376 [Desulfomicrobium baculatum DSM
           4028]
 gi|256580312|gb|ACU91448.1| protein of unknown function DUF1009 [Desulfomicrobium baculatum DSM
           4028]
          Length = 270

 Score =  302 bits (774), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 81/280 (28%), Positives = 134/280 (47%), Gaps = 15/280 (5%)

Query: 1   MKR-LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVL 57
           M R L IIAG G  P  VA  A+ + +  V     ++    +Q        L LG    L
Sbjct: 1   MTRTLGIIAGGGSFPITVASTAKERGERVVGVGFASDTDPSFQAHCDNFSWLKLGQLGRL 60

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
                  ++  +V+AG I++   +      ++   R +++++ + + G+  +L+A    L
Sbjct: 61  IDFFTANHVTHVVMAGPINKPKAL-----DLRPDWRAARLLFSIKARGDDVLLRALTTEL 115

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G++VV  H   P+LL   G L    P +  + D+  A   +++L + D+GQ  V   
Sbjct: 116 EREGLTVVAPHLYSPDLLAPEGVLTKRKPTQSEREDVEFAWTLSQSLGQFDIGQCLVVRE 175

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+A+E IEGTD+ ++R       G  L G   V+VK  K  QD R DLP+ G KT+Q+
Sbjct: 176 KIVLAVEAIEGTDAAIRR-------GGQLGGPGAVVVKRPKPTQDKRLDLPAFGLKTLQS 228

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           + + G   +A EAG  +  E+      A+  GI + G+  
Sbjct: 229 MAEVGATCLAFEAGGCIFFEQREALDFANAHGIALLGLSP 268


>gi|118589999|ref|ZP_01547403.1| hypothetical protein SIAM614_15080 [Stappia aggregata IAM 12614]
 gi|118437496|gb|EAV44133.1| hypothetical protein SIAM614_15080 [Stappia aggregata IAM 12614]
          Length = 301

 Score =  302 bits (773), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 113/281 (40%), Positives = 165/281 (58%), Gaps = 2/281 (0%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
            RL +IAG+G LP  +A A      E  I ++  E     +     EL  G+   L   L
Sbjct: 10  PRLALIAGNGSLPCQIADALSNAGREFKIIAIKGEADERTRAQADTELGWGEIGRLYKFL 69

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +     +++ G + +RP+   +   I  +L+    I + ++GG+ ++L   I L E  G
Sbjct: 70  KKTGCRDVLLIGGVSKRPDFTSILGDI-GTLKRLPTIIRALAGGDDSLLTKVIRLFEVEG 128

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             VVG  ++ P+LL   G LG   P++   RD   A+++ E L ELD+GQ+AV++GGRVV
Sbjct: 129 YRVVGIKDVAPQLLASSGVLGKVQPSQTDWRDAELALRACEKLGELDIGQAAVAVGGRVV 188

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGK-SGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           ALEG EGTD+MLQR  D + NGRI A   +GVLVK  K  QD+R DLP++G KT+   + 
Sbjct: 189 ALEGAEGTDAMLQRCADLKRNGRIRAKSHTGVLVKTAKPNQDLRVDLPTVGPKTIDLAVA 248

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGLAGIA+EA  +L+ EK++  K AD+AG+FV GI+   +I
Sbjct: 249 AGLAGIAVEASGALIAEKDVTLKKADDAGLFVIGIEHGSSI 289


>gi|239832037|ref|ZP_04680366.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824304|gb|EEQ95872.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 315

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 116/278 (41%), Positives = 170/278 (61%), Gaps = 4/278 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAG+G+LP  VA+A     + P +  +  E       +E +E+ + +F  L   + 
Sbjct: 34  RVAIIAGNGLLPINVAEALATAGNSPFLVPLRGEADPILYKYEHQEISIVEFAKLVRSMK 93

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V DL      +LR    + + +  G+ A+L+A I LLES+G 
Sbjct: 94  AAGVDRVVLAGGVTSRPHVSDLKLDW-PTLRAVPYVLRALGQGDDALLRAFIGLLESFGF 152

Query: 123 SVVGAHEIVPELL--VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
            VVGAHE+VP+LL       L   VP+   + ++  AM+SA  L +LDVGQ A+++GGRV
Sbjct: 153 KVVGAHEVVPDLLSPSPAQILTRAVPDSRERHNLELAMESALRLGDLDVGQGAIAVGGRV 212

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEG EGTD M++R+ + R   RI   + GVLVKM K QQD RADLP+IG  TV+N  K
Sbjct: 213 VALEGAEGTDQMIERVRELRAARRI-PRRGGVLVKMAKPQQDERADLPTIGISTVENAAK 271

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AGL+GIA+EAG++ +L        A++ G+F+  + RE
Sbjct: 272 AGLSGIAVEAGRTFILGFGETIAAANDEGLFIETVSRE 309


>gi|49475420|ref|YP_033461.1| phosphatidate cytidyltransferase [Bartonella henselae str.
           Houston-1]
 gi|49238226|emb|CAF27436.1| Phosphatidate cytidyltransferase [Bartonella henselae str.
           Houston-1]
          Length = 290

 Score =  301 bits (772), Expect = 7e-80,   Method: Composition-based stats.
 Identities = 111/276 (40%), Positives = 163/276 (59%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  +A+        P +  + +E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPITIAQELEKNGQNPFLVLLRDEADALLYRYEHCELSIVELARLVKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  IV+AG + RRP ++ L F     L + K+I  L  GG+  +LKA + ++E++G 
Sbjct: 73  AAEICNIVLAGGVKRRPLLKQLQFDWTTFLALPKLIGALK-GGDDVLLKAFVRIIEAHGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            ++GAHEIVP LL      L      R  K+DIL A ++A+ L  LD+GQ+AV I GRV+
Sbjct: 132 CIIGAHEIVPNLLAPREFDLTLRRATRKEKKDILLAAEAAKLLGRLDIGQAAVVINGRVI 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD+ML R+ + R  G+I   K GVLVK  K QQD R DLPSIG  T+ N+ K+
Sbjct: 192 AVEGAEGTDNMLWRVCEMRERGQIPP-KGGVLVKCAKPQQDHRVDLPSIGPMTIMNIAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL+GIA+EA +SL+L  +   + A++  +F+   ++
Sbjct: 251 GLSGIAVEANRSLILSVKTTIEKANKYSLFIETFEK 286


>gi|325111096|ref|YP_004272164.1| hypothetical protein Plabr_4571 [Planctomyces brasiliensis DSM
           5305]
 gi|324971364|gb|ADY62142.1| protein of unknown function DUF1009 [Planctomyces brasiliensis DSM
           5305]
          Length = 304

 Score =  300 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 77/284 (27%), Positives = 137/284 (48%), Gaps = 11/284 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
            ++ ++AG+G  P   AK A+ +        V+   S +  ++      +PL        
Sbjct: 21  NKVGLLAGAGRFPILFAKEAQKQGYSVHAMGVIGMASDELPEYCDVYSPVPLARIGQAIR 80

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLC-FSIKDSLRISKMIWQLVS--GGNAAILKASIDL 116
              ++ + ++V+AG I++    Q    + +   +R   M  +       +  +L A I  
Sbjct: 81  WFKRHRVEQMVMAGKIEKVVLFQSKRLWRLLPDMRTIHMWMRYARENKKDDTLLLAVIRE 140

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            E   +    A +  PELLVQ G L    PN    +DI      A+ +  LDVGQ+ +  
Sbjct: 141 FERDQIHFASALDFCPELLVQHGFLTRRKPNAAQWKDICFGWDLAKEMGRLDVGQTVIVN 200

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD  + R  +    G         +VK+ K QQD R D+P+IG +T++
Sbjct: 201 DTAVIAIEAIEGTDKAILRAGELCKRG------GFTVVKVAKPQQDYRFDVPTIGVQTLR 254

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           ++ +AG   +A+EAG++++L++  V + AD+ GI +  ++ E A
Sbjct: 255 SMHEAGGRVLAVEAGQTIILDEPEVVELADKLGISIVSLNSEEA 298


>gi|307317024|ref|ZP_07596465.1| protein of unknown function DUF1009 [Sinorhizobium meliloti AK83]
 gi|306897112|gb|EFN27857.1| protein of unknown function DUF1009 [Sinorhizobium meliloti AK83]
          Length = 295

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 133/276 (48%), Positives = 188/276 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AARL+ ++P I ++  E   DW  F+     +GDF  +     
Sbjct: 14  RLAIIAGAGTLPHHVAEAARLQGEDPFIIALSREADTDWTGFDHAVCAIGDFAAISRTFE 73

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP  +D+  ++K   ++ ++   L+SGG+ A+L+  I+L+E+ G 
Sbjct: 74  TEGIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLISGGDDAVLRMVIELIEASGA 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL   G LG   P  + +RDI A + +A AL  LDVGQ AV++GGRVVA
Sbjct: 134 HVIGAHEVVPGLLADTGPLGAHAPTDEDRRDIEAGIAAANALGALDVGQGAVAVGGRVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ D R +GRI   + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 194 LEGAEGTDAMLARVADLRKDGRISIRRRGVLVKLCKPQQDERADLPSIGPSTVAGAHAAG 253

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAGIA+EAG++LVLE+  + + AD +G+F+ GI+R+
Sbjct: 254 LAGIAVEAGRALVLERARLVQEADRSGLFILGIERD 289


>gi|149175417|ref|ZP_01854038.1| hypothetical protein PM8797T_18174 [Planctomyces maris DSM 8797]
 gi|148845685|gb|EDL60027.1| hypothetical protein PM8797T_18174 [Planctomyces maris DSM 8797]
          Length = 297

 Score =  299 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 75/282 (26%), Positives = 133/282 (47%), Gaps = 11/282 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           +++ ++AG+G  P   A+ AR +        +    S +  +       +PL        
Sbjct: 14  RQIGLLAGAGRFPIVFAEQARQQGYSVCCLGIFGMASEELTEVCDIFHWIPLARIGRAIK 73

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCF-SIKDSLRISKMIWQ--LVSGGNAAILKASIDL 116
           +  + ++ RIV+AG I++           +   LR   M ++       +  +L A I  
Sbjct: 74  LFQREDVNRIVMAGKIEKTVLFSPFRILKLLPDLRTLHMWYRYAKKDRKDDTLLLAVIKE 133

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
            E   +    A +  PELLV+ G L    P+     DI      A+ + +LD+GQS V  
Sbjct: 134 FERDNIFFDSALDFCPELLVKHGFLTKRRPSHSQWEDIKMGWDIAKQMGQLDIGQSIVIN 193

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD  +QR       G         +VK+ K QQD R D+P++G KT+Q
Sbjct: 194 DKAVIAVEAIEGTDRAIQRAGQLCKRG------GFTVVKVAKPQQDRRFDVPTVGIKTLQ 247

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            + +AG   +A+E+ ++++++++ V   AD+ GI +  ++ E
Sbjct: 248 TMHEAGGRVLAIESNQTIMIDQKEVADLADKLGIAIVSLNEE 289


>gi|15965259|ref|NP_385612.1| hypothetical protein SMc02090 [Sinorhizobium meliloti 1021]
 gi|307309282|ref|ZP_07588950.1| protein of unknown function DUF1009 [Sinorhizobium meliloti BL225C]
 gi|15074439|emb|CAC46085.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306900283|gb|EFN30900.1| protein of unknown function DUF1009 [Sinorhizobium meliloti BL225C]
          Length = 295

 Score =  299 bits (766), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 133/276 (48%), Positives = 188/276 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AARL+ ++P I ++  E   DW  F+     +GDF  +     
Sbjct: 14  RLAIIAGAGTLPHHVAEAARLQGEDPFIIALSREADTDWTGFDHAVCAIGDFAAISRTFE 73

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP  +D+  ++K   ++ ++   L+SGG+ A+L+  I+L+E+ G 
Sbjct: 74  TEGIDRVVLSGAVRRRPEWRDIRPTLKTLAKVPRVFRTLISGGDDAVLRMVIELIEASGA 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL   G LG   P  + +RDI A + +A AL  LDVGQ AV++GGRVVA
Sbjct: 134 HVIGAHEVVPGLLADTGRLGAHAPTDEDRRDIEAGIAAANALGALDVGQGAVAVGGRVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ D R +GRI   + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 194 LEGAEGTDAMLARVADLRKDGRISIRRRGVLVKLCKPQQDERADLPSIGPSTVAGAHAAG 253

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAGIA+EAG++LVLE+  + + AD +G+F+ GI+R+
Sbjct: 254 LAGIAVEAGRALVLERARLVEEADRSGLFILGIERD 289


>gi|303230233|ref|ZP_07317001.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302515159|gb|EFL57133.1| conserved hypothetical protein [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 278

 Score =  298 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 71/281 (25%), Positives = 137/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   + V+  V+ +     +        + +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHMLGHQVVVIGVVPDTDPILEKEADSFYNISVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEGVTELTMLGKVTKEILYKGLSF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G SV+     +   + +VG L    P  +  +DI    + A+ + +LD+GQ+ V    
Sbjct: 118 REGFSVLDQTVYLKPFMPKVGVLTKRQPTEEQWQDICFGFELAKQMGKLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD  + R       G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDKCILR-------GGELGRGEAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ +++E V + A+   I +C +D+ F
Sbjct: 231 IDSGCNVLAVEAEKTIFVQQEDVLEMANRHNIIICAVDQAF 271


>gi|121602728|ref|YP_988901.1| hypothetical protein BARBAKC583_0593 [Bartonella bacilliformis
           KC583]
 gi|120614905|gb|ABM45506.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 290

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 112/272 (41%), Positives = 162/272 (59%), Gaps = 3/272 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
            R  IIAG+G+LP  VA+A      +P +  +  E      ++E  EL + +   L  IL
Sbjct: 12  SRTAIIAGNGVLPIAVAQALEECGQKPFLILLHGEAESALYNYEHCELSIVELARLFKIL 71

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +  I  I++AG I +RP+   L F     L + K++ +++  G+  +LK+ I L+E+ G
Sbjct: 72  KEKEICNIILAGGIRKRPDFFKLHFDWTTLLALPKLL-KILGSGDDILLKSFIQLIEARG 130

Query: 122 VSVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
             VVGAHE+VP+LL     SL +   ++  K  IL A K+A+ L  LD+GQ+ V I  RV
Sbjct: 131 FCVVGAHEVVPDLLAPMDFSLTSRRASQKEKNSILLAAKAAKLLGHLDIGQAVVVINNRV 190

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VA+EG EGTD ML+R+ + R   +I   K GVLVK  K QQD RADLPSIG  T+ N  K
Sbjct: 191 VAVEGAEGTDDMLKRVQEMRKKKQI-PSKGGVLVKCAKPQQDHRADLPSIGPTTIVNAAK 249

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           +GL G+A+EAGKSL+L  +   + A++  +FV
Sbjct: 250 SGLVGVAVEAGKSLILSCKRTIEEANKHSLFV 281


>gi|163868111|ref|YP_001609315.1| phosphatidate cytidyltransferase [Bartonella tribocorum CIP 105476]
 gi|161017762|emb|CAK01320.1| phosphatidate cytidyltransferase [Bartonella tribocorum CIP 105476]
          Length = 290

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 108/276 (39%), Positives = 161/276 (58%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAGSG+LP  VA+A     + P +  +  E       +E  EL + +   L  +L 
Sbjct: 13  RTAIIAGSGVLPITVAQALEKNGENPFLVLLQGEADSVLYRYEHCELSIVELARLIKVLK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  +  +V+AG + +RP +  L       L + K+I  L   G+ A+LKA I  +E +G 
Sbjct: 73  EAGVYNVVLAGGVKKRPLLTQLRLDWTTFLALPKLIGAL-RKGDDALLKAFIRFIEEHGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+GAHEIVP+LL     +L      +  K+DI  A ++A+ L +LD+GQ+ V + GRVV
Sbjct: 132 CVIGAHEIVPDLLAPIEFNLTVRRATQKEKKDIFLAARAAKILGQLDIGQAVVVVQGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD+ML R+ + R  G+I   K GVLVK  K QQD R DLPSIG  T+ N  K+
Sbjct: 192 ALEGAEGTDNMLWRVCEMRERGQIPP-KGGVLVKCAKPQQDNRVDLPSIGPVTIMNTAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL+GIA+EA +S++L  +   + A++  +F+   ++
Sbjct: 251 GLSGIAVEANRSIILSLKKTIEKANKHSLFIETFEK 286


>gi|303230965|ref|ZP_07317708.1| conserved hypothetical protein [Veillonella atypica ACS-049-V-Sch6]
 gi|302514347|gb|EFL56346.1| conserved hypothetical protein [Veillonella atypica ACS-049-V-Sch6]
          Length = 278

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 72/281 (25%), Positives = 138/281 (49%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   + V+ SV+ +     +        + +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHMLGHQVVVISVVPDTDPILEKEADAFYNISVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEGVTELTMLGKVTKEILYKGLSF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G SV+     +   + +VG L    P  +  +DI    + A+ + +LD+GQ+ V    
Sbjct: 118 REGFSVLDQTVYLKPFMPKVGVLTKRQPTEEQWQDICFGFELAKQMGKLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD  + R       G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDKCILR-------GGELGRGEAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ +++E V + A+   I +C +D+ F
Sbjct: 231 IDSGCNVLAVEAEKTIFVQQEDVLEMANRHNIIICAVDQAF 271


>gi|49474286|ref|YP_032328.1| phosphatidate cytidyltransferase [Bartonella quintana str.
           Toulouse]
 gi|49239790|emb|CAF26180.1| Phosphatidate cytidyltransferase [Bartonella quintana str.
           Toulouse]
          Length = 290

 Score =  298 bits (763), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 108/275 (39%), Positives = 159/275 (57%), Gaps = 3/275 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+A       P +  + +E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGILPITVAQALEKHGQNPFLVLLRDEADPVLYRYEHCELSIVELARLVKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I  IV+AG + +RP +  L       L + K++     GG+ A+LKA I ++E++G 
Sbjct: 73  AAAICNIVLAGGVKKRPLLTQLRPDWTTFLALPKLLGAFK-GGDDALLKAFIQVIEAHGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            V+G HEI+P+LL      L      R  K DIL A ++A+ L  LD+GQ+AV++ GRV+
Sbjct: 132 CVIGVHEILPDLLAPKEFDLTLRRATRKEKNDILLAAEAAKLLGRLDIGQAAVAVNGRVI 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD ML R+ + R   +I   K GVLVK  K QQD RADLPSIG  T+ N+ K+
Sbjct: 192 AVEGAEGTDKMLWRVCEMREKKQIPP-KGGVLVKCAKPQQDHRADLPSIGPTTIMNIAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            L+G+A+EA KSL+L  +   + A++  +F+   +
Sbjct: 251 ELSGVAVEANKSLILSVKATIEKANKHSLFIETFE 285


>gi|153009370|ref|YP_001370585.1| hypothetical protein Oant_2040 [Ochrobactrum anthropi ATCC 49188]
 gi|151561258|gb|ABS14756.1| protein of unknown function DUF1009 [Ochrobactrum anthropi ATCC
           49188]
          Length = 299

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 115/278 (41%), Positives = 169/278 (60%), Gaps = 4/278 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ IIAG+G+LP  VA+A      +P +  +  E       +E +E+ + +F  L   + 
Sbjct: 18  RVAIIAGNGLLPISVAEALEAAEKKPFLVPLRGEADPVLYKYEHQEISIVEFAKLVRSMK 77

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V DL F    +LR    + + +  G+ A+L+A I LLES+G 
Sbjct: 78  AAGVDRVVLAGGVTSRPHVSDLKFDW-PTLRAVPYVLRALGQGDDALLRAFIGLLESFGF 136

Query: 123 SVVGAHEIVPELL--VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
            VVGAH++VP LL       L    P+   + ++  AM+SA  L +LDVGQ AV++GGRV
Sbjct: 137 KVVGAHDVVPNLLSPSPAQILTRNAPDARERHNLELAMESALRLGDLDVGQGAVAVGGRV 196

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEG EGTD M++R+ + R  GRI   + GVLVKM K +QD RADLP+IG  T+ N +K
Sbjct: 197 VALEGAEGTDQMIERVRELRAAGRI-PRRGGVLVKMAKPRQDERADLPTIGISTIDNAVK 255

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AGL+GIA+EAG++ +L        A+  G+F+  + RE
Sbjct: 256 AGLSGIAVEAGRTFILGFGETIAAANAEGLFIETVSRE 293


>gi|298529238|ref|ZP_07016641.1| protein of unknown function DUF1009 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510674|gb|EFI34577.1| protein of unknown function DUF1009 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 279

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 93/279 (33%), Positives = 138/279 (49%), Gaps = 14/279 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRS 59
           K+L IIAG G  P  VA+ AR +      A+   E   + Q +  +   L LG    L  
Sbjct: 5   KKLGIIAGGGSFPLLVAQNARKQGYRVAAAAFEKETLPEIQAYTDQLVWLKLGQLGRLIR 64

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            LHQ  +  +V AG I++          ++   R  K++  L S  + A+L +  D L  
Sbjct: 65  FLHQAGVSHVVFAGPINKPRAF-----DLRPDFRAIKLLVNLRSRNDNALLSSVADELHR 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+ A E VPEL+   G      P+   K+DIL A    + +  LD+GQ  V     
Sbjct: 120 EGLEVISAIEFVPELISPAGLQSRRAPSFAEKKDILFAWPIIKQIGSLDIGQCIVVKERA 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E IEGTD  + R  +        +G S  +VK+ K  QD R DLP++G++TV+ +I
Sbjct: 180 VVAVEAIEGTDRAILRAGEL-------SGSSLTVVKIFKPGQDQRIDLPALGSQTVRTMI 232

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +AG   +A E+G SL  ++      ADE  I + GID +
Sbjct: 233 QAGATCLAYESGTSLFFDRAEAVSLADEHKICLVGIDPD 271


>gi|254502036|ref|ZP_05114187.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222438107|gb|EEE44786.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 294

 Score =  297 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 108/275 (39%), Positives = 160/275 (58%), Gaps = 2/275 (0%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +IAG+G +P  VA A      E  + ++  E     +     EL  G+   L + L++
Sbjct: 12  VALIAGNGRIPLQVATALAAAGRECKVVAIRGEADAATRSLASAELGWGEIGRLYAFLNK 71

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
                +++ G + +RP+   +   +  +LR    I + ++GG+ ++L   I L E  G  
Sbjct: 72  SGCRDVMLIGGVSKRPDFASILGDL-GTLRRLPTIIRALTGGDDSLLTKVIGLFEVEGFR 130

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVG  ++ P LL   G LG   P     +DI  A+ +   L ELD+GQ+AV++GGRVVAL
Sbjct: 131 VVGIKDVAPGLLAASGVLGKTQPRDTDWQDIQLALTATRKLGELDIGQAAVAVGGRVVAL 190

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           EG EGTD+ML+R  D R +GRI A  K+GVLVK  K  QD+R DLP+IG +T++    AG
Sbjct: 191 EGAEGTDAMLERCADLRGSGRIRAKNKTGVLVKTAKPNQDLRVDLPTIGPRTIERADAAG 250

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAGIA+EAG +L+ ++E     AD AG+FV GID+
Sbjct: 251 LAGIAIEAGGALISDREETLAQADRAGLFVIGIDQ 285


>gi|78356422|ref|YP_387871.1| hypothetical protein Dde_1375 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218827|gb|ABB38176.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 288

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 89/279 (31%), Positives = 136/279 (48%), Gaps = 14/279 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--LPLGDFCVLRSIL 61
           + IIAGSG  P  VA+AARL+    V+           +        L LG    L    
Sbjct: 14  IGIIAGSGQFPMLVARAARLEGHRVVMCGFQGHTDSALEHEADVWSMLHLGQLGRLIDFF 73

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               + R+  AGAI +   +      ++  +R +K++++L S G+  +L+A +  LES G
Sbjct: 74  VSAGVTRLCFAGAISKPRAL-----DLRPDMRAAKVLFRLRSKGDDVLLRAVLAELESEG 128

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + +V A E+VP L    G L    P+ +  +DI      A  +  LD+GQ  V   G VV
Sbjct: 129 LVIVQAAELVPGLRGPEGVLTRRQPSAEEWQDIRYGWPVAMQIGALDIGQCLVVRRGMVV 188

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG+EGTD+ L+R       G  L G   V +K  K  QD R DLP++G  TV+ + + 
Sbjct: 189 AVEGLEGTDATLRR-------GGELGGDGCVALKFVKPGQDERIDLPALGLATVRTLAQG 241

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           G   +  +AG +L  ++E     AD+ GI + GI    +
Sbjct: 242 GYTCLCYQAGNTLFFDREESISLADKHGISIVGIGPALS 280


>gi|254294067|ref|YP_003060090.1| hypothetical protein Hbal_1705 [Hirschia baltica ATCC 49814]
 gi|254042598|gb|ACT59393.1| protein of unknown function DUF1009 [Hirschia baltica ATCC 49814]
          Length = 286

 Score =  296 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 93/277 (33%), Positives = 148/277 (53%), Gaps = 4/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSI 60
            +L IIAGSG LP  +AK A+ +     I  +      +  + F  + + +G+     S 
Sbjct: 4   SKLGIIAGSGDLPETLAKHAQKEGRSVFIVGIAGFVEPELLEQFAHKVISVGEVGKQLSA 63

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L   N+  +  AG I +RPN ++L    K  + + K++ +  S G+ A+L+  +  +E  
Sbjct: 64  LKSENVNEVCFAG-IVKRPNFKNLKLDAKGMMILPKVL-KAASQGDDALLRVLVKTIERE 121

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVGA +++  L+  +GSLG   P+     DI  A + A  +  LD+GQ A+   G V
Sbjct: 122 GFKVVGADDVLTSLVAPIGSLGKHSPSSADFADIKKAAQIAAEIGRLDIGQGAIVCDGLV 181

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E  EGTD MLQR     +N R       GVLVK  K  Q+ R DLP+IG +T++   
Sbjct: 182 LAVEAQEGTDLMLQRCAALPDNLRGSTKVPRGVLVKRPKPVQERRVDLPTIGIRTLEGAK 241

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +A L+GIA EA  +L+L  + +  +AD  G+++ G +
Sbjct: 242 RACLSGIAYEANSALLLNMDELIAYADNNGLWIYGFE 278


>gi|227821908|ref|YP_002825878.1| hypothetical protein NGR_c13450 [Sinorhizobium fredii NGR234]
 gi|227340907|gb|ACP25125.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 293

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 132/275 (48%), Positives = 189/275 (68%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG+G LP++VA+AAR + ++P I ++  E   DW  F+   L +GDF  +     
Sbjct: 12  RLAIIAGAGALPHHVAEAARRQGEDPFIIALSREADADWSGFDHATLAIGDFAAISKAFA 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+V++GA+ RRP+ +D+  ++K   ++  ++  LVSGG+ A+L+ ++DL+E+ G 
Sbjct: 72  AEGIDRVVLSGAVRRRPDWRDIRPTLKTLAKVPSVLRTLVSGGDDAVLRMAMDLIEASGA 131

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHE+VP LL  +G +G      D  RDI A + +A AL  LDVGQ AV+IGGRVVA
Sbjct: 132 RVIGAHEVVPGLLADIGPIGEHTSTDDDLRDIEAGIAAANALGTLDVGQGAVAIGGRVVA 191

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG EGTD+ML R+ + + +GR+ + + GVLVK+CK QQD RADLPSIG  TV     AG
Sbjct: 192 LEGAEGTDAMLARVAELKADGRVSSRRRGVLVKLCKPQQDERADLPSIGPSTVAGAEAAG 251

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAGIA+EAG++LVLE+  V + A+ +G+FV GI+R
Sbjct: 252 LAGIAVEAGRALVLERPAVIETANRSGLFVLGIER 286


>gi|306844014|ref|ZP_07476609.1| phosphatidate cytidyltransferase [Brucella sp. BO1]
 gi|306275769|gb|EFM57493.1| phosphatidate cytidyltransferase [Brucella sp. BO1]
          Length = 300

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 114/277 (41%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ I+ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAIVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  AAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALRLGDLDVGQGAIATGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRMAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|17987117|ref|NP_539751.1| hypothetical protein BMEI0834 [Brucella melitensis bv. 1 str. 16M]
 gi|62290063|ref|YP_221856.1| hypothetical protein BruAb1_1156 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699989|ref|YP_414563.1| hypothetical protein BAB1_1172 [Brucella melitensis biovar Abortus
           2308]
 gi|189024303|ref|YP_001935071.1| hypothetical protein BAbS19_I10900 [Brucella abortus S19]
 gi|225852648|ref|YP_002732881.1| hypothetical protein BMEA_A1194 [Brucella melitensis ATCC 23457]
 gi|254689374|ref|ZP_05152628.1| hypothetical protein Babob68_04212 [Brucella abortus bv. 6 str.
           870]
 gi|254693858|ref|ZP_05155686.1| hypothetical protein Babob3T_04207 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697507|ref|ZP_05159335.1| hypothetical protein Babob28_07326 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701891|ref|ZP_05163719.1| hypothetical protein Bsuib55_13692 [Brucella suis bv. 5 str. 513]
 gi|254706667|ref|ZP_05168495.1| hypothetical protein BpinM_06689 [Brucella pinnipedialis
           M163/99/10]
 gi|254710225|ref|ZP_05172036.1| hypothetical protein BpinB_08122 [Brucella pinnipedialis B2/94]
 gi|254714221|ref|ZP_05176032.1| hypothetical protein BcetM6_12896 [Brucella ceti M644/93/1]
 gi|254717657|ref|ZP_05179468.1| hypothetical protein BcetM_14895 [Brucella ceti M13/05/1]
 gi|254730404|ref|ZP_05188982.1| hypothetical protein Babob42_04232 [Brucella abortus bv. 4 str.
           292]
 gi|256031719|ref|ZP_05445333.1| hypothetical protein BpinM2_13894 [Brucella pinnipedialis
           M292/94/1]
 gi|256044806|ref|ZP_05447710.1| hypothetical protein Bmelb1R_09954 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061232|ref|ZP_05451383.1| hypothetical protein Bneo5_12823 [Brucella neotomae 5K33]
 gi|256113711|ref|ZP_05454515.1| hypothetical protein Bmelb3E_13133 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159882|ref|ZP_05457606.1| hypothetical protein BcetM4_12889 [Brucella ceti M490/95/1]
 gi|256255119|ref|ZP_05460655.1| hypothetical protein BcetB_12676 [Brucella ceti B1/94]
 gi|256257620|ref|ZP_05463156.1| hypothetical protein Babob9C_09789 [Brucella abortus bv. 9 str.
           C68]
 gi|256369575|ref|YP_003107085.1| hypothetical protein BMI_I1161 [Brucella microti CCM 4915]
 gi|260168852|ref|ZP_05755663.1| hypothetical protein BruF5_10896 [Brucella sp. F5/99]
 gi|260546614|ref|ZP_05822353.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565594|ref|ZP_05836078.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260754892|ref|ZP_05867240.1| phosphatidate cytidyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758109|ref|ZP_05870457.1| phosphatidate cytidyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260761933|ref|ZP_05874276.1| phosphatidate cytidyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|261214144|ref|ZP_05928425.1| phosphatidate cytidyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|294852490|ref|ZP_06793163.1| hypothetical protein BAZG_01417 [Brucella sp. NVSL 07-0026]
 gi|297248462|ref|ZP_06932180.1| hypothetical protein BAYG_01418 [Brucella abortus bv. 5 str. B3196]
 gi|17982779|gb|AAL52015.1| hypothetical protein BMEI0834 [Brucella melitensis bv. 1 str. 16M]
 gi|62196195|gb|AAX74495.1| conserved hypothetical protein TIGR00148 [Brucella abortus bv. 1
           str. 9-941]
 gi|82616090|emb|CAJ11128.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
 gi|189019875|gb|ACD72597.1| hypothetical protein BAbS19_I10900 [Brucella abortus S19]
 gi|225641013|gb|ACO00927.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|255999737|gb|ACU48136.1| hypothetical protein BMI_I1161 [Brucella microti CCM 4915]
 gi|260095664|gb|EEW79541.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151662|gb|EEW86756.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668427|gb|EEX55367.1| phosphatidate cytidyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672365|gb|EEX59186.1| phosphatidate cytidyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675000|gb|EEX61821.1| phosphatidate cytidyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260915751|gb|EEX82612.1| phosphatidate cytidyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|294821079|gb|EFG38078.1| hypothetical protein BAZG_01417 [Brucella sp. NVSL 07-0026]
 gi|297175631|gb|EFH34978.1| hypothetical protein BAYG_01418 [Brucella abortus bv. 5 str. B3196]
 gi|326409169|gb|ADZ66234.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538879|gb|ADZ87094.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 300

 Score =  295 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|328954375|ref|YP_004371709.1| protein of unknown function DUF1009 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454699|gb|AEB10528.1| protein of unknown function DUF1009 [Desulfobacca acetoxidans DSM
           11109]
          Length = 269

 Score =  295 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 82/276 (29%), Positives = 139/276 (50%), Gaps = 13/276 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSI 60
           ++ +IAG    P    +AA+ +  E V  +   E     +      + + +G    +   
Sbjct: 4   KIGLIAGKNKFPLIFTQAAQKQGLEVVAVAHHGETDPALEQMVSALKWVYVGQLGKIIRF 63

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
             Q  + + V+AG I +      L        R  K+I ++    +  IL+A  D LES 
Sbjct: 64  FQQAGVSQAVMAGGITKGRLFTHLRPDW----RALKIIRRVGQARDDGILRALADELESE 119

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+++V     + ELL   G L    P+   +RDI      A+ + +LD+GQ  V     V
Sbjct: 120 GITIVSPTLFLEELLAPAGVLSRRRPSAGEQRDIRFGWSIAKEIGKLDIGQCVVVRRQAV 179

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +ALE I+GTD+ ++R       G +LAG+  V+VK+ K  QD+R D+P++G +T+Q + +
Sbjct: 180 LALEAIDGTDATIRR-------GGLLAGEGAVVVKVSKPGQDLRFDVPAVGVETIQVMRE 232

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
              + +ALEAGK+LV +++ +   AD+A I V G+ 
Sbjct: 233 VKASVLALEAGKTLVFDRDAMLHLADQAKIAVVGLS 268


>gi|237815571|ref|ZP_04594568.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|261314127|ref|ZP_05953324.1| phosphatidate cytidyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|265998280|ref|ZP_06110837.1| phosphatidate cytidyltransferase [Brucella ceti M490/95/1]
 gi|237788869|gb|EEP63080.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|261303153|gb|EEY06650.1| phosphatidate cytidyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|262552748|gb|EEZ08738.1| phosphatidate cytidyltransferase [Brucella ceti M490/95/1]
          Length = 305

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 25  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 84

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 85  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 143

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 144 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 203

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 204 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 262

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 263 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 299


>gi|254719213|ref|ZP_05181024.1| hypothetical protein Bru83_06676 [Brucella sp. 83/13]
 gi|306837961|ref|ZP_07470819.1| phosphatidate cytidyltransferase [Brucella sp. NF 2653]
 gi|306406885|gb|EFM63106.1| phosphatidate cytidyltransferase [Brucella sp. NF 2653]
          Length = 300

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 171/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  AAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM++A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPLPACLTRITPDARERRNIALAMEAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVCELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|254469396|ref|ZP_05082801.1| phosphatidate cytidyltransferase [Pseudovibrio sp. JE062]
 gi|211961231|gb|EEA96426.1| phosphatidate cytidyltransferase [Pseudovibrio sp. JE062]
          Length = 286

 Score =  295 bits (756), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 99/275 (36%), Positives = 155/275 (56%), Gaps = 2/275 (0%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +IAG G LP  V ++A  +  E V  ++  E       F   EL  G    L S L  
Sbjct: 7   IAVIAGGGDLPGLVIRSAMAQGREVVTIAIKGEADASLSAFNPVELGWGQIGKLFSTLKS 66

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +V+ G + RRP+   +        R+ ++I   V GG+  +L     + E  G+ 
Sbjct: 67  KGVRDVVLIGGVQRRPDFTSILGDFGTMWRLPRII-AAVVGGDDHLLVKVAGIFEREGLH 125

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVGAHE+ PEL+   G +    P++    D+  A+++ +AL  LD+GQ A+++  RVVA+
Sbjct: 126 VVGAHEVAPELVASPGHVAGPKPSKKALSDMTLAIEAVDALGRLDIGQGAIAVNARVVAV 185

Query: 184 EGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           EG EGTD+ML+R+   R NGR+ + G +GVLVK  K QQD+R D+P IG +T++   +A 
Sbjct: 186 EGAEGTDAMLERVAVLRENGRVRSKGAAGVLVKCSKPQQDLRLDMPGIGPQTIRKAAEAQ 245

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           L G+ +EAG+ LV  ++ V++  DE G+F+ G  R
Sbjct: 246 LQGVCVEAGRVLVAHRDEVERLCDELGVFLYGCTR 280


>gi|225627618|ref|ZP_03785655.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260883904|ref|ZP_05895518.1| phosphatidate cytidyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261219498|ref|ZP_05933779.1| phosphatidate cytidyltransferase [Brucella ceti M13/05/1]
 gi|261222317|ref|ZP_05936598.1| phosphatidate cytidyltransferase [Brucella ceti B1/94]
 gi|261317784|ref|ZP_05956981.1| phosphatidate cytidyltransferase [Brucella pinnipedialis B2/94]
 gi|261321993|ref|ZP_05961190.1| phosphatidate cytidyltransferase [Brucella ceti M644/93/1]
 gi|261325240|ref|ZP_05964437.1| phosphatidate cytidyltransferase [Brucella neotomae 5K33]
 gi|261752455|ref|ZP_05996164.1| phosphatidate cytidyltransferase [Brucella suis bv. 5 str. 513]
 gi|261758340|ref|ZP_06002049.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265988815|ref|ZP_06101372.1| phosphatidate cytidyltransferase [Brucella pinnipedialis M292/94/1]
 gi|265991230|ref|ZP_06103787.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995066|ref|ZP_06107623.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265999443|ref|ZP_05466390.2| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|225617623|gb|EEH14668.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|260873432|gb|EEX80501.1| phosphatidate cytidyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260920901|gb|EEX87554.1| phosphatidate cytidyltransferase [Brucella ceti B1/94]
 gi|260924587|gb|EEX91155.1| phosphatidate cytidyltransferase [Brucella ceti M13/05/1]
 gi|261294683|gb|EEX98179.1| phosphatidate cytidyltransferase [Brucella ceti M644/93/1]
 gi|261297007|gb|EEY00504.1| phosphatidate cytidyltransferase [Brucella pinnipedialis B2/94]
 gi|261301220|gb|EEY04717.1| phosphatidate cytidyltransferase [Brucella neotomae 5K33]
 gi|261738324|gb|EEY26320.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261742208|gb|EEY30134.1| phosphatidate cytidyltransferase [Brucella suis bv. 5 str. 513]
 gi|262766179|gb|EEZ11968.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002014|gb|EEZ14589.1| phosphatidate cytidyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093989|gb|EEZ17923.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661012|gb|EEZ31273.1| phosphatidate cytidyltransferase [Brucella pinnipedialis M292/94/1]
          Length = 308

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 170/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 28  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 87

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 88  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 146

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 147 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 206

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 207 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 265

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 266 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 302


>gi|265984208|ref|ZP_06096943.1| phosphatidate cytidyltransferase [Brucella sp. 83/13]
 gi|264662800|gb|EEZ33061.1| phosphatidate cytidyltransferase [Brucella sp. 83/13]
          Length = 308

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 171/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 28  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 87

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 88  AAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 146

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM++A  L +LDVGQ A++ GGRVV
Sbjct: 147 KVVGAHEVVPDLLSPLPACLTRITPDARERRNIALAMEAALKLGDLDVGQGAIAAGGRVV 206

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 207 ALEGAEGTDLMIERVCELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 265

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 266 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 302


>gi|317485989|ref|ZP_07944844.1| hypothetical protein HMPREF0179_02199 [Bilophila wadsworthia 3_1_6]
 gi|316922762|gb|EFV43993.1| hypothetical protein HMPREF0179_02199 [Bilophila wadsworthia 3_1_6]
          Length = 281

 Score =  295 bits (755), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 80/277 (28%), Positives = 136/277 (49%), Gaps = 14/277 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--LPLGDFCVLRSIL 61
           + IIAGSG  P  VA+ A+      V+ +         +        + LG F  +    
Sbjct: 5   IGIIAGSGQFPRLVAEDAKAAGYGVVVCAFHGFTDPGLEALADAYTTVYLGQFDKVIDYF 64

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++ + R+ +AGAI++   +      ++   R +++++ L   G+ A+L+A +  LE  G
Sbjct: 65  RKHGVRRLCMAGAINKPRAL-----DLRPDFRAARILFSLRGKGDDALLRAIMADLEKEG 119

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            +++ A E+   LL   G L    P+ +   +I      AEAL   D+GQ  V   G VV
Sbjct: 120 FTLIQAAELSTSLLCPEGVLTRRGPSAEEIAEIDYGWPIAEALGRFDIGQCIVVKQGMVV 179

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGTD+ L+R       G  L G+  V +K  K +QD R DLPSIG +TV+ +I+ 
Sbjct: 180 AVECLEGTDAALRR-------GGELRGEGCVAIKRFKPKQDERVDLPSIGLQTVRLLIEQ 232

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
               +A++AGK+L  ++      AD+    +  +  +
Sbjct: 233 HYRCLAVDAGKTLFFDRAEALALADKHNFCIVALTED 269


>gi|290968944|ref|ZP_06560479.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
 gi|290780900|gb|EFD93493.1| conserved hypothetical protein [Megasphaera genomosp. type_1 str.
           28L]
          Length = 271

 Score =  294 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 72/278 (25%), Positives = 139/278 (50%), Gaps = 12/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M+++ + AG G LP    +AA+    E V+ +++     +  +      E+ +     + 
Sbjct: 1   MEKVGLFAGVGRLPVEFVRAAKTSGHETVVIALVPGTDPELAEAADVYYEINVAKLDKVI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             + +  + ++ + G + +    + L F      R  K++  L +  +  I+ A ++ L 
Sbjct: 61  KTMRRAGVTKVTMIGKVTKELLFKGLSF---PDFRAMKLLATLHNRKDDTIMLAIVEELA 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V    E +  L+   G L    P+    +DI     +A+A+ +LD+GQ+ V    
Sbjct: 118 KDGLEVADQTEYLKALMPSCGVLTRRQPSEAEWQDIRFGAATAKAMGKLDIGQTVVVKRQ 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ ++R       G  LA   GV+VK+ K +QD R D+P++G  TV+ +
Sbjct: 178 AVMAVEAIEGTDACIRR-------GGTLAQGDGVVVKVAKPKQDWRFDMPTVGKATVEAM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           + +G   +A+EA K+L +E+E V   A +  + +C ++
Sbjct: 231 VASGCTVLAMEADKTLFVEQEEVLALAAKHKLCICAVN 268


>gi|269797600|ref|YP_003311500.1| hypothetical protein Vpar_0537 [Veillonella parvula DSM 2008]
 gi|269094229|gb|ACZ24220.1| protein of unknown function DUF1009 [Veillonella parvula DSM 2008]
          Length = 278

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 137/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   E V+  V+ +       +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDIGVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEEVQELTMLGKVTKEILFKGLTF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTAYLKPFMPKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD  + R       G  L     ++VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AVMAIEAIEGTDKCILR-------GGELGRGDAIVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   AD  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDMADRHGIVICAVDQEF 271


>gi|312114745|ref|YP_004012341.1| hypothetical protein Rvan_2007 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219874|gb|ADP71242.1| protein of unknown function DUF1009 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 299

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 99/277 (35%), Positives = 148/277 (53%), Gaps = 4/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
            R+ I+AG G LP  VA+AA  + + P I  +    S   + F      +G    +   L
Sbjct: 21  SRIGIVAGGGTLPLAVAEAAAARGERPYIVGLQGNASSTIESFPHSYAGIGQIGRILGAL 80

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +    R+V  G++ RRPN+  +       +R    + +++ GG+ ++L+A     E+ G
Sbjct: 81  RREGCERVVFVGSL-RRPNLLRVRIDTGF-VRHMPELLRILRGGDDSVLRAVARFFEARG 138

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+ AHE+ P LL   G      P+ +   DI  A   A AL E D+GQ AV   G V+
Sbjct: 139 FEVLAAHEVAPRLLAPAGVFSGAAPDAEALADIRLAFNVARALGEYDIGQGAVVARGYVL 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E  EGTD+ML R  D    G     + GVLVKM K  QD+R D+P+IG +TV+   +A
Sbjct: 199 AVEAAEGTDAMLSRCRDLNRWG--FKNRQGVLVKMPKPGQDLRLDMPAIGPRTVELAAEA 256

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+ AG  L+ E++ + + AD  G+F+ G+D E
Sbjct: 257 GLAGIAVAAGGVLLAEQQAIVEKADALGLFLYGVDGE 293


>gi|308272625|emb|CBX29229.1| hypothetical protein N47_J02100 [uncultured Desulfobacterium sp.]
          Length = 273

 Score =  293 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 82/277 (29%), Positives = 142/277 (51%), Gaps = 13/277 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           K++ +IAGSG  P   +K A  K      A+ +NE     ++   +   L LG    L +
Sbjct: 7   KKIGLIAGSGQFPIIFSKIAVSKGFLVYAAAFINEAEETLKEEVEKIEWLHLGQVKRLVN 66

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  I  +V+ GAI +          +K  ++   +I  + S  +  +L A   +LE 
Sbjct: 67  FFKKNEIKEVVMLGAIKKTKMFS----DVKPDMKAISLIMHMKSTHDDGLLSAFAGMLEK 122

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V  +  ++P+LL Q G      P R  K DI   +  A+ +  LD+GQ  V  GG 
Sbjct: 123 EGIIVKSSTFLLPDLLAQEGCWTKRKPTRSEKADINIGLHIAKEIGRLDIGQCVVVCGGS 182

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E I+GTD+ ++R       G  L     V+VK+CK +QD R D+P++G +T+  + 
Sbjct: 183 VLAVEAIDGTDATIRR-------GGKLGNGEAVIVKVCKPEQDTRFDMPAVGIQTISTMY 235

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           ++G+  +A+EA K++V ++E + + AD+ GI +  + 
Sbjct: 236 ESGVKALAVEANKAVVFDREDMIRLADKVGISIVAVS 272


>gi|311234480|gb|ADP87334.1| protein of unknown function DUF1009 [Desulfovibrio vulgaris RCH1]
          Length = 278

 Score =  293 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 86/277 (31%), Positives = 131/277 (47%), Gaps = 14/277 (5%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSILH 62
            IIAG G  P  VA+ AR       I            +       + LG F  L    H
Sbjct: 6   GIIAGRGQFPALVAREARRAGLRVAICGFHGHTDPSLAEACDAFSLIHLGQFGRLSEFFH 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                R+  AGAID+   +      ++  LR ++++++L   G+ A+L+A I+ LES G 
Sbjct: 66  GQGASRLCFAGAIDKPRAL-----DLRPDLRAARVLFRLRGKGDDALLRAVIEELESDGF 120

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+ A E+VP L    G L    P  +   DI      A  +  LD+GQ  V   G V+A
Sbjct: 121 KVMQAAELVPGLRAPEGVLTRRQPGDEEWDDIRFGWPVARTMGRLDIGQCIVVKRGIVMA 180

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +EG EGTD+ L+R       G  L G   V +K+ K  QD R DLP++G  T+  + + G
Sbjct: 181 VEGPEGTDAALRR-------GGELGGAGCVAIKLVKPGQDERIDLPALGTGTIGVLAEYG 233

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
            + +AL+A K+L  +++     A+  GI +  +  +F
Sbjct: 234 YSCLALQAHKTLFFDRDESLALAERHGIAIVALPEDF 270


>gi|206602499|gb|EDZ38980.1| Conserved protein of unknown function [Leptospirillum sp. Group II
           '5-way CG']
          Length = 296

 Score =  293 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 79/277 (28%), Positives = 134/277 (48%), Gaps = 14/277 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSIL 61
           + ++AG+G+ P     +AR K  E ++ +   E     + F    R + +G    +    
Sbjct: 32  IGLVAGNGLFPNLFLDSARKKGYEVIVVAHRGETDPSVESFGVPVRWIRVGQLDPIFKTF 91

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
           H++ +     AG I +          ++   R  +++ ++    +  +L+A  D  E   
Sbjct: 92  HEHGVKAAAFAGGIKKPRLF-----DLRPDWRGVRILARVAVNHDDQVLRALADEFEQES 146

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + +V +  ++PEL    G LG   P    + DI   +++ + L +LDVGQ  V     ++
Sbjct: 147 IRIVPSTWLLPELTTPEGVLGVHHPTEAEREDIRIGLEAGKVLGKLDVGQCVVVKEKVIL 206

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALE IEGTD  ++R       G        V+VKM K  QD+R DLPS+G KT++ + + 
Sbjct: 207 ALEAIEGTDETIRR-------GARFTSPGIVVVKMAKPGQDLRFDLPSVGMKTLELMAEV 259

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           G   +ALEAGKSL+L+     + AD  GI V G+  +
Sbjct: 260 GGRVLALEAGKSLILDTGHFLETADRYGICVLGVTWD 296


>gi|94269143|ref|ZP_01291381.1| Protein of unknown function DUF1009 [delta proteobacterium MLMS-1]
 gi|93451329|gb|EAT02203.1| Protein of unknown function DUF1009 [delta proteobacterium MLMS-1]
          Length = 280

 Score =  293 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 85/279 (30%), Positives = 140/279 (50%), Gaps = 13/279 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M +L IIAG G  P  VA+AAR    E  + +   E   + +     C  + LG    + 
Sbjct: 5   MSKLGIIAGGGQFPLLVAQAARRHGREVAVVAHRGESVPELEQAAASCLWIKLGQLGKMV 64

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L +  + + + AG I +    +     +    +  ++  ++ S  + AIL+A  DLL 
Sbjct: 65  NFLRRQGVQQCLFAGTITKTRIFR----DVWPDFKALQLWGRIDSRQDDAILRAIADLLA 120

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + G+ VV +   + ELL   G L    PN + + DI    + A  + ELD+GQ  V    
Sbjct: 121 AEGIEVVASTLYLEELLFPKGVLSRKKPNAEQRADIDFGWQMARRIGELDIGQCVVVRQR 180

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ ++R       G  L  +  V+VK+ K  QD R DLP+IG +T+  +
Sbjct: 181 AVLAVEAIEGTDAAIRR-------GGELGREQAVVVKVRKPNQDFRFDLPAIGRQTIATM 233

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            +A  A +A+EA ++L+ +       AD+AG+ V G++ 
Sbjct: 234 QEARAAVLAVEARQALLFDPRETLAAADQAGLVVVGVEE 272


>gi|148559345|ref|YP_001259069.1| hypothetical protein BOV_1108 [Brucella ovis ATCC 25840]
 gi|148370602|gb|ABQ60581.1| conserved hypothetical protein TIGR00148 [Brucella ovis ATCC 25840]
          Length = 300

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 169/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  R     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLRNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+E G++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEVGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|313894592|ref|ZP_07828155.1| conserved hypothetical protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313440782|gb|EFR59211.1| conserved hypothetical protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 278

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 71/281 (25%), Positives = 133/281 (47%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M ++ +IAG G LP    +AA +   E V+  V+ +       +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGALPVEFMRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDISVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L    +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKNEGVVELTMLGKVTKEILFKGLSF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG      P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTVYLKPFMPKVGVFSKAQPTEEQWADICFGFELAKQMGGLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD  + R       G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDKCILR-------GGELGRGEAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   A+  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDMANRHGIVICAVDQEF 271


>gi|161619102|ref|YP_001592989.1| hypothetical protein BCAN_A1169 [Brucella canis ATCC 23365]
 gi|163843415|ref|YP_001627819.1| hypothetical protein BSUIS_A1198 [Brucella suis ATCC 23445]
 gi|260566316|ref|ZP_05836786.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335913|gb|ABX62218.1| Hypothetical protein BCAN_A1169 [Brucella canis ATCC 23365]
 gi|163674138|gb|ABY38249.1| Hypothetical protein BSUIS_A1198 [Brucella suis ATCC 23445]
 gi|260155834|gb|EEW90914.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 300

 Score =  293 bits (750), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 169/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|301057977|ref|ZP_07199034.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300447944|gb|EFK11652.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 272

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 75/278 (26%), Positives = 135/278 (48%), Gaps = 14/278 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRS 59
           + + +IAG G  P  VA AAR      V  +   E      +   E   + LG    L  
Sbjct: 6   ETIGLIAGGGQFPLLVADAARKHGTRVVAVAHQGETDSALSEKVDEIAWIKLGQLGQLIK 65

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++++ + ++AG+I ++   +     ++  L+   ++ +L    +  IL++       
Sbjct: 66  TFKKFDVTKALMAGSIAKKKMFE-----MRPDLKGLAIMSKLAIFHDDDILRSVTAEFAK 120

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ +V +   +P+LL   G L    P ++  +DI    K A+ L  LD+GQS V     
Sbjct: 121 EGIEIVSSTLFLPDLLAPEGCLTKRAPTKNEWKDIRFGWKIAKELGRLDIGQSVVVRKKT 180

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ALE I+GTD+ + R       G  LA +  V+VK+ K +QD+R D+P +G +T+  + 
Sbjct: 181 VLALEAIDGTDATILR-------GGALAKEKAVVVKVSKPKQDLRFDVPCVGMETIAVMK 233

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           +   A +A+EAG +L+ ++  +   AD+  I V  +  
Sbjct: 234 RVKGAVLAVEAGHTLIFDRSEMVAAADKEKIAVVAVKS 271


>gi|23502028|ref|NP_698155.1| hypothetical protein BR1150 [Brucella suis 1330]
 gi|23347982|gb|AAN30070.1| conserved hypothetical protein TIGR00148 [Brucella suis 1330]
          Length = 300

 Score =  292 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 113/277 (40%), Positives = 169/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNTGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|124514699|gb|EAY56211.1| conserved protein of unknown function [Leptospirillum rubarum]
          Length = 296

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 79/277 (28%), Positives = 134/277 (48%), Gaps = 14/277 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSIL 61
           + ++AG+G+ P     +AR K  E ++ +   E     + F    R + +G    +    
Sbjct: 32  IGLVAGNGLFPNLFLDSARKKGYEVIVVAHRGETDPSVESFGAPVRWIRVGQLEPIFKTF 91

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
           H++ +     AG I +          ++   R  +++ ++    +  +L+A  D  E   
Sbjct: 92  HEHGVKAAAFAGGIKKPRLF-----DLRPDWRGVRILARVAVNHDDQVLRALADEFEQES 146

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + +V +  ++PEL    G LG   P    + DI   +++ + L  LDVGQ  V     ++
Sbjct: 147 IRIVPSTWLLPELTTPEGVLGVHHPTDAEREDIRIGLEAGKVLGTLDVGQCVVVKEKVIL 206

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALE IEGTD  ++R       G   +    V+VKM K  QD+R DLPS+G KT++ + + 
Sbjct: 207 ALEAIEGTDETIRR-------GARFSSPGIVVVKMAKPGQDLRFDLPSVGMKTLELMAEV 259

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           G   +ALEAGKSL+L+     + AD  GI V G+  +
Sbjct: 260 GGRVLALEAGKSLILDTGHFLETADRYGICVLGVTWD 296


>gi|254704437|ref|ZP_05166265.1| hypothetical protein Bsuib36_11015 [Brucella suis bv. 3 str. 686]
          Length = 300

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 112/277 (40%), Positives = 169/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM ++  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDASLKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 257

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 258 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 294


>gi|46580770|ref|YP_011578.1| hypothetical protein DVU2365 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450190|gb|AAS96838.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 274

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 86/277 (31%), Positives = 131/277 (47%), Gaps = 14/277 (5%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSILH 62
            IIAG G  P  VA+ AR       I            +       + LG F  L    H
Sbjct: 2   GIIAGRGQFPALVAREARRAGLRVAICGFHGHTDPSLAEACDAFSLIHLGQFGRLSEFFH 61

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                R+  AGAID+   +      ++  LR ++++++L   G+ A+L+A I+ LES G 
Sbjct: 62  GQGASRLCFAGAIDKPRAL-----DLRPDLRAARVLFRLRGKGDDALLRAVIEELESDGF 116

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+ A E+VP L    G L    P  +   DI      A  +  LD+GQ  V   G V+A
Sbjct: 117 KVMQAAELVPGLRAPEGVLTRRQPGDEEWDDIRFGWPVARTMGRLDIGQCIVVKRGIVMA 176

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +EG EGTD+ L+R       G  L G   V +K+ K  QD R DLP++G  T+  + + G
Sbjct: 177 VEGPEGTDAALRR-------GGELGGAGCVAIKLVKPGQDERIDLPALGTGTIGVLAEYG 229

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
            + +AL+A K+L  +++     A+  GI +  +  +F
Sbjct: 230 YSCLALQAHKTLFFDRDESLALAERHGIAIVALPEDF 266


>gi|298291811|ref|YP_003693750.1| hypothetical protein Snov_1827 [Starkeya novella DSM 506]
 gi|296928322|gb|ADH89131.1| protein of unknown function DUF1009 [Starkeya novella DSM 506]
          Length = 297

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 100/279 (35%), Positives = 150/279 (53%), Gaps = 3/279 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL II G G  P  VA+AAR    E V+  V        + +    +P+G F +L+  + 
Sbjct: 18  RLAIICGGGAFPLAVAEAARRAGREVVLFPVRGFADMAVESWPHVWIPIGRFGLLKREMR 77

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           ++    +V  G    RP ++D+      +L +   + +++ GG+  +L +   L E  G 
Sbjct: 78  RHGCTEVVFIGT-ALRPRIRDIRLDW-TTLTLLPRVLRMLRGGDDHLLTSLGRLFEESGF 135

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +VGAHE+ PE+L+  G LG   P+ +   D+     +      LD+GQ  V +   VVA
Sbjct: 136 RLVGAHEVAPEILIPAGQLGGVAPSAEEMDDVAVGRHALGVTGPLDIGQGLVVMNRHVVA 195

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           LE  EGTD ML R+ + R NGRI A  + GVLVK  K  QD R DLPS+G +TV+   +A
Sbjct: 196 LEAAEGTDLMLARVAELRGNGRIKAPARCGVLVKRPKEGQDRRLDLPSLGTRTVEGAARA 255

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           GLAGIA+EAG  +V +   + + AD AG+F+    ++ A
Sbjct: 256 GLAGIAVEAGGVIVTDVAALVRAADRAGLFIYAFGQDEA 294


>gi|120601945|ref|YP_966345.1| hypothetical protein Dvul_0897 [Desulfovibrio vulgaris DP4]
 gi|120562174|gb|ABM27918.1| protein of unknown function DUF1009 [Desulfovibrio vulgaris DP4]
          Length = 278

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 86/277 (31%), Positives = 131/277 (47%), Gaps = 14/277 (5%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSILH 62
            IIAG G  P  VA+ AR       I            +       + LG F  L    H
Sbjct: 6   GIIAGRGQFPALVAREARRAGLRVAICGFHGHTDPSLAEACDAFSLIHLGQFGRLSEFFH 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                R+  AGAID+   +      ++  LR ++++++L   G+ A+L+A I+ LES G 
Sbjct: 66  GQGASRLCFAGAIDKPRAL-----DLRPDLRAARVLFRLRGKGDDALLRAVIEELESDGF 120

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+ A E+VP L    G L    P  +   DI      A  +  LD+GQ  V   G V+A
Sbjct: 121 KVMQAAELVPGLRAPEGVLTRRQPGDEEWDDIRFGWPVARTVGRLDIGQCIVVKRGIVMA 180

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +EG EGTD+ L+R       G  L G   V +K+ K  QD R DLP++G  T+  + + G
Sbjct: 181 VEGPEGTDAALRR-------GGELGGAGCVAIKLVKPGQDERIDLPALGTGTIGVLAEYG 233

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
            + +AL+A K+L  +++     A+  GI +  +  +F
Sbjct: 234 YSCLALQAHKTLFFDRDESLALAERHGIAIVALPEDF 270


>gi|282850047|ref|ZP_06259429.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
 gi|282580236|gb|EFB85637.1| conserved hypothetical protein [Veillonella parvula ATCC 17745]
          Length = 278

 Score =  291 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 136/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   E V+  V+ +       +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDIGVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEEVEELTMLGKVTKEILFKGLTF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTVYLKPFMPKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD  + R       G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDKCILR-------GGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   AD  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDMADRHGIVICAVDQEF 271


>gi|261755115|ref|ZP_05998824.1| phosphatidate cytidyltransferase [Brucella suis bv. 3 str. 686]
 gi|261744868|gb|EEY32794.1| phosphatidate cytidyltransferase [Brucella suis bv. 3 str. 686]
          Length = 305

 Score =  291 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 112/277 (40%), Positives = 169/277 (61%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 25  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 84

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 85  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 143

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM ++  L +LDVGQ A++ GGRVV
Sbjct: 144 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDASLKLGDLDVGQGAIAAGGRVV 203

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV N  +A
Sbjct: 204 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVGNAERA 262

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGIA+EAG++ +L        A++ G+F+  I R+
Sbjct: 263 GLAGIAIEAGRTFILGFGETLAAANKKGLFIETISRD 299


>gi|284105034|ref|ZP_06386163.1| protein containing DUF1009 [Candidatus Poribacteria sp. WGA-A3]
 gi|283830157|gb|EFC34417.1| protein containing DUF1009 [Candidatus Poribacteria sp. WGA-A3]
          Length = 274

 Score =  291 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 71/274 (25%), Positives = 133/274 (48%), Gaps = 13/274 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSIL 61
           + +IAG+G  P   A+ AR         +   E + + +        + +G F  +   L
Sbjct: 10  IGLIAGNGRFPVIFAENARKLGFRVSAVAHHGETAPELEQVVDRMHWVRIGQFGKVIQAL 69

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               + + V+ G + +      +    +   R      +L S  +  IL+A  D LE  G
Sbjct: 70  KYDGVEQAVMLGGMKKTHLFSGV----RPDFRAMAFFAKLKSWKDDHILRAIADDLEDEG 125

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           +++  +   +  L+V  G+L    P+R  + ++      A+ +  +D+GQ  V     +V
Sbjct: 126 ITIRESTFGLSNLVVPEGTLTRRGPSRKERENVSYGWSIAKEIGRMDIGQCVVVKDRVIV 185

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGTD  ++R       G  +A    V+VK CK QQD+R DLP++G +T+  + + 
Sbjct: 186 AVEAVEGTDETIRR-------GGRMARSGAVVVKCCKPQQDLRFDLPAVGPRTIDVMDEV 238

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             + +ALEA K+++L++E + + A +AGI + G+
Sbjct: 239 KASVLALEAHKTIMLDREEMLEKAHQAGIVIIGV 272


>gi|158423329|ref|YP_001524621.1| hypothetical protein AZC_1705 [Azorhizobium caulinodans ORS 571]
 gi|158330218|dbj|BAF87703.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 294

 Score =  290 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 101/278 (36%), Positives = 145/278 (52%), Gaps = 3/278 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + I+AG G  P  VA+A R +  E  +  +        + +      +G      + L  
Sbjct: 18  VGIVAGGGAFPAAVAEAVRAQGREVYLGLLQGFADPSLERYPHFWFKVGSLGTATTRLKA 77

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +V+ G +  RP V+DL       LR+   I  L  GG+  +L   ++L+ + G +
Sbjct: 78  QGVKELVMVGTLT-RPRVRDLGLDW-TMLRLLPRIAALFRGGDNHLLSGVVELVAAQGFA 135

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           + GAHE+ P LL+  G LG   P      DI   +    +L   DVGQ+ + + G VVA+
Sbjct: 136 MRGAHEVAPSLLLPEGVLGAIAPRPVDLDDIRLGLSLIASLGAFDVGQAVIVVNGFVVAV 195

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           E  EGTD ML R    R  GR+  GK  GVLVK  K QQD R DLPS+G +TVQ   +AG
Sbjct: 196 EAAEGTDEMLTRYKTMREKGRLRFGKGQGVLVKAPKPQQDRRVDLPSLGPRTVQRAAEAG 255

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           LAGIA EAG ++V + E +   AD+AG+FV G+  + A
Sbjct: 256 LAGIAFEAGGAIVPDAEHLVAEADKAGLFVVGVRPQVA 293


>gi|16126153|ref|NP_420717.1| UDP-2,3-diacylglucosamine pyrophosphatase [Caulobacter crescentus
           CB15]
 gi|221234924|ref|YP_002517360.1| UDP-2,3-diacylglucosamine pyrophosphatase [Caulobacter crescentus
           NA1000]
 gi|13423363|gb|AAK23885.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964096|gb|ACL95452.1| UDP-2,3-diacylglucosamine pyrophosphatase LpxI [Caulobacter
           crescentus NA1000]
          Length = 280

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 90/279 (32%), Positives = 141/279 (50%), Gaps = 3/279 (1%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M++L +IAG G LP  +A           +  + +        +   ++ +G+F  +   
Sbjct: 1   MRKLGLIAGGGALPVELASHCEAAGRAFAVMRLRSFADPSLDRYPGADVGIGEFGKIFKA 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L       +  AG +  RP+   L    +  L++   +      G+ A+L+  +D  E  
Sbjct: 61  LRAEGCDVVCFAGNVS-RPDFSALMPDARG-LKVLPSLIVAARKGDDALLRRVLDEFEKE 118

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  + GAHE++ E+ +  G LG   P  +   DI  A+  A  +  LD+GQ AV   G V
Sbjct: 119 GFEIEGAHEVMGEMTLPRGRLGKVSPAPEHMADIDKALDVAREIGRLDIGQGAVVCEGLV 178

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E  EGTD+ML+R+ D     R  A +  GVL K  K  Q+ R DLP+IG  T+    
Sbjct: 179 LAVEAQEGTDAMLRRVADLPEAIRGRAERRLGVLAKAPKPIQETRVDLPTIGVATIHRAA 238

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +AGLAGI  EAG+ LV+++E V   AD+ G+FV G+D +
Sbjct: 239 RAGLAGIVGEAGRLLVVDREAVIAAADDLGLFVLGVDPQ 277


>gi|224369343|ref|YP_002603507.1| hypothetical protein HRM2_22450 [Desulfobacterium autotrophicum
           HRM2]
 gi|223692060|gb|ACN15343.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 271

 Score =  288 bits (739), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 86/278 (30%), Positives = 142/278 (51%), Gaps = 13/278 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSI 60
           ++ +IAG G  P   AK A++K  E    + +NE S D  D     + + LG    + + 
Sbjct: 2   KIGLIAGGGQFPLLFAKKAKIKGYEIHAVAYVNEASTDLSDHVDTIQWMHLGQVGRMLTF 61

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
             +  I + V+ G++ +          IK  L+    I ++    + +IL+A  DLLES 
Sbjct: 62  FKRQEIAQAVMLGSVKKTRIFT----DIKPDLKALAFIARMGHTHDDSILRAFADLLESQ 117

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV++  +  ++PEL+   G      P R  K+DI    + A  +  LDVGQ+ V   G V
Sbjct: 118 GVTIKPSTFLLPELVSPRGCWTKRRPGRSEKKDIRTGWRIAREIGRLDVGQAIVIGNGTV 177

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E  +GTD+ ++R       G        VLVK+CK  QD R DLPS G +T+Q ++ 
Sbjct: 178 LAVEAADGTDATIRRGGLLGGGGS-------VLVKLCKPGQDRRFDLPSTGVETIQAMVD 230

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +G++ + LEA +S+  ++E +   ADE GI +  +  +
Sbjct: 231 SGVSVLVLEAERSISFDREQMTALADEHGIAIVAMAED 268


>gi|323698041|ref|ZP_08109953.1| protein of unknown function DUF1009 [Desulfovibrio sp. ND132]
 gi|323457973|gb|EGB13838.1| protein of unknown function DUF1009 [Desulfovibrio desulfuricans
           ND132]
          Length = 279

 Score =  288 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 87/279 (31%), Positives = 133/279 (47%), Gaps = 13/279 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRS 59
             + +IAG    P  VA+  + +    V+A      + D        REL LG    L S
Sbjct: 6   STIGLIAGGKQFPVLVARGVKARGHRLVVAGFTGHTNMDVVPLADVFRELKLGKLNQLIS 65

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L +  + ++++AG I++ P V D+       +R  K+I      G++A+L       E 
Sbjct: 66  FLKEEKVDKVIMAGTIEK-PKVMDIRH---LDMRAIKLILGRKDKGDSALLGIIGREFEK 121

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ VV AHE +P+LL   G +    P+     D+  A   A+ L  +DVGQ  V   G 
Sbjct: 122 EGMPVVPAHEYLPDLLSPEGVMTRREPDAREWGDLRFAWDIAKELGRMDVGQCVVVREGI 181

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V A+E +EGTD  L+R       G    G   V+VK+ K  Q    DLPS+G  T++ + 
Sbjct: 182 VAAVEALEGTDETLRR-------GFRYGGPECVVVKVFKPGQQQEVDLPSLGLDTLKLMA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +     + +EAGKSL  ++E   + AD AGI V G+  +
Sbjct: 235 EGKATCLGVEAGKSLFFDREAAIEFADRAGIAVVGLTAD 273


>gi|218888086|ref|YP_002437407.1| hypothetical protein DvMF_3002 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759040|gb|ACL09939.1| protein of unknown function DUF1009 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 281

 Score =  287 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 91/278 (32%), Positives = 134/278 (48%), Gaps = 14/278 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRSIL 61
           + IIAG G  P  VA+ AR +    V+           +        L LG    L    
Sbjct: 6   IGIIAGKGQFPALVARGARAEGLSVVMCGFHGHTDEALEHEADAFAMLHLGQLGKLIDFF 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
              N+ R+ +AGAI +   +      ++  LR +K++++L + G+ AIL+A ID LES G
Sbjct: 66  RDNNVRRLCLAGAISKPRAL-----DLRPDLRAAKVLFRLRAKGDDAILRAVIDELESEG 120

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           ++VV    +VP L    G L    P+ +   DI      A  L  LD+GQ  V   G  V
Sbjct: 121 LAVVQPASLVPGLRAPEGVLTRRPPSDEEWADIRYGWPIAHVLGRLDIGQCIVVKRGMTV 180

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG+EGTD+           G  L G+  V VK+ K  QD R DLP++GA T++ +   
Sbjct: 181 AVEGMEGTDAT-------LRRGGELGGEGCVAVKVVKPGQDDRIDLPALGAGTIRVLADY 233

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           G   +ALEAGK+L  ++E     AD+  I +  +   F
Sbjct: 234 GYTCLALEAGKTLFFDREESIALADKHDISIISMPEGF 271


>gi|302343534|ref|YP_003808063.1| hypothetical protein Deba_2104 [Desulfarculus baarsii DSM 2075]
 gi|301640147|gb|ADK85469.1| protein of unknown function DUF1009 [Desulfarculus baarsii DSM
           2075]
          Length = 275

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 90/278 (32%), Positives = 135/278 (48%), Gaps = 15/278 (5%)

Query: 1   MKR--LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCV 56
           M R  + +IAGS   P   AKAAR K    V  + L E   +      E   + LG    
Sbjct: 1   MSRQAIGLIAGSNQFPILFAKAARAKGLRVVAVAHLGETVPELAAEVDEITWIHLGQLGK 60

Query: 57  LRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDL 116
           L     +  + R V+ G + +          ++  LR   ++  L    +  IL+     
Sbjct: 61  LLKAFRKAGVTRAVMCGGVTKTRIFS----DVRPDLRALFLLRHLRHMADDGILRTVAQY 116

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           +   GV+++ +HE++PELL          P+ D   D       AE L  LD+GQ  V  
Sbjct: 117 MADQGVTIMASHELLPELLADGALHSRRGPSVDELDDARVGWTVAEQLGRLDIGQCVVVR 176

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
           G  VVA+E IEGTD+ + R       G  LAG+  V+VK CK  QD+R DLPS+G +TV+
Sbjct: 177 GKAVVAVEAIEGTDACIAR-------GGKLAGEKAVVVKRCKPTQDLRFDLPSVGRRTVE 229

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            + ++G + + +E+GK+LV ++E +   ADE GI V  
Sbjct: 230 VMAESGCSCLVVESGKTLVFDREPMLSLADEKGICVMA 267


>gi|148255858|ref|YP_001240443.1| hypothetical protein BBta_4505 [Bradyrhizobium sp. BTAi1]
 gi|146408031|gb|ABQ36537.1| hypothetical protein BBta_4505 [Bradyrhizobium sp. BTAi1]
          Length = 285

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 94/276 (34%), Positives = 141/276 (51%), Gaps = 4/276 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSI 60
             + +IA  G+LP+ VA     +   PV+ ++   C       F    + LG       +
Sbjct: 10  PPVGLIAAGGVLPFAVADEIVARGQTPVLFALKGICDPKPLARFRHHWIGLGQLGNALKL 69

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    +  ++  G +  RP V ++      +LR    IW    GG+  +L     + E +
Sbjct: 70  LKAEGVRDLMFIGNLV-RPAVSEIRIDW-GTLRELPYIWSAFRGGDDHLLSGVGRIFERH 127

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  ++G  ++ P LLV  G L    PN  V  DI   +    A++  DVGQ+ V I G V
Sbjct: 128 GFHMIGVKDVAPNLLVPEGHLTRSRPNDLVTGDIAKGLAVLRAMAPFDVGQAVVVIDGHV 187

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VALE I GTD +L R+V  R + RI +    GVLVK  KS QD+R DLP+IG +TV+ + 
Sbjct: 188 VALEDIGGTDGLLARVVRLRADRRIRSAAGRGVLVKAPKSGQDLRYDLPTIGPRTVEGLS 247

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            AGLAG+A+ AG +L+ + +     AD AG+F+ G+
Sbjct: 248 AAGLAGVAVSAGYTLLADPQETVSAADRAGLFITGV 283


>gi|262038002|ref|ZP_06011414.1| conserved hypothetical protein [Leptotrichia goodfellowii F0264]
 gi|261747955|gb|EEY35382.1| conserved hypothetical protein [Leptotrichia goodfellowii F0264]
          Length = 268

 Score =  286 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 78/279 (27%), Positives = 143/279 (51%), Gaps = 12/279 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE-LPLGDFCVLRS 59
           M R+ +IAG+G LP    K  + K  E     + +      ++        +     + S
Sbjct: 1   MDRVGLIAGNGKLPELFLKQCQKKGIELFSVYLFDSVEESIKNHSNSVKYSVAQPGKIIS 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  +  I++ G +++     +L F    +    K++    +  +  ILKA I+ +ES
Sbjct: 61  HFKRNGLSHIIMLGKVEKDLIFSNLKFDFTAT----KILLSAKNKKDKNILKAIINYIES 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G++V+  + ++ + +V+        P+ + ++ I   +++A+ L+++D GQ+ V     
Sbjct: 117 EGITVLPQNYLMDDYMVKQTVYTKYSPSAEEEKTIEIGIEAAKMLTDIDAGQTVVVKNQS 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ALEGIEGTD  + R       G  LAGK+ ++VKM +  QD R D+P+IG +TV+ V 
Sbjct: 177 VIALEGIEGTDKAILR-------GGELAGKNCIVVKMARKNQDYRIDIPTIGLETVKKVA 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +    GI +EA K L +++E V  +A++  IF+ GI  E
Sbjct: 230 EIKGRGIVVEADKMLFIDQEEVINYANKNKIFIKGIKYE 268


>gi|239947176|ref|ZP_04698929.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921452|gb|EER21476.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 270

 Score =  286 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   D  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYIKQGGNCYIAAIKDEADIDQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKEHEVKNIIFIGGVN-RPNFKNLAVDKIGGLLLFKIVGQ-KIRGDDSLLKTVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI         ++    P    K DI   +K    LS  D+ QS +     
Sbjct: 120 YGFKVISSNEIYKNQQGNSNTITDINPTSSDKNDIELGIKLLNHLSSFDIAQSVIVESSY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIARCADLRKNPY-----GGVLVKIPKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|51473899|ref|YP_067656.1| hypothetical protein RT0716 [Rickettsia typhi str. Wilmington]
 gi|51460211|gb|AAU04174.1| rickettsial conserved hypothetical protein [Rickettsia typhi str.
           Wilmington]
          Length = 274

 Score =  286 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 81/274 (29%), Positives = 138/274 (50%), Gaps = 4/274 (1%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L +IAG G LP+ +A     +  +  IA++ +E +    +DFE +   +G       
Sbjct: 2   LPNLGMIAGRGSLPHLIAYNYIKQGGKCYIAAIKDETNIKQIKDFEYKIFKIGMVGEAIR 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
               +N+  I+  G I+ RPN ++L       L + K++ Q +  G+ ++LK   +  ES
Sbjct: 62  YFKDHNVKNIIFIGGIN-RPNFKNLAVDKIGGLLLFKIVGQTI-RGDDSLLKIVAEFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYRNQQCNSNIITNTTLTSSDKNDIELGIKVLNHLSLFDIAQSVIVKNGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D RN     +   GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIVRCADLRNKSHGESH-GGVLVKIPKLGQDNRLDMPTIGPNTIKNLA 238

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++  K +++E+EL  K A++  IF+ 
Sbjct: 239 KYNYQGLAIQKNKVIIVEEELTIKLANKHKIFIT 272


>gi|91977315|ref|YP_569974.1| hypothetical protein RPD_2845 [Rhodopseudomonas palustris BisB5]
 gi|91683771|gb|ABE40073.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           BisB5]
          Length = 285

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 90/276 (32%), Positives = 144/276 (52%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ +A + + +   P++  +   C       F    + +G +  L+ +L 
Sbjct: 12  VGVIAGGGVLPFAIADSMQARQITPLLIGLRGFCDPTGIARFRHHWISIGQYGRLKRLLR 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             +   ++  G++  RP++  +      ++R+   +     GG+  +L +   + E  G 
Sbjct: 72  AEHCRDVMFIGSVV-RPSLASVRLDW-GAVRVLPSVMAAYRGGDDHLLTSIGRIFEGEGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            + G  ++ PELL+  G L    P+     DI   +    ALS  D+GQ  + I G VVA
Sbjct: 130 RLYGVKDVAPELLMPRGELTQATPDEGHLADIAKGIAVLAALSPFDIGQGVIVIDGHVVA 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E I GTD++L  +   R  G I A    GVLVK  KS QD+R DLP++G +TV+ V  A
Sbjct: 190 VEDIGGTDALLANLARLRAQGAIHAKPGRGVLVKSPKSGQDLRFDLPTLGPRTVEGVAAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGIA+ AG +LV E +   K AD AG+FV G+  
Sbjct: 250 GLAGIAVAAGNTLVAEPQETIKAADAAGLFVTGVPA 285


>gi|320353430|ref|YP_004194769.1| hypothetical protein Despr_1314 [Desulfobulbus propionicus DSM
           2032]
 gi|320121932|gb|ADW17478.1| protein of unknown function DUF1009 [Desulfobulbus propionicus DSM
           2032]
          Length = 283

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 83/277 (29%), Positives = 134/277 (48%), Gaps = 13/277 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRSIL 61
           + +IAG G  P   A+AAR +    V  + +NE + + +D       + LG    +    
Sbjct: 11  IGLIAGGGQFPLLFAEAARARGRRVVAIAHVNETAIEIEDRADAVYWVKLGQLGKIIKHF 70

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +  +G  V AG I +     D+   +K     SK+  +L    + AIL+A    +E  G
Sbjct: 71  KREGVGETVFAGTITKTRIFHDILPDLKGLSLWSKIDRRL----DDAILRAVAASMEEEG 126

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V+ +   +  L    G L    P+ +   DI    K A  +  LD+GQ  V     V+
Sbjct: 127 IRVLASTCYLEHLFFPKGLLSRKKPSAEQMEDIRFGWKVAREVGRLDIGQCVVVRDRSVL 186

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E IEGTD+ ++R       G  LAG   V+VK+ K  QD R DLP+ G +T+  +   
Sbjct: 187 AVEAIEGTDAAIRR-------GGELAGSGAVVVKLKKPNQDFRFDLPATGPRTIDTLAAV 239

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
             A +A+EAG+SL+ ++  + + AD AG+ V G+  +
Sbjct: 240 KGAVLAVEAGQSLLFDRTAMVEAADRAGLVVVGLVED 276


>gi|227825143|ref|ZP_03989975.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226905642|gb|EEH91560.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 276

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 68/283 (24%), Positives = 131/283 (46%), Gaps = 13/283 (4%)

Query: 1   MKR-LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVL 57
           M++ L ++AG G LP  V + A+      V  +++ E   D   +      + +G    +
Sbjct: 2   MEKTLGVLAGVGHLPVDVVRGAKQAGYRTVAIALVPETHEDLPKEADVFYAINIGKVGKI 61

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
            S L    +  + + G + +    +     +    +  K++  L    +  I+ A +  L
Sbjct: 62  FSTLKNEGVSEVTMIGKVTKEILYKG--GILIPDWQAVKLLMSLPDRHDDTIMNALVAKL 119

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G+ V+     +  ++ + G L    P      D+    + A+ +  LD+GQ+ V   
Sbjct: 120 EEMGIHVMDQTLFLKHIMPEEGVLSRRKPTDKEWEDMKYGFRMAKKIGGLDIGQTVVVKD 179

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             ++A+E IEGTD+ ++R            G+  ++ K  K  QD R D+P +G KT+++
Sbjct: 180 MAIMAVEAIEGTDACIKRGGSL--------GRGAIVAKTAKPAQDHRFDVPGVGVKTMES 231

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           +I++G AGI +E G++L +E+E     A+E  + V  +  E A
Sbjct: 232 MIESGCAGIVMETGRTLFVEREQALALANEHNLVVVSMSEETA 274


>gi|157803404|ref|YP_001491953.1| hypothetical protein A1E_01115 [Rickettsia canadensis str. McKiel]
 gi|157784667|gb|ABV73168.1| hypothetical protein A1E_01115 [Rickettsia canadensis str. McKiel]
          Length = 270

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 86/273 (31%), Positives = 137/273 (50%), Gaps = 8/273 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +AK    +  +  I ++  E   +  ++FE +   +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAKNYTTQGGKCYITAIQGETDINQIKNFEYKVFKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKENEVQNIIFIGGVN-RPNFKNLAVDKIGGLLLFKILGQ-KIRGDDSLLKTVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ +++I          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNKIYKNQQCDSNIITDTHPKSSDKNDIELGIKILNHLSPFDIAQSVIIESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T+QN+ 
Sbjct: 180 ILGIEAAEGTDNLIARCADLRKNHHE-----GVLVKIPKLGQDTRLDIPTIGPGTIQNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           K    GIA++AG+ +V+E+EL  K A+E  IF+
Sbjct: 235 KYNYCGIAIKAGEMIVVEQELTVKLANEHKIFI 267


>gi|91205179|ref|YP_537534.1| hypothetical protein RBE_0364 [Rickettsia bellii RML369-C]
 gi|91068723|gb|ABE04445.1| unknown [Rickettsia bellii RML369-C]
          Length = 270

 Score =  285 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 85/274 (31%), Positives = 134/274 (48%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LP  +A   + +     IA++  E + +  +DFE +   +G       
Sbjct: 2   LPNLGIIAGKGSLPSLIADNYKKQGGNCYIAAIEGEANIELIKDFEYQPFKIGMVGAAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              QYN+  I+  G +D RPN ++L       L + K+I Q    G+  +L+      E+
Sbjct: 62  YFTQYNVQNIIFIGGVD-RPNFKNLAVDKIGGLLLLKIISQ-KIRGDDNLLRIVAKFFEN 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ + EI          +    P    K+DI   +K    LS+ DVGQS +   G 
Sbjct: 120 YGFKVISSSEIYQNQQCDSTIITDTSPTNSDKKDIEFGVKLLNHLSKFDVGQSVIVEDGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E  EGTD+++ R  D R          GVL+K+ K  QD R DLP+IG  T++N+ 
Sbjct: 180 VLGIEAAEGTDNLIARCADLRKKSC-----GGVLIKLSKIGQDNRLDLPTIGVNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++  + ++ E+E   K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKKQVIIAEEEKTIKLANEHKIFIT 268


>gi|240850314|ref|YP_002971707.1| phosphatidate cytidyltransferase [Bartonella grahamii as4aup]
 gi|240267437|gb|ACS51025.1| phosphatidate cytidyltransferase [Bartonella grahamii as4aup]
          Length = 290

 Score =  285 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 110/276 (39%), Positives = 163/276 (59%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R  IIAG+G+LP  VA+A     + P +  +  E       +E  EL + +   L  IL 
Sbjct: 13  RTAIIAGNGVLPITVAQALEKNGENPFLVLLRGEADSVLYRYEHCELSIVELARLVKILK 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  +  +V+AG + +RP ++ L       L + K+I  L   G+ A+LKA I ++E+YG 
Sbjct: 73  EAGVYNVVLAGGVKKRPLLKQLRLDWTTFLALPKLIGALK-RGDDALLKAFIRIIEAYGF 131

Query: 123 SVVGAHEIVPELLVQ-VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHEIV +LL      L      R  K+DI  A ++A+ L +LD+GQ+ V + GRVV
Sbjct: 132 RVVGAHEIVADLLAPVEFDLTVRRATRKEKKDIFLAAEAAKLLGQLDIGQAVVVVQGRVV 191

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD+ML R+ + R  G+I   K GVLVK  K QQD R DLPSIG  T+ N+ K+
Sbjct: 192 ALEGAEGTDNMLWRVCEMRERGQIPL-KGGVLVKCAKPQQDNRVDLPSIGPATIMNIAKS 250

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL+G+A+EA +SL+L  +   + A++  +F+   ++
Sbjct: 251 GLSGVAVEANRSLILSVKTTIEKANKYSLFIETFEK 286


>gi|302038338|ref|YP_003798660.1| hypothetical protein NIDE3039 [Candidatus Nitrospira defluvii]
 gi|300606402|emb|CBK42735.1| conserved protein of unknown function, DUF1009 [Candidatus
           Nitrospira defluvii]
          Length = 280

 Score =  285 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 71/277 (25%), Positives = 129/277 (46%), Gaps = 13/277 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           +R+ +IAG+G  P   A  A+         +   E   +          + +G F  L  
Sbjct: 15  QRIGLIAGNGRFPIIFADNAKRLGYSVSAVAHEGETDPELARHVDHIHWIKIGQFGKLIE 74

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    + R V+ G I +         +++   R   +  +L+   +  IL+   + +E 
Sbjct: 75  ALKGDGVQRAVMLGGIKKTHIFS----TVRPDFRALALAAKLIHLKDDDILRRVAEEIEQ 130

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ +  +   +  +LV+ G+L    P++    DI       + +  LD+GQ  V     
Sbjct: 131 EGIQICESTFGLEGILVEEGTLTRREPSKKEWEDIRYGWDVGKQIGALDIGQCVVVKDRV 190

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +VA+E +EGTD  ++R       G  LA    V+VK CK QQD+R DLP++G +T++ + 
Sbjct: 191 IVAVEAVEGTDGAIRR-------GGELAHGGAVVVKRCKPQQDLRFDLPAVGPRTIEVME 243

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
               + +ALEAG+ ++L+++     A+ AGI + G+ 
Sbjct: 244 SVKASVLALEAGRGILLDRDDTIAKANRAGIAIIGMT 280


>gi|229587084|ref|YP_002845585.1| hypothetical protein RAF_ORF1018 [Rickettsia africae ESF-5]
 gi|228022134|gb|ACP53842.1| Unknown [Rickettsia africae ESF-5]
          Length = 270

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 86/274 (31%), Positives = 139/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L      SL + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVN-RPNFKNLAVDKIGSLLLFKIVGQ-KIRGDDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K  + LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITNTNPISSDKNDIELGIKLLDHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D RNN        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRNNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|94987560|ref|YP_595493.1| hypothetical protein LI1118 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731809|emb|CAJ55172.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 269

 Score =  285 bits (729), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 77/275 (28%), Positives = 127/275 (46%), Gaps = 14/275 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--LPLGDFCVLRSIL 61
           L +IAGSG  P+ V K A+ K  + ++           +D       +PLG F  L    
Sbjct: 2   LGVIAGSGQFPFMVVKGAQEKGYKVIVCGFHGHTDSKLEDIADHFEMMPLGQFNRLIRFF 61

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +  +  + +AGAI++   +Q     ++   R  ++ + L   G+ A+ +  I   E  G
Sbjct: 62  RRSGVIELCMAGAINKPRALQ-----VRPDFRAFRLYFSLCRKGDDALFRTIIKEFEKEG 116

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             +V     VP L    G L    P++D+  +I      A +L   D+GQ  V     V+
Sbjct: 117 FLMVSPSTFVPFLHCPPGVLSNKQPDKDILAEISYGWPIATSLGRFDIGQLIVVKQQMVI 176

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGT++ LQR       G  L GK+ V +K+ K  QD R DLP+IG +T+  ++K 
Sbjct: 177 AIECLEGTNATLQR-------GAELGGKNCVAIKIAKPIQDERVDLPAIGLETIHLLVKY 229

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
               IA+ A K+L  +       A++  + V  + 
Sbjct: 230 QFKCIAVSAEKTLFFDMPEALTLANKHKLCVMSLS 264


>gi|329121354|ref|ZP_08249980.1| protein of hypothetical function DUF1009 [Dialister micraerophilus
           DSM 19965]
 gi|327469763|gb|EGF15229.1| protein of hypothetical function DUF1009 [Dialister micraerophilus
           DSM 19965]
          Length = 275

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 73/282 (25%), Positives = 139/282 (49%), Gaps = 13/282 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M RL ++AG G LP+   + A+ +  E V  +V+ +     + +  +   +       + 
Sbjct: 1   MARLGLLAGVGTLPFEFVQTAKKQGHEIVCIAVVPDVDTRLRSYSDKYFEINVFKLNKIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG--NAAILKASIDL 116
             L + N+  + + G + +    +     +   LR  K++ +L      +  I+ A +D 
Sbjct: 61  KTLCEANVKEVTMLGKVTKEYLYK--RKLVIPDLRTVKILNKLRKLDFKDDTIMLALVDE 118

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G+ V+   + +  L+         +P+ +   DI    K+A+ + ++D+GQ+ V  
Sbjct: 119 LEGSGLKVMDQTKYLKPLMPPPQIFTHAMPSEEQMDDIAFGFKTAKLIGQMDMGQTVVVK 178

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+ ++R       G  LAGK  V+VK+ K  QD R D+P++G  T+ 
Sbjct: 179 DKAVMAVEAIEGTDACIRR-------GGKLAGKGAVVVKVAKPNQDPRFDVPAVGLDTLN 231

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            +I+     +A+EA K+L +++  V   ADE  I +  +++E
Sbjct: 232 AMIETKCKVLAIEAEKTLFVDRFDVMDKADEHDIVIVSVNQE 273


>gi|15893033|ref|NP_360747.1| hypothetical protein RC1110 [Rickettsia conorii str. Malish 7]
 gi|15620234|gb|AAL03648.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 270

 Score =  284 bits (728), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 83/274 (30%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVN-RPNFKNLAVDKIGGLLLFKIVGQ-KIRGDDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITNTNPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A++  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANKHKIFIT 268


>gi|154248347|ref|YP_001419305.1| hypothetical protein Xaut_4427 [Xanthobacter autotrophicus Py2]
 gi|154162432|gb|ABS69648.1| protein of unknown function DUF1009 [Xanthobacter autotrophicus
           Py2]
          Length = 306

 Score =  284 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 93/276 (33%), Positives = 142/276 (51%), Gaps = 3/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + I+AG G  P  VA+A   +  + ++  +        + +  +   LG    + ++   
Sbjct: 26  VGIVAGGGAFPAAVAEAVIAQGRDVLLLLIRGFADPALERYPHQWFRLGSLGSVTAMAKA 85

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +V+ GA+  RP V DL F     LR+   I +L  GG+  +L   + L+   G +
Sbjct: 86  RGVRDVVMVGALT-RPRVSDLGFDW-TMLRLLPRIARLFRGGDNHLLSGVLGLVAEQGFN 143

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +VGAHE+ P LL+  G LG   P+   ++D++  +     L   DVGQ  + + G V A+
Sbjct: 144 LVGAHEVAPGLLLPQGVLGARAPSAQDRQDMVRGLDVIRTLGPFDVGQGVIVVDGFVAAV 203

Query: 184 EGIEGTDSMLQRIVDCRNNGRIL-AGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           E  EGTD ML R  + R  GR+      GVLVK  K  QD R DLPS+G  TV    + G
Sbjct: 204 EAAEGTDQMLARYGEMRRTGRLRFHAGRGVLVKAPKPGQDRRVDLPSLGPATVARAAEVG 263

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           L GIA EAG ++V + + +   AD AG+F+ G+DR 
Sbjct: 264 LGGIAFEAGGAIVPDVQALVAGADAAGLFIYGMDRS 299


>gi|307942154|ref|ZP_07657505.1| phosphatidate cytidyltransferase [Roseibium sp. TrichSKD4]
 gi|307774440|gb|EFO33650.1| phosphatidate cytidyltransferase [Roseibium sp. TrichSKD4]
          Length = 291

 Score =  284 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 108/275 (39%), Positives = 162/275 (58%), Gaps = 2/275 (0%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ +IAG+G LP  V    + +  +  I ++  E S   +     EL  G+   L   L 
Sbjct: 13  RIAVIAGNGALPEQVVSVLQSRGRDHRIVAIKGEASETTRQAAAVELGWGEIGRLYRFLE 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     I++ G I +RP+++          R+ K++  L+ GG+ ++LK  I L E+ G 
Sbjct: 73  RSGCDEILLIGGISQRPDLRSFVGDFGTLRRLPKILKALI-GGDDSLLKKVIGLFETEGY 131

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           SVVG  ++  ELL + G++G   P+    RD+  A+ + + L ELD+GQ+AV+IGGRVVA
Sbjct: 132 SVVGIKDVASELLAEAGTMGRHQPSDSNLRDLRLALAATQKLGELDIGQAAVAIGGRVVA 191

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           LEG EGTD+ML+R    R+ GR+     +GVLVK  K  QD+R DLP+IG +TV    KA
Sbjct: 192 LEGAEGTDAMLERCQQLRDTGRVKGRTPAGVLVKSAKPTQDLRVDLPAIGPRTVDLAHKA 251

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           GLAG+A+ AG +LV E++L    A+E G+F+ G D
Sbjct: 252 GLAGVAVHAGNALVSERDLTLSKANELGLFIYGFD 286


>gi|34581279|ref|ZP_00142759.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262664|gb|EAA26168.1| unknown [Rickettsia sibirica 246]
          Length = 270

 Score =  284 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVN-RPNFKNLAVDKIGGLLLFKIVGQ-KIRGDDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITNTHPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|238019679|ref|ZP_04600105.1| hypothetical protein VEIDISOL_01553 [Veillonella dispar ATCC 17748]
 gi|237863720|gb|EEP65010.1| hypothetical protein VEIDISOL_01553 [Veillonella dispar ATCC 17748]
          Length = 278

 Score =  284 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 72/281 (25%), Positives = 136/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M ++ +IAG G+LP    +AA +   E V+  V+ +       +     ++ +     + 
Sbjct: 1   MAKVGLIAGIGVLPVEFMRAAHVLGHEVVVIGVVPDVDPALKAEADAFYDIGVAKLGKIF 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + L F     L+   ++ +L +  +  I+ A +D +E
Sbjct: 61  KTLKKEGVEELTMLGKVTKEILFKGLTF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIE 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G  V+     +   + +VG L    P  +   DI    + A+ +  LD+GQ+ V    
Sbjct: 118 REGFKVLDQTVYLKPFMPKVGVLSKTQPTDEQWADICFGFELAKQMGGLDIGQTVVVKHK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD  + R       G  L     V+VK  K  QD+R D+P++G KT+ ++
Sbjct: 178 AAMAIEAIEGTDKCILR-------GGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I +G   +A+EA K++ ++++ V   A+  GI +C +D+EF
Sbjct: 231 IDSGCKVLAVEAEKTIFVQQQDVLDLANRHGIVICAVDQEF 271


>gi|157964871|ref|YP_001499695.1| hypothetical protein RMA_1147 [Rickettsia massiliae MTU5]
 gi|157844647|gb|ABV85148.1| hypothetical protein RMA_1147 [Rickettsia massiliae MTU5]
          Length = 275

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 135/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   D  +DFE + L +G       
Sbjct: 7   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIDQIKDFEYKILKIGMVGEAIK 66

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 67  YFKEHEVKNIIFIGGVN-RPNFKNLAVDTIGGLLLFKIVGQ-KIRGDDSLLKTVADFFES 124

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 125 YGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNHLSSFDIAQSVIVESGY 184

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R    R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 185 ILGIEAAEGTDNLITRCAALRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 239

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 240 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 273


>gi|157827484|ref|YP_001496548.1| hypothetical protein A1I_05955 [Rickettsia bellii OSU 85-389]
 gi|157802788|gb|ABV79511.1| hypothetical protein A1I_05955 [Rickettsia bellii OSU 85-389]
          Length = 270

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 134/274 (48%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRS 59
           +  L IIAG G LP  +A   + +     IA++  E + +  ++FE +   +G       
Sbjct: 2   LPNLGIIAGKGSLPSLIAGNYKKQGGNCYIAAIEGEANIELIKEFEYQPFKIGMVGAAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              QYN+  I+  G +D RPN ++L       L + K+I Q    G+  +L+      E+
Sbjct: 62  YFTQYNVQNIIFIGGVD-RPNFKNLAVDKIGGLLLLKIISQ-KIRGDDNLLRIVAKFFEN 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ + EI          +    P    K+DI   +K    LS+ DVGQS +   G 
Sbjct: 120 YGFKVISSSEIYQNQQCDSTIITDTSPTNSDKKDIEFGVKLLNHLSKFDVGQSVIVEDGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E  EGTD+++ R  D R          GVL+K+ K  QD R DLP+IG  T++N+ 
Sbjct: 180 VLGIEAAEGTDNLIARCADLRKKSC-----GGVLIKLSKIGQDNRLDLPTIGVNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++  + ++ E+E   K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNQVIIAEEEKTIKLANEHKIFIT 268


>gi|320108836|ref|YP_004184426.1| hypothetical protein AciPR4_3680 [Terriglobus saanensis SP1PR4]
 gi|319927357|gb|ADV84432.1| protein of unknown function DUF1009 [Terriglobus saanensis SP1PR4]
          Length = 293

 Score =  283 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 73/283 (25%), Positives = 135/283 (47%), Gaps = 14/283 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-------QDFECRELPLGDF 54
            +L +IAG+G  P+ +  AAR +    V+A++  E   +               + LG+ 
Sbjct: 6   SKLGLIAGNGRFPFLLLDAARARGIAVVVAAIHEETDPEMNARATADAGIRVHWMSLGEL 65

Query: 55  CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASI 114
             L    H   + + V+AG +  +     +    K    ++K++  L +     +L A  
Sbjct: 66  SKLIDTFHAEGVMQAVMAGQVRHKQIFSAIRPDWK----LAKLLMSLRTRNTDMLLGAVA 121

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
            +L   G+ ++ +   +  +L + G L    P+ +  +DI   +  A  ++  D+GQ+ V
Sbjct: 122 KVLGDEGIELISSTAYLEPMLARAGVLTQRAPDEEELKDIAYGLTVARGIAGFDLGQTVV 181

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILA---GKSGVLVKMCKSQQDMRADLPSIG 231
                 VA+E +EGTD+ + R  +        A    +S  +VK+ K +QDMR D+P IG
Sbjct: 182 IAAQACVAIEAMEGTDATIARAGELFRTLEAEASTLRRSLTVVKVAKPKQDMRFDVPVIG 241

Query: 232 AKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
             T++ +I AG   +A+EAG++L+ ++  +   A+ AGI V G
Sbjct: 242 LPTIEAMISAGATCLAIEAGRTLLFDEPALIARANAAGICVVG 284


>gi|313892335|ref|ZP_07825927.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
 gi|313119194|gb|EFR42394.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
          Length = 275

 Score =  283 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 73/282 (25%), Positives = 139/282 (49%), Gaps = 13/282 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M RL ++AG G LP+   + A+ +  E V  +V+ +     + +  +   +       + 
Sbjct: 1   MARLGLLAGVGTLPFEFVQMAKKQGHEIVCIAVVPDVDTRLRSYSDKYFEINVFKLNKIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG--NAAILKASIDL 116
             L + N+  + + G + +    +     +   LR  K++ +L      +  I+ A +D 
Sbjct: 61  KTLCEANVKEVTMLGKVTKEYLYK--RKLVIPDLRTVKLLNKLRKLDFKDDTIMLALVDE 118

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           LE  G+ V+   + +  L+         +P+ +   DI    K+A+ + ++D+GQ+ V  
Sbjct: 119 LEGSGLKVMDQTKYLKPLMPPPQIFTHAMPSEEQMDDIAFGFKTAKLIGQMDMGQTVVVK 178

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+ ++R       G  LAGK  V+VK+ K  QD R D+P++G  T+ 
Sbjct: 179 DKAVMAVEAIEGTDACIRR-------GGKLAGKGAVVVKVAKPNQDPRFDVPAVGLDTLN 231

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            +I+     +A+EA K+L +++  V   ADE  I +  +++E
Sbjct: 232 AMIETKCKVLAIEAEKTLFVDRFDVMDKADEHDIVIVSVNQE 273


>gi|157828955|ref|YP_001495197.1| hypothetical protein A1G_06155 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933680|ref|YP_001650469.1| hypothetical protein RrIowa_1323 [Rickettsia rickettsii str. Iowa]
 gi|157801436|gb|ABV76689.1| hypothetical protein A1G_06155 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908767|gb|ABY73063.1| hypothetical protein RrIowa_1323 [Rickettsia rickettsii str. Iowa]
          Length = 270

 Score =  283 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVN-RPNFKNLAVDKIGGLLLFKIVGQ-KIRGDDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|288958455|ref|YP_003448796.1| hypothetical protein AZL_016140 [Azospirillum sp. B510]
 gi|288910763|dbj|BAI72252.1| hypothetical protein AZL_016140 [Azospirillum sp. B510]
          Length = 283

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 96/276 (34%), Positives = 152/276 (55%), Gaps = 9/276 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSI 60
            +L I+AG G LP  +A+A R +  +  I +                    G    +   
Sbjct: 13  PKLGILAGGGTLPARIAEAVRGQGRDVFIVAFDGHTDPPTVAGLPHIWSRFGAAGTILRR 72

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           LH+  +  +V+AG + RRP+  +L    + +  ++++  + +  G+  +L+A +  +E  
Sbjct: 73  LHEEGVSEVVLAGPV-RRPSFTELMPDWRTARFLARVGSRAL--GDDGLLRAVVREVEED 129

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVG H+++ +L+   G +G  VP+ D +RDI  A++ A A+  LDVGQ AV   G V
Sbjct: 130 GFRVVGLHDLLKDLMTVTGPVGRLVPDSDAERDISRAIEVARAMGTLDVGQGAVVQQGIV 189

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E IEGTD+ML R       G    G  GVLVK+ K +QD R DLP++G  TV+    
Sbjct: 190 LAVEAIEGTDAMLGRCA-----GLARPGPGGVLVKVKKPKQDRRIDLPTMGVTTVERAAA 244

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           AGL G+A+EAG SL++++  V + AD  G+FV GI+
Sbjct: 245 AGLRGVAVEAGGSLLIDRAAVAETADRLGLFVVGIE 280


>gi|238650386|ref|YP_002916238.1| hypothetical protein RPR_01465 [Rickettsia peacockii str. Rustic]
 gi|238624484|gb|ACR47190.1| hypothetical protein RPR_01465 [Rickettsia peacockii str. Rustic]
          Length = 270

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 137/274 (50%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +     IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGNCYIAAIKDEADIEQIKDFEYKILKIGMVGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              ++ +  I+  G ++ RPN ++L       L + K++ Q    G+ ++LK   D  ES
Sbjct: 62  YFKEHKVKNIIFIGGVN-RPNFKNLAVDKIGGLLLFKIVGQ-KIRGDDSLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +    P    K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQGNSNIITDTNPISSDKNDIELGIKLLNHLSAFDIAQSVIVESGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E +EGTD+++ R  D R N        GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAVEGTDNLITRCADLRKNPH-----GGVLVKIAKLGQDNRLDIPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|67458570|ref|YP_246194.1| hypothetical protein RF_0178 [Rickettsia felis URRWXCal2]
 gi|67004103|gb|AAY61029.1| unknown [Rickettsia felis URRWXCal2]
          Length = 270

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 81/274 (29%), Positives = 131/274 (47%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +  +  IA++ +E   +  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIASNYTKQGGKCYIAAIKDEADIEQIKDFEYKILKIGMIGEAIK 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 +  I+  G ++ RPN ++L       L + K++ Q    G+  +LK      ES
Sbjct: 62  YFKDNEVQNIIFIGGVN-RPNFKNLSVDKIGGLLLFKIVGQ-KIRGDDNLLKIVAAFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++EI          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNEIYKNQQDNSNIITDITLTNSDKNDIELGVKLLNHLSSFDIAQSVIVENGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R          GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIARCADLRKKPY-----GGVLVKIPKLGQDNRLDMPTIGPDTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|192291628|ref|YP_001992233.1| hypothetical protein Rpal_3256 [Rhodopseudomonas palustris TIE-1]
 gi|192285377|gb|ACF01758.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           TIE-1]
          Length = 285

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 90/276 (32%), Positives = 145/276 (52%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + IIAG G LP+ VA +   +   PV+ ++   C  +    +    L +G F  L  +L 
Sbjct: 12  VGIIAGGGTLPFAVADSLAARGLTPVLFALKGSCDPERVTAYRHHWLRMGAFGRLLRLLR 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 +V  G++  RP + D+      ++++   +     GG+  +L     L E +G 
Sbjct: 72  DEGCRDLVFIGSLV-RPALSDMRLDW-GAIKVLPAVLAAYRGGDDHLLTGVGRLFERHGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G  ++  +LL+  G L   VP+  V+ DI        ALS  D+GQ  V I G VVA
Sbjct: 130 RLLGLKDVATDLLMPAGCLTRAVPDAGVEADIAKGRAVLAALSPFDIGQGCVVIDGHVVA 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E   GTD +L+R+   R++ RI A    GVLVK  K+ QD+R DLP++G KT++ +I A
Sbjct: 190 VEDTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKTGQDLRFDLPALGPKTIEGLIAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            L G+A+ AG ++V E + +   AD+AG+F  G+  
Sbjct: 250 QLGGVAVVAGHTVVAEPQEMIAAADKAGVFAIGMPA 285


>gi|312897545|ref|ZP_07756965.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310621397|gb|EFQ04937.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 274

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 72/281 (25%), Positives = 137/281 (48%), Gaps = 12/281 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLR 58
           M ++ ++AG G LP    +AA     E ++ SV+ + +     +     E+ +     + 
Sbjct: 4   MGKVGLLAGVGNLPVEFLRAAHQMGHEVIVISVVPDTAAALKTEADAYYEINVAKLDKII 63

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  +  + + G + +    + + F      R  K++ +L +  +  I+ A +D L 
Sbjct: 64  KTLLREGVTDVTMIGKVTKEILFKGIKF---PDFRAVKLLAKLRNRKDDTIMLAIVDELA 120

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              + V      +  L+   G L    P  + K DI    ++A+A+  +D+GQ+ V    
Sbjct: 121 KDNLVVADQTAYLKPLMPPPGVLTKRNPTEEEKEDIRFGFETAKAMGGMDIGQTVVVKHK 180

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ ++R       G         +VK+ K  QD+R D+P++G +T+ ++
Sbjct: 181 AVMAIEAIEGTDACIRRGGALGRGGA-------CVVKVAKPNQDVRFDVPAVGKQTLLSM 233

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           I++G   +A+EA K+L +E+E V   ADE  I +C +D  +
Sbjct: 234 IESGCTLLAMEAHKTLFVEQEEVLALADEHRICICAVDESY 274


>gi|158522849|ref|YP_001530719.1| hypothetical protein Dole_2839 [Desulfococcus oleovorans Hxd3]
 gi|158511675|gb|ABW68642.1| protein of unknown function DUF1009 [Desulfococcus oleovorans Hxd3]
          Length = 273

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 72/275 (26%), Positives = 120/275 (43%), Gaps = 13/275 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSIL 61
           + +IAG G  P   A+AA+         +   +     Q+       L +G    L    
Sbjct: 3   IGLIAGGGCFPLLFARAAKAAGHRVYAVAYTGQADPAIQEAVDAAAWLNVGQVEHLLGFF 62

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++ +   V+ G + +           +        I  L    +  +L++   LLE  G
Sbjct: 63  SRHQVTDTVIMGWVRKTVMFS----DFQPDATALAFIAGLTETHDDLLLRSFAGLLEENG 118

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V  +  ++P +L   G      P      DI    + A+ +  LDVGQ  V   G V+
Sbjct: 119 LRVRASTFLLPHILAGEGCWTKTKPTAGQWSDISLGWRIAKEIGRLDVGQCVVVQKGSVL 178

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E IEGTD+ + R       G  L G   V+VK+CK  QD+R D+P++G +TV+ +   
Sbjct: 179 AVEAIEGTDAAIAR-------GGRLGGGDAVVVKVCKPNQDLRFDIPAVGMETVKTMQST 231

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           G   +A+EAG+S+V +K  +   AD   + V  + 
Sbjct: 232 GAKVLAVEAGRSVVFDKPEMVSFADANNMCVMALT 266


>gi|163760894|ref|ZP_02167973.1| hypothetical protein HPDFL43_07107 [Hoeflea phototrophica DFL-43]
 gi|162281938|gb|EDQ32230.1| hypothetical protein HPDFL43_07107 [Hoeflea phototrophica DFL-43]
          Length = 299

 Score =  281 bits (721), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 119/276 (43%), Positives = 175/276 (63%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL I+AG G  P  VA +AR     P + ++  E   DW  ++   L +G+      I  
Sbjct: 13  RLGILAGRGSFPQVVAASARALEHNPFVFTIDGEADQDWSGYDTASLNIGNLSAFMDIAR 72

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           + +IG +V+AG I RRP ++D+  +          +  L+SGG+  IL+A+I +LE++G+
Sbjct: 73  RESIGTVVLAGGIARRPGLRDIRPTWAALKSAPSALKALLSGGDDKILRAAIHVLETHGM 132

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+ A EI P+LL + G LG   P +  + +I AA ++A AL  LD+GQ AV++ GRV+A
Sbjct: 133 CVLAAQEIAPDLLGEAGPLGDHRPGKSDQANIAAATQAALALGHLDIGQGAVAVSGRVIA 192

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           LEG+EGTD ML+R+   R NGR+ AG  GVLVK+CK  Q+ RADLP+IG  TV N   +G
Sbjct: 193 LEGLEGTDGMLRRVAGLRANGRLRAGSRGVLVKLCKPGQEQRADLPAIGPDTVLNAHASG 252

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAG+A+EAG+SLVLE++ V   A+  G+FV G++ +
Sbjct: 253 LAGVAIEAGRSLVLERDRVIAEANRLGLFVTGLELD 288


>gi|13470831|ref|NP_102400.1| hypothetical protein mll0631 [Mesorhizobium loti MAFF303099]
 gi|14021574|dbj|BAB48186.1| mll0631 [Mesorhizobium loti MAFF303099]
          Length = 304

 Score =  281 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 110/275 (40%), Positives = 159/275 (57%), Gaps = 3/275 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS--FDWQDFECRELPLGDFCVLRSI 60
           R+ IIAG G LP  VA  +  +   P I  +  E     +   +E   L L     L  +
Sbjct: 23  RVGIIAGGGSLPVEVAAGSAGQGYPPFIVLMEGEADRLTELCQYEHETLALEAIGSLVPL 82

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L ++ I  +V+AG I RRP +  L  S+   L +  ++   ++ G+  +LK     LE+ 
Sbjct: 83  LKRHRITHLVLAGEIKRRPRLTHLRPSL-SLLAVIPIVVMALARGDDGLLKVVARGLEAR 141

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ ++GAHEIVP L+   G L   VP +   RDI A   +A+A+  LD+GQ+A+++GGR 
Sbjct: 142 GIKIMGAHEIVPNLVAAEGVLTKAVPQKSDWRDIEAGFAAAKAIGALDIGQAAIAVGGRA 201

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +ALEGIEGT  +L R    R +GRI     GVLVK  K  Q++RADLPS+G +TV+    
Sbjct: 202 IALEGIEGTAGLLDRAKLLRGHGRIAGKTRGVLVKCAKPGQELRADLPSMGPQTVEAAHA 261

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           AGLAGIA+EAG+SL+LE       A+E G+F+ G+
Sbjct: 262 AGLAGIAVEAGRSLILEGPATLSRANELGLFIVGL 296


>gi|39935975|ref|NP_948251.1| hypothetical protein RPA2910 [Rhodopseudomonas palustris CGA009]
 gi|39649829|emb|CAE28351.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 285

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 89/276 (32%), Positives = 144/276 (52%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + IIAG G LP+ VA +   +   PV+ ++   C  +    +    L +G F  L  +L 
Sbjct: 12  VGIIAGGGTLPFAVADSLAARGLTPVLFALKGSCDPERVTAYRHHWLRMGAFGRLLRLLR 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 +V  G++  RP + D+      ++++   +     GG+  +L     L E +G 
Sbjct: 72  DEGCRDLVFIGSLV-RPALSDMRLDW-GAIKVLPAVLAAYRGGDDHLLTGVGRLFERHGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G  ++  +LL+  G L    P+  V+ DI        ALS  D+GQ  V I G VVA
Sbjct: 130 RLLGLKDVATDLLMPAGCLTRAAPDAGVEADIAKGRAVLAALSPFDIGQGCVVIDGHVVA 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E   GTD +L+R+   R++ RI A    GVLVK  K+ QD+R DLP++G KT++ +I A
Sbjct: 190 VEDTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKTGQDLRFDLPALGPKTIEGLITA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            L G+A+ AG ++V E + +   AD+AG+F  G+  
Sbjct: 250 QLGGVAVVAGHTVVAEPQEMIAAADKAGVFAIGMPA 285


>gi|291278543|ref|YP_003495378.1| hypothetical protein DEFDS_0110 [Deferribacter desulfuricans SSM1]
 gi|290753245|dbj|BAI79622.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 271

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 76/278 (27%), Positives = 132/278 (47%), Gaps = 13/278 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSI 60
           +  ++AG G LP       +    E V  +   E + D         +  +G    +   
Sbjct: 2   KTAVLAGYGNLPLIAINNLKAMGHEVVTIAFNEEINTDLSGVSDKIYKFSVGQAKKVLDT 61

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  +  ++ AG I++     +L    K  +   K++  L    +  I+   ++LLE  
Sbjct: 62  LEKERVESVLFAGKINKSLLYSNL----KFDMFSVKLLMSLKDRKDDTIMLKIVELLEER 117

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G++V+   ++  +LLV+ G L    P      DIL   K A+ +  +D+GQ+ V     V
Sbjct: 118 GITVLKQTDVFKDLLVEEGVLTKMKPTGQEMEDILFGFKVAKEIGRVDIGQTVVVKNKAV 177

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E IEGTD  ++R       G   A   GV+VK+ K  QD+R D+P++G  T++N+  
Sbjct: 178 MAVEAIEGTDEAIKR-------GCKYAKNGGVIVKVSKPCQDLRFDVPTVGIDTLKNIKD 230

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
                +ALEA K+ V++K+   K A++  I + GI  E
Sbjct: 231 NKGKILALEANKTFVVDKDECVKFANKNKIVIVGIRGE 268


>gi|115524572|ref|YP_781483.1| hypothetical protein RPE_2565 [Rhodopseudomonas palustris BisA53]
 gi|115518519|gb|ABJ06503.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           BisA53]
          Length = 284

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 89/274 (32%), Positives = 146/274 (53%), Gaps = 4/274 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ VA + + +    V+ ++   C  D    +    + +G F  LR +L 
Sbjct: 11  VGLIAGGGVLPFAVADSLQARGIGAVLFALKGSCDADQLSRYRHHWISIGAFGQLRRLLR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 ++  GA+  RP++  +      ++R+   I     GG+  +L     + E  G 
Sbjct: 71  AEQCRDVLFIGALV-RPSLSAVRLDW-GAIRVMPAILAAYRGGDDHLLTGIGQIFERDGF 128

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G  ++ P+LL+  G +    PN+D + DI        ALS  D+GQ  V I G VV+
Sbjct: 129 RLLGLKDVAPDLLMPEGCMTRARPNKDTEADIAKGRAVLAALSPFDIGQGCVVIDGHVVS 188

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E   GTD +L+R+   R   R+ A    GVLVK  KS QD+R DLP++G KT++ +I A
Sbjct: 189 VEDTGGTDGLLRRVEQLRGERRLRAKPGRGVLVKAPKSGQDLRFDLPALGPKTIEGLIAA 248

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +AG+A+ AG ++V E + +   AD AG+FV G+
Sbjct: 249 QIAGVAVVAGHTVVAEPQAMVDAADRAGLFVTGV 282


>gi|27379959|ref|NP_771488.1| hypothetical protein bll4848 [Bradyrhizobium japonicum USDA 110]
 gi|27353112|dbj|BAC50113.1| bll4848 [Bradyrhizobium japonicum USDA 110]
          Length = 289

 Score =  281 bits (719), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 90/276 (32%), Positives = 145/276 (52%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILH 62
           + ++AG G +P+ VA +   +   PV+  +   C     + F  R + +G       +  
Sbjct: 16  VGVVAGGGAMPFAVADSLATRGITPVLFPLRGACDPVQVEKFRHRWISVGQLGRAMRLFR 75

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     ++  G +  RP++ ++ F    +LR+   + +   GG+  +L     +LE  G 
Sbjct: 76  EEGCRDLIFIGTLV-RPSLSEIRFDF-TTLRLLGNVIRAFRGGDDHLLSGVGRILEQGGF 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +VG  ++ P+LL+  G +    P+   K DI        AL   D+GQ+AV I G VVA
Sbjct: 134 RMVGIKDVAPDLLMPEGCISRAWPSDTSKTDIERGRAVLTALGPFDIGQAAVVIDGHVVA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E IEGTD++L R+   R  GRI A    GVLVK  KS QD+R DLP+IG +T++ V +A
Sbjct: 194 VEDIEGTDALLARVARLREEGRIRAATGRGVLVKAPKSSQDLRFDLPTIGPRTIEGVARA 253

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGIA+ AG ++  E + +   AD   +F+ G+  
Sbjct: 254 GLAGIAVIAGNTIAAEPQAMIALADAKYLFIIGLPA 289


>gi|295689585|ref|YP_003593278.1| hypothetical protein Cseg_2197 [Caulobacter segnis ATCC 21756]
 gi|295431488|gb|ADG10660.1| protein of unknown function DUF1009 [Caulobacter segnis ATCC 21756]
          Length = 280

 Score =  281 bits (719), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 93/278 (33%), Positives = 141/278 (50%), Gaps = 3/278 (1%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M++L +IAG G LP  +A           +  + +        +   ++ LG+F  +   
Sbjct: 1   MRKLGLIAGGGALPVELAARCEAAGRSFAVMRLKSFADPALARYPGIDVGLGEFGKVFKA 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L       +  AG + +RP+   L    +    +  +I      G+ A+L+  +D  E  
Sbjct: 61  LRAEGCEVVCFAGNV-KRPDFATLMPDARGLKVVPGLIMAA-RQGDDALLRRVLDEFEKE 118

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  + GAHE+V E+ + +G LG   P  D   DI  A+  A  +  LDVGQ AV   G V
Sbjct: 119 GFEIEGAHEVVDEMTLPLGRLGRFYPAADHMADIDKALMVAREIGRLDVGQGAVVCDGLV 178

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E  EGTD+ML+R+ D  +  R  A    GVL K  K  Q+ + DLP+IG  T+    
Sbjct: 179 LAVEAQEGTDAMLRRVADLPHAIRGSAERPRGVLAKAPKPIQETKVDLPTIGVATLHRAA 238

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           +AGLAG+  EAG+ LV+++E V   ADE G+FV G+D 
Sbjct: 239 RAGLAGVVGEAGRLLVVDREAVIAAADELGLFVLGVDP 276


>gi|320101871|ref|YP_004177462.1| hypothetical protein Isop_0318 [Isosphaera pallida ATCC 43644]
 gi|319749153|gb|ADV60913.1| protein of unknown function DUF1009 [Isosphaera pallida ATCC 43644]
          Length = 328

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 72/278 (25%), Positives = 126/278 (45%), Gaps = 9/278 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           +++ ++AGSG  P   A+AAR +  E     +  E + +          + +     +  
Sbjct: 38  RKIGLLAGSGRFPILFAEAARRQGLEVYCVGIRYEAADELVPLCARFEWVSVTRMNSMIQ 97

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCF-SIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
              +  I  +V+AG + +           +    R  +    L    +  +L + ID   
Sbjct: 98  AFQRMGIDEVVMAGKVIKNVMYTPWRILRLWPDRRTVRWWRNLPDRKDDTVLLSLIDEFA 157

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+    A +  PELLV  G L     +   + D+    + A+A+  LDVGQS      
Sbjct: 158 RDGIRFTSALDYCPELLVDHGLLSCRPLSPLERGDVAFGWRLAKAMGGLDVGQSVAVKER 217

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E IEGTD  ++R       G         LVK+ K QQDMR D+P+IG  T++N+
Sbjct: 218 AALAVEAIEGTDRCIERAGQLCKAG------GWTLVKVAKPQQDMRFDVPTIGLSTIENL 271

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            +A    +A+EA K+++++++LV   A+  GI +  + 
Sbjct: 272 ARARARVLAVEAQKTILIDRDLVIARANHYGITLIALT 309


>gi|162147924|ref|YP_001602385.1| hypothetical protein GDI_2140 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542542|ref|YP_002274771.1| hypothetical protein Gdia_0360 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786501|emb|CAP56083.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530219|gb|ACI50156.1| protein of unknown function DUF1009 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 282

 Score =  280 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 95/274 (34%), Positives = 140/274 (51%), Gaps = 7/274 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILH 62
           + I+AG G LP  VA+AA        I    +       + +  R + L     + S L 
Sbjct: 15  VGILAGGGPLPGQVARAAVAMGLRVFIVGFQDFAEPAIIEPWPHRYIRLAAAGEILSCLR 74

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 +V+ G + RRP+  DL      + RI   I + +  G+  +L A + +L   G 
Sbjct: 75  AEQCRDLVLIGPV-RRPSFSDLRPDATGA-RIMARIGRALFSGDDGLLAAIVRVLAEEGF 132

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           ++ GAHE +   + + G LG   P+   + DI       +A+  LD+GQ  V   G V+A
Sbjct: 133 TIHGAHEFLSGSVGRRGVLGRVQPDAQAQADIGRGRAVVDAIGRLDIGQGCVVQDGLVLA 192

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGTD ML R  +CR  GR      GVLVKM K  QD RADLP+IG  TV+   +AG
Sbjct: 193 VEAMEGTDRMLLRAGECRQPGR----PGGVLVKMLKPGQDRRADLPTIGPDTVRRAAQAG 248

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           L GIA +AG +L+ + +     A+EAG+F+ GI+
Sbjct: 249 LRGIAFQAGATLLTDPDGCVAAANEAGLFLAGIE 282


>gi|284049019|ref|YP_003399358.1| protein of unknown function DUF1009 [Acidaminococcus fermentans DSM
           20731]
 gi|283953240|gb|ADB48043.1| protein of unknown function DUF1009 [Acidaminococcus fermentans DSM
           20731]
          Length = 273

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 68/277 (24%), Positives = 126/277 (45%), Gaps = 12/277 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRS 59
           K L +++G G LP  V + A+      V  +++     D +        + +G    +  
Sbjct: 3   KTLGVLSGVGHLPVDVVRGAKKAGYRTVAIALVPGTHEDLEKEADVFHAINIGKVGKIFK 62

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L Q  +  + + G + +          +    +  K++  L    +  I+ A +  LE 
Sbjct: 63  TLKQEGVDEVTMIGKVTKEILYSG--GILVPDWQAIKILMSLPDRHDDTIMNALVAKLED 120

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+     + +L+ Q G L    P  +   D+      A+ +  LD+GQ+ V     
Sbjct: 121 MGIHVMDQTLFLTDLMPQEGVLSKRQPTPEEWEDMKYGFAMAKKIGGLDIGQTVVVKNKA 180

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++A+E IEGTD+ + R            GK  ++ K  K  QD R D+P +G KTV+++I
Sbjct: 181 IMAVEAIEGTDACILRGGKL--------GKGAIVAKTAKPAQDNRFDMPGVGVKTVESMI 232

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           ++G AGI +EAG++L++E+E     A+   + V  + 
Sbjct: 233 ESGCAGIVMEAGRTLLVEREKALDLANRHKLVVVAMK 269


>gi|260889716|ref|ZP_05900979.1| putative septum site-determining protein MinC [Leptotrichia
           hofstadii F0254]
 gi|260860322|gb|EEX74822.1| putative septum site-determining protein MinC [Leptotrichia
           hofstadii F0254]
          Length = 267

 Score =  279 bits (715), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 77/277 (27%), Positives = 143/277 (51%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE-LPLGDFCVLRS 59
           M+++ +IAG+G LP        LK  EP    +        ++ +      +     + S
Sbjct: 1   MEKVGLIAGNGKLPELFLNQCILKGIEPFSVYLFESVEESVKEHKNSVKYSVAQVGKIIS 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  I  +++ G +++     +L F +  +    K++    +  +  ILKA ID +ES
Sbjct: 61  HFKKNGITHLIMLGKVEKNLIFSNLKFDLTAT----KILLSTKNKKDKNILKAIIDYIES 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
             + V+  + ++ E +    +    +P+++ ++ I   +++A  L+++D GQ+ V     
Sbjct: 117 ENIEVLPQNYLMDEYIAGNETYTKVLPSKNEEKTIEIGIEAARMLTDIDAGQTVVVKDES 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ALEG+EGTD  + R       G  LAGK+ ++VKM +  QD R D+P+IG +T++ V+
Sbjct: 177 VIALEGVEGTDKAILR-------GGELAGKNCIVVKMARRNQDYRIDIPTIGLETIKKVV 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +    GI +EA K L ++KE V K A++  IF+ GI 
Sbjct: 230 EINGRGIVIEADKMLFIDKEEVIKFANKNKIFIKGIK 266


>gi|117925149|ref|YP_865766.1| hypothetical protein Mmc1_1852 [Magnetococcus sp. MC-1]
 gi|117608905|gb|ABK44360.1| protein of unknown function DUF1009 [Magnetococcus sp. MC-1]
          Length = 278

 Score =  279 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 93/276 (33%), Positives = 141/276 (51%), Gaps = 15/276 (5%)

Query: 5   LIIAGSGMLPYYVAKAAR-LKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSIL 61
            IIAGSG +P  +    R   +   V+A+ + E              + LG F  +    
Sbjct: 2   GIIAGSGAIPALLIDKLRHCHHTAVVVAAHVGEADPKLTQLADAIEWVRLGQFKRILRFF 61

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
           H   +  IV+ G I +        ++I+      K+  +L    +  +L+A  + LE  G
Sbjct: 62  HAQGVTHIVMVGGITKTQI-----WNIRPDTLALKIATRLKHMQDDHLLRAIAETLEERG 116

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V GAHE+ PELL  VG LG   PN ++ +D+    + A+A+  LD+GQ  V     V+
Sbjct: 117 FVVCGAHELAPELLAPVGILGHHRPNSELWQDMRLGWQMAKAIGALDIGQGVVVRERVVL 176

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGTD+MLQR       G       G LVK+ K QQD+R D+P+IG  T+QN+ +A
Sbjct: 177 AVEAVEGTDAMLQRAGKLSRGG-------GCLVKVSKPQQDLRLDMPTIGVATIQNLHRA 229

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GL G+A+E+G +L+++   +   AD  GI V G D 
Sbjct: 230 GLRGLAVESGSTLIVDYIGMLAEADRLGIVVVGCDA 265


>gi|319783660|ref|YP_004143136.1| hypothetical protein Mesci_3971 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169548|gb|ADV13086.1| protein of unknown function DUF1009 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 305

 Score =  278 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 110/278 (39%), Positives = 158/278 (56%), Gaps = 3/278 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECS--FDWQDFECRELPLGDFCVLRS 59
            R+ IIAG G LP  VA  +  +   P +  +  E     +   ++   L L     L  
Sbjct: 22  SRVGIIAGGGSLPVEVAAGSAEQGYPPFVILMEGEVDRIAELSRYDHESLALEGIGSLVP 81

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           +L ++ I  +V+AG I RRP +  L  S+   L +  ++   ++ G+  +LK     LE+
Sbjct: 82  LLRRHRITHLVLAGEIKRRPRLLALRPSL-SLLAVIPLVVMALARGDDGLLKVLARGLEA 140

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ VVGAHE+VP L+   G L    P +   RDI A + +A+A+  LD+GQ+A++IGGR
Sbjct: 141 RGIKVVGAHEVVPSLVAAEGVLTNAAPQKSDWRDIEAGLDAAKAIGALDIGQAAIAIGGR 200

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
            +ALEGIEGT  +L+R    R +GRI     GVLVK  K  Q++RADLPSIG +TV+   
Sbjct: 201 TIALEGIEGTAGLLERAKLLRGHGRIAGKTRGVLVKCAKPGQELRADLPSIGLQTVEAAH 260

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            A LAGIA+EAG+SLVLE       A+  G+FV G+  
Sbjct: 261 AAELAGIAVEAGRSLVLEGPETIARANALGLFVIGLPA 298


>gi|237755581|ref|ZP_04584197.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237692244|gb|EEP61236.1| conserved hypothetical protein [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 267

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 83/275 (30%), Positives = 139/275 (50%), Gaps = 11/275 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRSIL 61
           ++ +IAGSG LP   AK+A   N++  I ++ +    + + + +       +   +   L
Sbjct: 2   KIGLIAGSGELPKAFAKSAYQNNEDLTIIAIKSSADKELERYGKTHWFSFTEAQKIIDFL 61

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            + N+  +V+ G I+       L    K   R    + +L      +IL + I  LES G
Sbjct: 62  KKENVQNLVMLGKIEHSSI---LFHFHKLDHRAKTFLSKLKDKRAKSILHSIIQELESEG 118

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
              +     + ELL+  G L   V + +V +D+   +K A+ +++LD+GQ+ V   G V+
Sbjct: 119 FKFIDPTPYLKELLIPEGFLINPVDDAEVLKDVEFGIKIAKEIADLDIGQTVVVKNGVVI 178

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG+EGTD  + R       G    G++ V+ K  +S QDMR D+P IG+KT++ + KA
Sbjct: 179 AVEGVEGTDKCILR-------GGEFGGENTVVCKTARSNQDMRYDVPVIGSKTLEIMKKA 231

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
               +A+EA K+ +LEKE     A E GI V  + 
Sbjct: 232 KAKVLAIEANKTFLLEKEKFINRAKEYGITVMSVK 266


>gi|209885096|ref|YP_002288953.1| phosphatidate cytidyltransferase [Oligotropha carboxidovorans OM5]
 gi|209873292|gb|ACI93088.1| phosphatidate cytidyltransferase [Oligotropha carboxidovorans OM5]
          Length = 284

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 100/278 (35%), Positives = 154/278 (55%), Gaps = 4/278 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSI 60
           K + +IAG G LP+ +A + R +   PV+  +   C      ++      +G F  + S 
Sbjct: 9   KPVGLIAGGGTLPFALADSLRARGRVPVLIGLKGYCDPQRIANYRHHWYSVGQFGSIMSA 68

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L       I   G +  RP ++DL F    ++R+   I + + GG+  +L A+  + E  
Sbjct: 69  LRDEGCSDITFIGTLV-RPALRDLRFDW-TAVRLIPRILRGLRGGDDHLLSATARVFEQG 126

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V+G  E+ P+LL+ VG L +  P+     D +      +A+S  DVGQ+AV I G V
Sbjct: 127 GFRVLGVRELAPDLLMPVGCLTSTQPDAASLADAVTGRALLQAISPFDVGQAAVVIDGHV 186

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V++E I GTD++L RI + R +GR+ A    GVLVK  K  QD+R DLP++G  TV+ +I
Sbjct: 187 VSIEDIAGTDALLARIKELRASGRLRAKPGRGVLVKAPKQGQDLRLDLPALGPVTVKGLI 246

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            AGLAG+A+ AG S+V E + +   AD AG+F+ G+D 
Sbjct: 247 DAGLAGMAVAAGHSVVAEPQAMVAAADAAGLFIVGLDS 284


>gi|92117253|ref|YP_576982.1| hypothetical protein Nham_1706 [Nitrobacter hamburgensis X14]
 gi|91800147|gb|ABE62522.1| protein of unknown function DUF1009 [Nitrobacter hamburgensis X14]
          Length = 285

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 93/276 (33%), Positives = 147/276 (53%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ VA +   +  +PV  ++   C  +    F+   + +G    +  +L 
Sbjct: 12  IGLIAGGGVLPFAVADSLVARGIKPVFFALKGVCDPEKVSQFQHHWIAVGQIGKVARLLR 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             N   +   G +  RP + ++      ++R+   +     GG+  +L     +LE  G 
Sbjct: 72  AENCRDLAFIGTLI-RPALSEIRLDW-GTVRVMGHVLAAFRGGDDHLLSGVGRILERDGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +VG  +I P+LL+  G L    P++    DI   +    ALS  D+GQ+ V I G VV 
Sbjct: 130 RMVGIKDIAPDLLMPAGCLTRKTPDQSATADIAKGLDVLRALSPFDIGQAVVVIDGHVVG 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +EGIEGTD++L RI   R  GRI A    GVLVK  K+ QD+R DLP++G +T++N   A
Sbjct: 190 VEGIEGTDALLARIAQLRAEGRIRAKTARGVLVKAPKNGQDLRYDLPTLGPRTIENAAAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAG+A+ AG +LV E + +   AD + +FV G+  
Sbjct: 250 GLAGMAVVAGNTLVAEPQALVGAADASSLFVVGLPA 285


>gi|283782060|ref|YP_003372815.1| hypothetical protein Psta_4307 [Pirellula staleyi DSM 6068]
 gi|283440513|gb|ADB18955.1| protein of unknown function DUF1009 [Pirellula staleyi DSM 6068]
          Length = 300

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 71/287 (24%), Positives = 128/287 (44%), Gaps = 15/287 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELP--LGDFCVLRSIL 61
           + ++AG G  P  VA+A +          +        +      LP  +         L
Sbjct: 16  IGLMAGWGTFPVVVARALKAAGHTVSCVGLAGHADPILEKICDHYLPCPVARLGQHIRFL 75

Query: 62  HQYNIGRIVVAGAIDRRPN------VQDLCFSIKDSLRISKM-IWQLVSGGNAAILKASI 114
            ++++ R  +AG + +            L    +     + +  +   +  +  ++   +
Sbjct: 76  KRHDVRRATLAGKLFKDRLLLQKMGWLSLLPDFRTIRAFAPIYFFGRRNRNDDTLMNVVV 135

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           D     G+ +  A +  PELLV+ G L    P+     DI    + A+ +  +D+GQS  
Sbjct: 136 DEFARDGIELAPATDFSPELLVKHGLLTRRKPSAAELADIRYGWQVAKEMGRIDIGQSVA 195

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
             G  VVA+E IEGTDS ++R       G         +VK+ K QQDMR D+P+IG  T
Sbjct: 196 VKGRVVVAVEAIEGTDSCIRRAGQLCPQG------GFTVVKVAKPQQDMRFDVPTIGKLT 249

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           ++ +I AG   +A+EAGK+++L++  V   A++ G+ +  +    A+
Sbjct: 250 IETMIAAGAKVLAIEAGKTILLDEPEVAALANKHGLSIISLHDSDAL 296


>gi|306841874|ref|ZP_07474554.1| phosphatidate cytidyltransferase [Brucella sp. BO2]
 gi|306288004|gb|EFM59406.1| phosphatidate cytidyltransferase [Brucella sp. BO2]
          Length = 267

 Score =  278 bits (711), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 108/262 (41%), Positives = 159/262 (60%), Gaps = 3/262 (1%)

Query: 18  AKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDR 77
           A+  +     P +  +  E      D+E +E+ + +F  L   +    + R+V+AG +  
Sbjct: 2   AETLQNAGQAPFLVPLRGEADPVLYDYEHQEISVVEFAKLVRSMKAAGVSRVVLAGGVRN 61

Query: 78  RPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELL-V 136
           RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G  VVGAHE+VP+LL  
Sbjct: 62  RPHVRDLKFDW-PTLRAVPHVLGALGKGDDALLRAFIGLLESFGFKVVGAHEVVPDLLSP 120

Query: 137 QVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRI 196
               L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVVALEG EGTD M++R+
Sbjct: 121 PPACLTRITPDARERRNIALAMDAALRLGDLDVGQGAIAAGGRVVALEGAEGTDLMIERV 180

Query: 197 VDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVL 256
            + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N  +AGLAGIA+EAG++ +L
Sbjct: 181 RELRMAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENAERAGLAGIAIEAGRTFIL 239

Query: 257 EKELVKKHADEAGIFVCGIDRE 278
                   A++ G+F+  I R+
Sbjct: 240 GFGETLAAANKKGLFIETISRD 261


>gi|90423948|ref|YP_532318.1| hypothetical protein RPC_2448 [Rhodopseudomonas palustris BisB18]
 gi|90105962|gb|ABD87999.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           BisB18]
          Length = 284

 Score =  277 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 84/276 (30%), Positives = 142/276 (51%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + ++AG G+LP+ VA +   +   P+I ++   C       +    + +G F  L+ +L 
Sbjct: 11  IGLVAGGGVLPFAVADSLLARGITPIIFALNGFCDAAALHRYRHHWISIGRFGRLQKLLR 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             +   +V  GA+  RP++ ++      ++++ + +     GG+  +L     + E  G 
Sbjct: 71  AEHCRELVFIGAVV-RPSLSEVRLDW-GAVKVIRAVMAAYRGGDDHLLSGIGQIFEKDGF 128

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G  ++ P+LL+  G L    P+     DI        ALS  D+GQ  V I G VVA
Sbjct: 129 RLLGIRDVAPDLLMPAGCLTRATPDGSTVADIAKGRAVLAALSPFDIGQGCVVIDGHVVA 188

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E I GTD++L  +   R    I A  + GVLVK  K  Q++R DLP++G +T+  V  A
Sbjct: 189 VEDIGGTDALLASVARLRAQRLIRAKPRRGVLVKAPKVGQNLRFDLPALGPRTIAGVAAA 248

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            LAGIA+ AG ++V E + +   AD AG+F+ G+  
Sbjct: 249 ELAGIAVVAGHTVVAEPQPMIDAADRAGLFITGMPA 284


>gi|188996318|ref|YP_001930569.1| protein of unknown function DUF1009 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931385|gb|ACD66015.1| protein of unknown function DUF1009 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 267

 Score =  277 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 83/275 (30%), Positives = 138/275 (50%), Gaps = 11/275 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRSIL 61
           ++ +IAGSG LP   AK+A   N++  I ++ +    + + + +       +   +   L
Sbjct: 2   KIGLIAGSGELPKAFAKSAYQNNEDLTIIAIKSSADKELERYGKTHWFSFTEAQKIIDFL 61

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            + NI  +V+ G I+       L    K   R    + +L      +IL + I  LES G
Sbjct: 62  KKENIQNLVMLGKIEHSSI---LFHFHKLDHRAKTFLSKLKDKRAKSILHSIIQELESEG 118

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
              +     + ELL+  G L   V + +V  D+   +K A+ +++LD+GQ+ V   G V+
Sbjct: 119 FKFIDPTPYLKELLIPEGFLINPVDDTEVLNDVEFGIKIAKEIADLDIGQTVVVKDGVVI 178

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG+EGTD  + R       G  L G++ V+ K  +S QDMR D+P IG KT++++ KA
Sbjct: 179 AVEGVEGTDKCILR-------GGELGGENTVVCKTARSNQDMRYDVPVIGLKTLESMKKA 231

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
               +A+EA K+ +LE+E       E GI V  + 
Sbjct: 232 KAKVLAVEANKTFLLEREKFINRVKEYGITVMSVK 266


>gi|257463719|ref|ZP_05628108.1| hypothetical protein FuD12_07695 [Fusobacterium sp. D12]
 gi|317061263|ref|ZP_07925748.1| conserved hypothetical protein [Fusobacterium sp. D12]
 gi|313686939|gb|EFS23774.1| conserved hypothetical protein [Fusobacterium sp. D12]
          Length = 267

 Score =  277 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 71/275 (25%), Positives = 140/275 (50%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC-RELPLGDFCVLRS 59
           M+++ II G+G  P Y  K A+ +  +     + +    + ++ +  +   +G    +  
Sbjct: 1   MEKIGIIVGNGKFPLYFMKEAKKRGYDLYPVGLFDSIEKEIKEMKHFQSFHIGHLGEIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
               Y + ++++ G +++    Q+L           +++  L    +  +L A I  L+ 
Sbjct: 61  YFSFYGVKKLILLGKVEKSILFQNLDLDYYGQ----EILKMLPDRKDETLLFAIISFLKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   +V+       +P ++  R I   M++A+ L+ LD+GQ+ +     
Sbjct: 117 NGIRVLSQNYLLSSYMVEEKCYTEEMPKKEDDRSIQLGMEAAKMLTSLDIGQTVIVKEEA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEG+EGTD  + R  +        AGK+ +++KM + +QDMR D+P++G +T++  I
Sbjct: 177 VVALEGMEGTDRAILRAGEL-------AGKNCIIIKMARPKQDMRVDIPTVGVETIRRAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + G  GI +EA K   LE+E     A++ GIF+ G
Sbjct: 230 EIGAKGIVMEANKMFFLEREEAISLANKHGIFLIG 264


>gi|167646754|ref|YP_001684417.1| hypothetical protein Caul_2792 [Caulobacter sp. K31]
 gi|167349184|gb|ABZ71919.1| protein of unknown function DUF1009 [Caulobacter sp. K31]
          Length = 283

 Score =  276 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 89/277 (32%), Positives = 142/277 (51%), Gaps = 3/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           ++L +IAG G LP  +A+          +  + +        +   E+ LG+F  +   L
Sbjct: 5   RKLGLIAGGGSLPVELAQHCEAAGRPFSVMRLRSFAEPVLARYPGVEVGLGEFGKVFKAL 64

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
                  +  AG ++ RP+   +   ++    +  +I      G+ A+L+  +   E  G
Sbjct: 65  RAEGCEAVCFAGVVE-RPDFAAIKPDLRGLTVMPGLINAA-RKGDDALLRRLLSEFEKEG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            ++ GAHE+  E+ +  GSLG   P    + D+  A+  A A+  LDVGQ AV   G V+
Sbjct: 123 FAIEGAHEVRGEMTLPRGSLGRHAPTDAHRTDMDRALTVARAIGALDVGQGAVVCDGLVL 182

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           A+E  EGTD+ML+R+ D     R  A    GVL K  K  Q+ + DLP+IG  TVQ   +
Sbjct: 183 AVEAQEGTDAMLRRVADLPEAIRGRAEAPRGVLAKAPKPIQETKVDLPTIGVATVQRAAR 242

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AGLAG+  EAG+ L++++E V   AD+ G+FV G++ 
Sbjct: 243 AGLAGVVGEAGRLLIVDREQVIACADDLGLFVYGVEP 279


>gi|328543723|ref|YP_004303832.1| phosphatidate cytidyltransferase [polymorphum gilvum SL003B-26A1]
 gi|326413467|gb|ADZ70530.1| Phosphatidate cytidyltransferase [Polymorphum gilvum SL003B-26A1]
          Length = 282

 Score =  276 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 100/276 (36%), Positives = 161/276 (58%), Gaps = 2/276 (0%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + + IIAG G LP  +    R + +  ++ ++ +E + +       EL  G    L   L
Sbjct: 3   QPIGIIAGGGALPVQIVADLRARGEPVLVVAIRDEAAPELAATADAELGWGQIGQLFKTL 62

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +    R+++ GA+ RRP+   +   +    R+  ++  L+ GG+ ++L   I L E+ G
Sbjct: 63  KRGGCDRVLLIGAVSRRPDFASVVGDLGTMRRLPTILKALI-GGDDSLLTRVIGLFEADG 121

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + VVG  ++ P LL   G +    P     RD+  A K+   L ELD+GQ+AV++GGRV+
Sbjct: 122 LRVVGVPDVAPSLLAPAGRICGREPADGALRDLRLAHKAVARLGELDIGQAAVALGGRVI 181

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           ALEG EGTD+ML+R    R +GR+ A G++GVLVK  K  QD+R DLP+IG +T+   + 
Sbjct: 182 ALEGAEGTDAMLERCAGLRASGRVRAKGRAGVLVKAAKPGQDLRVDLPTIGPRTIDLAVA 241

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           A LAGIA+EAG+SL+ +++     A+ AG+F+ G++
Sbjct: 242 AQLAGIAIEAGRSLIAQQDETVARAEAAGLFLYGLN 277


>gi|332703884|ref|ZP_08423972.1| protein of unknown function DUF1009 [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332554033|gb|EGJ51077.1| protein of unknown function DUF1009 [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 280

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 89/279 (31%), Positives = 137/279 (49%), Gaps = 14/279 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLRSI 60
            L +IAG G  P+ +A  AR      V     +           E +EL LG    L   
Sbjct: 10  TLGLIAGGGRFPFLIADGARKSGLRVVAVGFRSNTDPGLPACVDEYQELRLGQLGKLIDF 69

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
                + R+++ G I++          I    R ++++ +L   G+ A+L+   D L S 
Sbjct: 70  FKSRGVDRVLMGGTINKAR-----AMDIIPDFRGARLLLKLGGKGDDALLRVISDELASE 124

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ V  AHE++PELL+  G L    P+ ++  DI      A+ L  LD+GQ+ V     V
Sbjct: 125 GMPVRRAHELIPELLMPEGFLAGRRPSTEIMADIRFGWSVAKELGRLDIGQTVVVRRQVV 184

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
            A+E +EGTD+ ++R       G  LAG+  V+VK+ K  QD R DLPS+G  T++ +  
Sbjct: 185 AAVEALEGTDNAIRR-------GCSLAGQGAVVVKVFKPGQDERLDLPSVGLTTIETMRD 237

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
            G A +A+EAG+SL  ++E     A+ AGI V G+    
Sbjct: 238 VGAACLAVEAGRSLFFDREQALSAANRAGIAVVGVSDSL 276


>gi|257452058|ref|ZP_05617357.1| hypothetical protein F3_03260 [Fusobacterium sp. 3_1_5R]
 gi|257466143|ref|ZP_05630454.1| hypothetical protein FgonA2_01715 [Fusobacterium gonidiaformans
           ATCC 25563]
 gi|315917301|ref|ZP_07913541.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
 gi|317058606|ref|ZP_07923091.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313684282|gb|EFS21117.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313691176|gb|EFS28011.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 267

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 73/275 (26%), Positives = 138/275 (50%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC-RELPLGDFCVLRS 59
           M+++ II G+G  P Y  K A+ +  +     + +    + ++ E  R   +G    +  
Sbjct: 1   MEKIGIIVGNGKFPLYFMKEAKSQGYDLYPVGLFDSIEEEIKNMEHYRSFHIGHIGEIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 I ++++ G +++    Q+L           +++  L    +  +L A I  L+ 
Sbjct: 61  HFSFCGIKKLILLGKVEKSLLFQNLDLDYYGQ----EIMKMLPDKKDETLLFAVISFLKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   +V+        P ++  + I   +++A+ L++LD+GQ+ +     
Sbjct: 117 NGIKVLSQNYLLSSFMVEEICYTEKKPEKEDHKTIQLGVEAAKMLTKLDIGQTVIVKEEA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEG+EGTD  + R  +        AGK  ++VKM + +QDMR D+P++G +TV+  I
Sbjct: 177 VVALEGMEGTDKTILRAGEL-------AGKGCIIVKMARPKQDMRVDIPTVGVETVKKAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + G  GI +EA K   LE+E     A++ GIF+ G
Sbjct: 230 EIGAKGIVMEAKKMFFLEREEAISLANQYGIFLIG 264


>gi|258541757|ref|YP_003187190.1| hypothetical protein APA01_06610 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632835|dbj|BAH98810.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256635892|dbj|BAI01861.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256638947|dbj|BAI04909.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642001|dbj|BAI07956.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645056|dbj|BAI11004.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648111|dbj|BAI14052.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651164|dbj|BAI17098.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654155|dbj|BAI20082.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 285

 Score =  276 bits (707), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 94/275 (34%), Positives = 143/275 (52%), Gaps = 8/275 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + I+AG G LP  VA+AA        I         +    +    + LG    + S+L 
Sbjct: 7   VGILAGGGPLPGRVAEAAAAAGRPVFILGFEGFAEPEVIGPWPHEFVRLGAAGRMLSLLK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           Q+N   +V+ G I RRP++++L    + + RI   + + +  G+  +L A + +L   G 
Sbjct: 67  QHNCSDLVLIGPI-RRPSLRNLRPDAEGA-RIMARLGRALFAGDDGLLGALVRILGEEGF 124

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            + GAHE + + + Q G LG   P+   + DI   +   +AL  LD+GQ  V   G V+ 
Sbjct: 125 HIRGAHEFLTQAVAQPGVLGRVQPDAQAQADIQRGITVVQALGRLDIGQGCVVQNGVVLT 184

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGTD ML R  +CR       G+ GVLVKM K  Q+ RAD+P+IG  TVQN   AG
Sbjct: 185 VEAMEGTDRMLARAGECRQ-----PGEGGVLVKMLKPGQEKRADMPTIGPVTVQNAHAAG 239

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           L GIA EA  +L+ +++   + AD  G+F+   D 
Sbjct: 240 LRGIAFEAAHTLLTDRQRCIEEADRLGLFLLAFDP 274


>gi|258406346|ref|YP_003199088.1| hypothetical protein Dret_2226 [Desulfohalobium retbaense DSM 5692]
 gi|257798573|gb|ACV69510.1| protein of unknown function DUF1009 [Desulfohalobium retbaense DSM
           5692]
          Length = 278

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 76/273 (27%), Positives = 129/273 (47%), Gaps = 14/273 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSIL 61
           L ++AG G  P  VA  A+ +             +          + L LG    L +  
Sbjct: 9   LGLVAGQGQFPALVAAGAKAQGWGVAAVGFAENTTSGLAAETDWFQWLKLGQLGKLVAFF 68

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
             + + ++V AGAI++   +      I+   R ++++W L S  +  +L A    L   G
Sbjct: 69  RTHGVRQVVFAGAINKPRAL-----DIRPDFRAARLLWNLRSKSDNTLLTAVAGELRREG 123

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + VV A   VPEL    G L     +R  ++D+      A+A+  +D+GQ  V     VV
Sbjct: 124 MEVVSALRFVPELQTPAGQLTKRGLSRREQQDLEYGWPIAKAIGRMDIGQCVVVREQMVV 183

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG+EGT++ML+R  D         G+ G+ +K+ K  Q+   D PS+G  TV+ +++A
Sbjct: 184 AVEGLEGTNAMLKRAGDL-------GGRGGMAIKIFKPGQEEAIDQPSVGLSTVETMLEA 236

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           GL  + +EA  SL  +++     A+  G+ + G
Sbjct: 237 GLTSLVVEAHTSLFFDRDASVALANRHGLCLYG 269


>gi|157826197|ref|YP_001493917.1| hypothetical protein A1C_05870 [Rickettsia akari str. Hartford]
 gi|157800155|gb|ABV75409.1| hypothetical protein A1C_05870 [Rickettsia akari str. Hartford]
          Length = 270

 Score =  275 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 81/274 (29%), Positives = 130/274 (47%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L IIAG G LPY +A     +  +  IA++ +E   D  +DFE + L +G       
Sbjct: 2   LPNLGIIAGRGSLPYLIAGNYTKQGGKCYIAAIKDEADIDPIKDFEYKILKIGMVGEAIR 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 +  I+  G ++ RPN ++L       L + K++ Q    G+  +LK   D  ES
Sbjct: 62  YFKDNEVQNIIFIGGVN-RPNFKNLSVDKIGGLLLFKIVGQ-KIRGDDNLLKIVADFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ ++ I          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNAIYKNQQGNSNIITDTNSTSADKNDIEVGVKLLNHLSSFDIAQSVIVENGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R    R          GVLVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIARCAALRKKEHE-----GVLVKIPKLGQDNRLDMPTIGPDTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A+E  IF+ 
Sbjct: 235 KYNYKGVAIQKNNVIIVEEELTIKLANEHKIFIT 268


>gi|251771048|gb|EES51632.1| conserved protein of unknown function [Leptospirillum
           ferrodiazotrophum]
          Length = 277

 Score =  275 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 79/277 (28%), Positives = 129/277 (46%), Gaps = 14/277 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRS 59
             + +IAG+G  P    +AA+      V+ +   E     +   F  R + LG    +  
Sbjct: 13  DPVGMIAGNGSFPLIFLEAAQKAGIRVVVVAHEGETDPAIETMGFPVRWIRLGQVGAIFD 72

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
             H+  I R    G + +          ++   +   ++ +L    +   L+A  D  E 
Sbjct: 73  TFHKNGISRAAFVGGVRKPRLF-----DLRPDWKGMMILGRLSRYHDDEALRALADEFEK 127

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+++V +  ++P+L   VG L    P    + DI   +  A  L   D+GQ  V     
Sbjct: 128 EGITIVPSTLLLPDLAAPVGPLTRRKPTASEEADIRVGIDVARILGPADIGQCLVVREKV 187

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E IEGTD  ++R            G+ GV+VKM K  QD+R DLPS+G +T++ ++
Sbjct: 188 VVAVEAIEGTDETIRRAGR-------FGGEGGVVVKMAKPGQDLRFDLPSVGPETIRVMM 240

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +A    +A+EAGK+L+  +E     AD A I V GI+
Sbjct: 241 EAKARVLAVEAGKTLLFSREETLGLADSADIAVVGIE 277


>gi|83311584|ref|YP_421848.1| hypothetical protein amb2485 [Magnetospirillum magneticum AMB-1]
 gi|82946425|dbj|BAE51289.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 273

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 93/278 (33%), Positives = 140/278 (50%), Gaps = 10/278 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRS 59
            +L IIAG G LP  VA A R +     I ++                 + LG+      
Sbjct: 3   PKLGIIAGGGDLPGLVAAACRAQGRPFHILALSGHADPQVIGDQAPQDWIRLGEAGTGFE 62

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L Q  +  +V+ G + RRP + +L    + +   +++   L + G+  +L+A    LES
Sbjct: 63  RLRQAGVAEVVMIGPV-RRPTIMELAPDFRTARFFARV--GLKALGDDGLLRAVASELES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  VVG  +++ + L   G  GT VP+   + D+   ++ A  L  LDVGQ+ V   G 
Sbjct: 120 EGFKVVGVDDVLSDCLATPGPYGTVVPDEQAQADMDRGIQVARGLGALDVGQAVVVQQGI 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E IEGTD++L+R       G       GVLVK+ K  QD R DLP+IG  T++   
Sbjct: 180 VLGVEAIEGTDNLLRRCGPLAREGL-----GGVLVKLKKPGQDRRIDLPTIGLTTLREAA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            AGL GIA+EAG +LV++ + +   AD  G+FV GI  
Sbjct: 235 AAGLRGIAIEAGGALVVDAKALGAEADRLGLFVTGITP 272


>gi|85716984|ref|ZP_01047947.1| hypothetical protein NB311A_06388 [Nitrobacter sp. Nb-311A]
 gi|85696186|gb|EAQ34081.1| hypothetical protein NB311A_06388 [Nitrobacter sp. Nb-311A]
          Length = 285

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 92/276 (33%), Positives = 145/276 (52%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ VA +   +  +PV  ++   C  +    F    + +G    +  +L 
Sbjct: 12  IGLIAGGGVLPFAVADSLTARGLKPVFFALKGVCDPERVSHFPHHWIAVGQIGKVVRLLR 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             N   +V  G +  RP + ++      ++R+   +     GG+  +L     +LE  G 
Sbjct: 72  AENCRDLVFIGTLV-RPALSEIRLDW-GTIRVMGQVLAAFRGGDDHLLSGIGRILERDGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G  +I P+LL+  G L    P+R    DI   +    ALS  DVGQ+ V I G V+ 
Sbjct: 130 RMMGIKDIAPDLLMPAGCLTRKTPDRSAAADIAKGLDVLRALSPFDVGQAVVVIDGHVIG 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +EGIEGTD++L R+   R  GRI      GVLVK  K  QD+R DLP++G +T++N   A
Sbjct: 190 VEGIEGTDALLARVAQLRAEGRIRTKAARGVLVKAPKHGQDLRYDLPTLGPQTIENAAAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAG+A+ AG +LV E + +   AD + +FV G+  
Sbjct: 250 GLAGLAVVAGNTLVAEPQALVGKADASNLFVVGLSA 285


>gi|144898245|emb|CAM75109.1| conserved hypothetical protein, secreted [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 270

 Score =  275 bits (703), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 138/274 (50%), Gaps = 9/274 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSI 60
            +L IIAG G  P     A R +     + ++          D     + LG+       
Sbjct: 3   SKLGIIAGGGAFPGLAIAACRSQGRPFHVLALSGHADPAVIGDAPVDWIRLGEAGTGFKK 62

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           LH+  +  +V+ G + RRP +++L    + +   +K+   L + G+  +L+A    +E  
Sbjct: 63  LHEAGVIDLVMIGPV-RRPTLKELAPDWRTTKFFAKV--GLKALGDDGLLRAVTREIEDE 119

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVG  +++ + L   G  G+  P+     DI    + A+ +  LDVGQ+ +   G +
Sbjct: 120 GFRVVGIDDVLADCLAPDGLFGSLAPDDQALADIDRGWEVAKGIGALDVGQAVIVQQGII 179

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E IEGTD +++R  + R +G        VLVK+ K  QD R DLP+IG  T++    
Sbjct: 180 LAVEAIEGTDRLIRRSAELRRDG-----PGAVLVKVRKPGQDRRLDLPTIGLGTLREAAA 234

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AGL GI +EAG +LVL++  +   AD AG+F+ G
Sbjct: 235 AGLRGICVEAGGTLVLDRAELGAEADRAGLFILG 268


>gi|86749933|ref|YP_486429.1| hypothetical protein RPB_2816 [Rhodopseudomonas palustris HaA2]
 gi|86572961|gb|ABD07518.1| Protein of unknown function DUF1009 [Rhodopseudomonas palustris
           HaA2]
          Length = 285

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 91/276 (32%), Positives = 146/276 (52%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ VA A + +   P++  +   C   +   F    + +G F  L+ +L 
Sbjct: 12  VGVIAGGGVLPFAVADALQTRTITPLLIGLRGFCDPNEIARFRHHWISIGQFGRLKRLLR 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             +   +V  G++  RP +  +      + R+   +     GG+  +L +   + E  G 
Sbjct: 72  TEHCRDVVFIGSLI-RPALTSVRLDW-GAFRVLPRVMAAYRGGDDHLLTSIGRIFEGEGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            + G  ++ PELL+  G L    P+   + DI        ALS  D+GQ+ + I G VVA
Sbjct: 130 RLRGVKDVAPELLMPPGELTKAAPDTRHRADIAKGQAVLAALSPFDIGQAVIVIEGHVVA 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E I GTD++L  +   R  GRI A    GVLVK  K+ QD+R DLP++G +T++ V  A
Sbjct: 190 VEDIGGTDALLANLARLRGQGRIAAKPGRGVLVKAPKTGQDLRFDLPTLGPRTIEGVAAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAG+A+ AG +LV E + +   AD+AG+FV G+  
Sbjct: 250 GLAGVAVAAGNTLVAEPQAMIAAADKAGLFVTGVPA 285


>gi|94971580|ref|YP_593628.1| hypothetical protein Acid345_4554 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94553630|gb|ABF43554.1| protein of unknown function DUF1009 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 301

 Score =  274 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 77/288 (26%), Positives = 137/288 (47%), Gaps = 12/288 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF---ECRELPLGDFCVLR 58
           KRL +IAG+G  P  +  AAR    E V+A++  E   + +         + LG+   L 
Sbjct: 8   KRLGLIAGNGKFPILILDAARAHGAEVVVAAIKEETFPEIEQHGAAAVHWMSLGELSKLI 67

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
               +  +   ++AG +  +     +    K    ++K++  L +    +++ A   +L 
Sbjct: 68  ETFQKEGVSEAIMAGQVKHKQIFSSIRPDWK----LAKLLMSLGTRNTDSLIGAVAKVLS 123

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G++++ +  ++  LL + G L T  P      +I      A  LS  D+GQ+ V    
Sbjct: 124 DEGITLLDSTSLLEPLLAKEGVLTTRQPTDQELTNITYGRAVAHHLSRFDIGQTVVIAEA 183

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRI-----LAGKSGVLVKMCKSQQDMRADLPSIGAK 233
             VA+E +EGTD+ + R  +   +  +       G+   +VK+ K  QDMR D+P IG +
Sbjct: 184 ACVAVEAMEGTDATILRAGELLTSPSLGEKPSTLGRELTVVKVAKPNQDMRFDVPVIGLR 243

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           +V+ + KA    +AL+AGK L+L+ + V   AD AGI +     + A+
Sbjct: 244 SVETMRKANATCLALDAGKCLLLDGQAVIDAADAAGICIVAEKPDPAL 291


>gi|257126039|ref|YP_003164153.1| hypothetical protein Lebu_1273 [Leptotrichia buccalis C-1013-b]
 gi|257049978|gb|ACV39162.1| protein of unknown function DUF1009 [Leptotrichia buccalis
           C-1013-b]
          Length = 269

 Score =  274 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 74/276 (26%), Positives = 139/276 (50%), Gaps = 12/276 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE-LPLGDFCVLRSI 60
           +++ +IAG+G LP        L+  E     + +      ++ +      +     + S 
Sbjct: 4   EKVGLIAGNGKLPELFLNQCLLQGVEIFSVYLFDSVEESVKNHKNSVKYSVAQVGKIISY 63

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
             +  +  +V+ G +++     +L F +  +    K++    +  +  ILKA ID +ES 
Sbjct: 64  FKKSGVSHLVMLGKVEKNLIFSNLKFDLTAT----KILLSTKNKKDKNILKAIIDFIESE 119

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
            + V+  + ++ E +          P++D ++ I   +++A  L+++D GQ+ V     V
Sbjct: 120 NIQVLPQNYLMDEYIAGNEIYTKVSPSKDEEKTIKIGIEAARMLTDIDAGQTVVVKDESV 179

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +ALEG+EGTD  + R       G  LAGK+ ++VKM +  QD R D+P+IG +T++ + +
Sbjct: 180 IALEGVEGTDKAILR-------GGELAGKNCIVVKMARRNQDYRIDMPTIGLETIKKIAE 232

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
               GI +EA K L ++KE V K A++  IF+ GI 
Sbjct: 233 INGRGIVIEADKMLFIDKEEVIKFANKNKIFIKGIK 268


>gi|260881397|ref|ZP_05893422.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
 gi|260848839|gb|EEX68846.1| conserved hypothetical protein [Mitsuokella multacida DSM 20544]
          Length = 298

 Score =  274 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 71/277 (25%), Positives = 140/277 (50%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M+R+ ++AG+G LP   A+AA+L   E    ++L E   + ++   +C+ + +     + 
Sbjct: 32  MERIGLLAGAGKLPVECARAAKLLGYEVYAVALLPETDAELKECTADCQFISIAHLDDVL 91

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L ++ + ++ + G + +          ++   R+ K+I +L    +  I+   +  L 
Sbjct: 92  NYLKEHQVSKVTMIGKVTKELLFS---GKVQPDARMMKLIMELPDRKDDTIMMMFVRELA 148

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+       ++  L+   G +    P  + ++D+    + A+ +  LDVGQ+AV    
Sbjct: 149 KAGIQAFDQTALIRRLMPHRGVITKREPTAEERKDMEFGFRMAKEIGRLDVGQTAVVKNM 208

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ + R       G  LA    V+ K+ K QQD R D+P++G  T+Q++
Sbjct: 209 AVMALEAIEGTDACIHR-------GGELARGGAVVAKVAKPQQDDRFDVPTVGLATIQSM 261

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +  G   +A+EA K+L++E+E +   A+   I +  +
Sbjct: 262 VDVGATALAIEADKTLLVEREEMLALAEANNITIAAL 298


>gi|253583580|ref|ZP_04860778.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
 gi|251834152|gb|EES62715.1| conserved hypothetical protein [Fusobacterium varium ATCC 27725]
          Length = 267

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 71/278 (25%), Positives = 134/278 (48%), Gaps = 12/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M +L II G+G LP Y  + A  +        +      + + +   +   +G+   +  
Sbjct: 1   MNKLGIIVGNGKLPLYFLQEAEKQKINVFPIGLFETIEPEIKSYSNFKAFNIGEVGAIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                ++  I++ G +++    +++           +++ +L    +  +L A I     
Sbjct: 61  HFLLNDVREIIMLGKVEKEIIFKEMKLDKYGE----ELLKRLPDKKDETLLFAIIAFFRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   + Q        P+ +  + I   M++A+ALSE+D GQ+ V     
Sbjct: 117 NGIKVLPQNYLLKNFMFQEKCYTGIKPSEEDMKTIKIGMEAAKALSEVDAGQTVVCKDSS 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ALEGIEGTD  ++R  +        AG   ++VKM + QQDMR D+P++G +T++  +
Sbjct: 177 VIALEGIEGTDKTIKRAGEL-------AGTGTIIVKMSRPQQDMRVDIPAVGIETIKRAV 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           + G  GI  EAGK L L ++   + A+E  +F+ GI  
Sbjct: 230 EIGAKGIVGEAGKMLFLNRDEAVEFAEEHSLFIIGIKA 267


>gi|330993386|ref|ZP_08317321.1| hypothetical protein SXCC_03284 [Gluconacetobacter sp. SXCC-1]
 gi|329759416|gb|EGG75925.1| hypothetical protein SXCC_03284 [Gluconacetobacter sp. SXCC-1]
          Length = 290

 Score =  273 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 95/273 (34%), Positives = 141/273 (51%), Gaps = 7/273 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + I+AG G LP  VA+A         I         +    +  R + L     + S LH
Sbjct: 16  VGILAGGGPLPGQVARAVERAGGRVFIIGFQGFAEPEVIGHWPHRMVRLAAAGEILSALH 75

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           ++    +V+ G + RRP++  L      + RI   I + +  G+  +L A + +L   G 
Sbjct: 76  EHGCRDLVLIGPV-RRPSLVSLRPDAAGA-RILTRIGKALFAGDDGLLGAIVRVLGEEGF 133

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           ++ GAHE +P  + + G+LGT  P+   + DI         L  LD+GQ  V  GG V+A
Sbjct: 134 TIRGAHEYLPGSVARPGALGTLTPDATARADIALGRHVVRQLGRLDIGQGCVVQGGLVLA 193

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGTD ML+R+   R   R      GVLVKM K  Q+ RADLP+IG +T+   + AG
Sbjct: 194 VEALEGTDRMLERVATLRQPDR----PGGVLVKMAKPGQERRADLPTIGPRTIAGAMAAG 249

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           L GIA+EAG +L+ +       ADEAG+F+ GI
Sbjct: 250 LRGIAMEAGATLITDPAACTAMADEAGLFLTGI 282


>gi|269120957|ref|YP_003309134.1| hypothetical protein Sterm_2350 [Sebaldella termitidis ATCC 33386]
 gi|268614835|gb|ACZ09203.1| protein of unknown function DUF1009 [Sebaldella termitidis ATCC
           33386]
          Length = 268

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 71/279 (25%), Positives = 129/279 (46%), Gaps = 12/279 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE-LPLGDFCVLRS 59
           M ++ II G+G LP    + A  K  E     + +      +++       +     +  
Sbjct: 1   MNKIAIITGAGKLPTLFLEEAVDKGYEVYPIYLFDGVDNKIKEYANSVKYSIAQVGKIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    I ++++ G +++     +L F +  +    K++    +  +  IL A I+ LE 
Sbjct: 61  YLKSKEISKLIMLGKVEKNLIFSNLKFDLVAT----KILMSTRNKKDKNILMAIINHLEK 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   + +           D  + I   +++A  L+ +D GQ+ V     
Sbjct: 117 EGIEVLPQNFLMDRYMAKEVEYTRRKALPDDMKTIEIGIEAARMLTAIDAGQTVVVKNES 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEG+EGTD  ++R  +        AGK  ++VKM +  QD R D+P+IG  TV+   
Sbjct: 177 VVALEGVEGTDKTIERAGEY-------AGKDCIVVKMARPNQDYRIDIPTIGIDTVKKAA 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +    GI +E+   L +++E V   AD+  IF+ GI  E
Sbjct: 230 EIKAKGIVIESEHMLFIDQEEVINFADKNKIFIKGIKYE 268


>gi|110633745|ref|YP_673953.1| hypothetical protein Meso_1392 [Mesorhizobium sp. BNC1]
 gi|110284729|gb|ABG62788.1| protein of unknown function DUF1009 [Chelativorans sp. BNC1]
          Length = 297

 Score =  272 bits (697), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 103/267 (38%), Positives = 159/267 (59%), Gaps = 3/267 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRS 59
            R+ ++AGSG+LP  VA         P++ ++  E   + +   ++   +   +   L S
Sbjct: 17  DRIAVVAGSGLLPREVANGLVRAGHRPLVVAITGEADLEDEPARYDFMRVTHEELGKLLS 76

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           IL +  +  +V+AG + RRP +  L +S K  L     +    + G+  +L+A I  +ES
Sbjct: 77  ILKRRGVTHLVLAGGVARRPPLSTLRYSPK-ILLYLPRLAAGYARGDDGLLRAIIGFIES 135

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG+  VGAHE+VPELL   G L    P    ++DI AA+ +A A+  LD+GQ+AV++GGR
Sbjct: 136 YGIKPVGAHEVVPELLAPAGLLTGTAPTSSDEKDISAAIAAARAIGRLDIGQAAVAVGGR 195

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ALE IEGTD +L+R    R +GR+     GVLVK  K  Q++R DLP+IG +TV++  
Sbjct: 196 VIALEDIEGTDGLLRRAKALRTHGRLAGKTRGVLVKCAKPAQELRVDLPTIGPQTVKDAH 255

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHAD 266
           +AGLAGIA+E+ +SL+LE     + A+
Sbjct: 256 EAGLAGIAVESERSLILECGETVRLAN 282


>gi|146341057|ref|YP_001206105.1| hypothetical protein BRADO4128 [Bradyrhizobium sp. ORS278]
 gi|146193863|emb|CAL77880.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 285

 Score =  272 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 94/276 (34%), Positives = 141/276 (51%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILH 62
           + +IA  G+LP+ VA A   +   PV+ ++   C       F    + LG       +L 
Sbjct: 12  VGLIAAGGVLPFAVADAIVARGQTPVLFALKGICDPKPLARFRHHWIGLGQLGNALKLLK 71

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              +  ++  G +  RP V ++ F    +LR    IW    GG+  +L     + E +G 
Sbjct: 72  AEGVRDLMFIGNLV-RPAVSEIRFDW-GTLRELPYIWSAFRGGDDHLLSGVGRIFERHGF 129

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G  ++ P LLV  G L    P   V  DI   M    A++  DVGQ+ V I G VVA
Sbjct: 130 HMIGVKDVAPNLLVPEGPLTRSRPTDLVTGDIAKGMSVLRAMAPFDVGQAVVVIDGHVVA 189

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           LE IEGTD +L R+   R + RI +    GVLVK  K+ QD+R DLP+IG +TVQ +  A
Sbjct: 190 LEDIEGTDGLLARVARLRADRRIRSAVGRGVLVKAPKAGQDLRYDLPTIGPRTVQGLSAA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAG+A+ +  +L+ + +     AD AG+F+ G+  
Sbjct: 250 GLAGVAVASAYTLLADPQETVTAADRAGVFITGVTA 285


>gi|310822807|ref|YP_003955165.1| hypothetical protein STAUR_5573 [Stigmatella aurantiaca DW4/3-1]
 gi|309395879|gb|ADO73338.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 267

 Score =  271 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 82/278 (29%), Positives = 148/278 (53%), Gaps = 13/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M+R+ +IAG+G LP+  A+ AR +  + V  +   E     +        + LG    + 
Sbjct: 1   MERIGLIAGNGQLPFLFAREARARGMDVVAVAHRGETDPALEREVAAFTWVRLGQVGRIV 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           S   + ++ +  +AG I R   + +     +  +   +++ +L S  + A+L+A  D  E
Sbjct: 61  STFQKASVTQAAMAGGIGRVRALTE----ARPDMGAVRILSRLRSLRDDALLRAVADHFE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           ++GV++V   + + +++   G L     + + ++D+   ++ A  L + DVGQ+ V  GG
Sbjct: 117 AHGVTIVAPTDYLAQVMCPAGHLAGPRLHPEQEKDVALGVEVASLLGKADVGQTVVVKGG 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE +EGTD  ++R       G  L GK  V+VK CK  QD+R DLP+ G +T++ +
Sbjct: 177 NVLALEAVEGTDETIRR-------GAKLGGKGAVVVKRCKPGQDLRFDLPAAGPRTLEVM 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            + G   +ALEAG++++LE + +   A+  GI V GI 
Sbjct: 230 AEVGAKVLALEAGRTVLLETQALFARAEADGITVVGIP 267


>gi|225849912|ref|YP_002730146.1| hypothetical protein PERMA_0354 [Persephonella marina EX-H1]
 gi|225646124|gb|ACO04310.1| conserved hypothetical protein [Persephonella marina EX-H1]
          Length = 268

 Score =  271 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 85/276 (30%), Positives = 144/276 (52%), Gaps = 11/276 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRS 59
           M+++ +IAGSG LP   A++A  K     + ++      + + + +   L  G+   L  
Sbjct: 1   MRKVGLIAGSGELPLEFARSASEKGIHVTVLAIKKTTDRNIEKYGKTHWLNFGEAQKLID 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
           +L +  I  +V+ G I+    +  L    K   R  +   +L       IL+A +D L  
Sbjct: 61  LLKKEGIKDLVMLGKIEHYSLIFSLH---KLDKRAREFFSKLKDKRAKTILEAVMDELSK 117

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G S +     +  LL++ G +   + ++ +  D L  +K A+ +++LD+GQ+ V   G 
Sbjct: 118 EGFSFIDPTPYLENLLIEEGLIAGRIEDKRLMNDALFGLKIAKEIAQLDIGQTVVVKDGI 177

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  + R       G  L G+  V+ K+ +  QDMR D+P IG KT++++ 
Sbjct: 178 VIAVEGIEGTDKCIIR-------GGELGGEGTVVCKVARKNQDMRYDVPVIGTKTLKSMK 230

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           KA    +A+EAGK+ +LE+E  KK A++ GI V G 
Sbjct: 231 KAKARLLAVEAGKTFLLEREKFKKLAEKFGIAVIGF 266


>gi|51246794|ref|YP_066678.1| hypothetical protein DP2942 [Desulfotalea psychrophila LSv54]
 gi|50877831|emb|CAG37671.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 286

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 82/271 (30%), Positives = 134/271 (49%), Gaps = 13/271 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRS 59
           +++ IIAG G  P    +AAR       + +  +E   +       C  + LG    + S
Sbjct: 11  EKIGIIAGGGQFPLLFIEAARRAGRSVAVVAHRSETDPEVAKAADSCCWVKLGQLGKILS 70

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  +G  V  G I +          I   +R   +  ++    + AIL+A    LE 
Sbjct: 71  FFKKEGVGETVFVGTITKTRIF----HDIMPDVRALTLWNKIDIKQDDAILRAVAGALEK 126

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            GV V+ +   + ELL   G+L     ++D ++D+    K+A A+  +D+GQ+ V     
Sbjct: 127 DGVKVLESTIYLQELLFPRGTLTAKSLSKDQRKDVEFGWKNARAIGAMDIGQTVVVRDCS 186

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E IEGTD+ ++R       G  LA +  V+VK+ K  QD R DLP+ G +T+Q++ 
Sbjct: 187 VVAVEAIEGTDAAIKR-------GGELAREKAVVVKVRKPGQDFRFDLPATGIQTIQSLA 239

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGI 270
               A +A+EAG+SL+ ++E +   AD AGI
Sbjct: 240 SVKGAVLAVEAGQSLLFDREAMVAAADAAGI 270


>gi|294793360|ref|ZP_06758505.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
 gi|294455791|gb|EFG24156.1| conserved hypothetical protein [Veillonella sp. 6_1_27]
          Length = 261

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 67/264 (25%), Positives = 126/264 (47%), Gaps = 12/264 (4%)

Query: 18  AKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI 75
            +AA +   E V+  V+ +       +     ++ +     +   L +  +  + + G +
Sbjct: 1   MRAAHVLGHEVVVIGVVPDIDPALKAEADAFYDIGVAKLGKIFKTLKKEEVQELTMLGKV 60

Query: 76  DRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELL 135
            +    + L F     L+   ++ +L +  +  I+ A +D +E  G  V+     +   +
Sbjct: 61  TKEILFKGLTF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIEREGFKVLDQTAYLKPFM 117

Query: 136 VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQR 195
            +VG L    P  +   DI    + A+ +  LD+GQ+ V     V+A+E IEGTD  + R
Sbjct: 118 PKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHKAVMAIEAIEGTDKCILR 177

Query: 196 IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLV 255
                  G  L     V+VK  K  QD+R D+P++G KT+ ++I +G   +A+EA K++ 
Sbjct: 178 -------GGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSMIDSGCKVLAVEAEKTIF 230

Query: 256 LEKELVKKHADEAGIFVCGIDREF 279
           ++++ V   AD  GI +C +D+EF
Sbjct: 231 VQQQDVLNMADRHGIVICAVDQEF 254


>gi|296115053|ref|ZP_06833695.1| hypothetical protein GXY_04714 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978390|gb|EFG85126.1| hypothetical protein GXY_04714 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 297

 Score =  270 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 91/276 (32%), Positives = 135/276 (48%), Gaps = 7/276 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + I+AG G LP  VA++         I         D    +  R + L     + S L 
Sbjct: 21  VGILAGGGPLPAQVARSVVAAGGSVFIIGFEGFADPDVIAPWPHRFIRLAAAGEILSTLR 80

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
            +    +V+ G + RRP+   L      + RI   I + +  G+  +L A + +L   G 
Sbjct: 81  LHGCRELVLIGPV-RRPSFATLRPDAVGA-RILARIGRALFSGDDGLLGAIVRVLGEEGF 138

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            + GAHE +   + + G +G   P+     DI    +  +A+  LD+GQ  V   G V+A
Sbjct: 139 VIRGAHEYLHASIGRRGVMGMVRPDHVAMSDIGRGRRVVQAMGALDIGQGCVVQDGLVLA 198

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E IEGTD ML+R+     +GR      GVL+KM K  Q+ RADLP+IG +TV+    AG
Sbjct: 199 VEAIEGTDEMLERVGRYHQDGR----PGGVLIKMVKPGQERRADLPTIGPETVRRAAGAG 254

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           L GIA EAG +L+ +       AD AG+F+ GI  E
Sbjct: 255 LRGIAFEAGATLLTDPLECVTRADAAGLFLVGITAE 290


>gi|220932590|ref|YP_002509498.1| hypothetical protein Hore_17540 [Halothermothrix orenii H 168]
 gi|219993900|gb|ACL70503.1| uncharacterized protein conserved in bacteria [Halothermothrix
           orenii H 168]
          Length = 272

 Score =  270 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 70/279 (25%), Positives = 138/279 (49%), Gaps = 13/279 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M ++ +IAG G LP   A +AR +  +     ++ E     ++     + + +G F  L 
Sbjct: 1   MSKIGLIAGRGKLPAIWAASARDRGHDVYAFPIIEEADEGLKNIAKVIKPVNVGAFDNLI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           +IL + +I ++V+ G +++               R+ +M+  L    + +IL   ++ L+
Sbjct: 61  NILIENDISKVVMIGKVNKTRLFGKTRLDA----RMQQMLANLRELNDDSILLGIVNELK 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V+     + +L    G + +  P+  +  D+  A K A  +  LD+GQ+ +    
Sbjct: 117 KEGIEVLKQSTFIEDLFPTPGPVTSKTPDDSLLEDMKYAFKLARGIGGLDIGQTVLVKNR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD  ++R  +         G    + K+ K  QD R D+P++G  T++N+
Sbjct: 177 AVLAVEAIEGTDQAIKRAGEL-------GGAGATMAKVSKPNQDFRFDIPTVGLTTLRNL 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           IK    G+ +EAGK+ ++++E   + A+ +GI V  ++ 
Sbjct: 230 IKIKARGLVIEAGKTFIVDREEFIETAEASGITVMALES 268


>gi|304320060|ref|YP_003853703.1| hypothetical protein PB2503_02422 [Parvularcula bermudensis
           HTCC2503]
 gi|303298963|gb|ADM08562.1| hypothetical protein PB2503_02422 [Parvularcula bermudensis
           HTCC2503]
          Length = 290

 Score =  270 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 92/277 (33%), Positives = 139/277 (50%), Gaps = 6/277 (2%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           K+L IIAG G LP  +A++ + ++    I ++        + F+     +G+      +L
Sbjct: 6   KKLGIIAGGGSLPLKIAESCQQQDAPFHILALSGYADDILKSFKPSWCGIGEVGKAIRVL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
             +    +V+AG +  RPN   L    + +  + K++    + G+ A+L   +    S G
Sbjct: 66  KDHGCDAVVLAGNVT-RPNFATLRPDWRGAKLLPKIL-SAATQGDGAMLDVLVATFASEG 123

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             VVGA ++   L V  G+LG   P+     D+  A     AL   DVGQ AV   G V+
Sbjct: 124 FYVVGADDVATALTVPAGALGMLGPDTCDLSDMRKAAAVVAALGPFDVGQGAVVRQGFVI 183

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAG----KSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           A+E  EGTD ML R        +   G    + GVL+K  K +Q+ R DLP+IG +TV+ 
Sbjct: 184 AIEAAEGTDLMLGRCAPLIARLQGEEGNRSERRGVLLKCPKPEQERRVDLPTIGVRTVEL 243

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
             +AGLAGIA+EA   LVL+   V + AD  G+FV G
Sbjct: 244 AAEAGLAGIAVEASGGLVLDSGAVARCADARGLFVYG 280


>gi|75676038|ref|YP_318459.1| hypothetical protein Nwi_1847 [Nitrobacter winogradskyi Nb-255]
 gi|74420908|gb|ABA05107.1| Protein of unknown function DUF1009 [Nitrobacter winogradskyi
           Nb-255]
          Length = 288

 Score =  270 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 94/276 (34%), Positives = 143/276 (51%), Gaps = 4/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSILH 62
           + +IAG G+LP+ VA +   +  +PV  ++   C  +    F    + +G    +  +L 
Sbjct: 15  IGLIAGGGVLPFAVADSLTARGLKPVFFALKGVCDPERVSRFPHHWIAVGQIGKVMRLLR 74

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
             N   +V  G +  RP + ++      ++R    +     GG+  +L     +LE  G 
Sbjct: 75  AENCRDLVFIGTLV-RPALSEIRLDW-GTIRAMGQVLAAFRGGDDHLLSGVGRILERDGF 132

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +VG  +I P+LL+  G L    P++    DI   +    ALS  DVGQ+ V I   VV 
Sbjct: 133 RMVGIKDIAPDLLMPAGCLTRKAPDQSAAADIAKGLDVLRALSPFDVGQAVVVIDAHVVG 192

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +EGIEGTD++L RI   R  GRI A    GVLVK  K  QD+R DLP++G +T+ N   A
Sbjct: 193 VEGIEGTDALLARIAQLRAAGRIRAKAPRGVLVKAPKHGQDLRYDLPTLGPRTIANAAAA 252

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAG+A+ AG +LV E + +   AD + +FV G+  
Sbjct: 253 GLAGLAVVAGNTLVAEPQALVGEADASNLFVVGLPE 288


>gi|304391657|ref|ZP_07373599.1| phosphatidate cytidyltransferase [Ahrensia sp. R2A130]
 gi|303295886|gb|EFL90244.1| phosphatidate cytidyltransferase [Ahrensia sp. R2A130]
          Length = 281

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 97/274 (35%), Positives = 154/274 (56%), Gaps = 2/274 (0%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
            R+ I+AGSG LP  +A        +P I  +       +++ + ++L       +  + 
Sbjct: 8   DRVAILAGSGALPIQLATQLTTVGLQPYILRLPGVTEKPFENLDGQDLRWEQVGQIFPLC 67

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +++IG IV+AG +D RP+++        +LR    I   +  G+ A+L + I ++E  G
Sbjct: 68  KEHSIGHIVLAGGVDGRPDLKFSQMDW-PTLRTLPTILGQLLKGDDAVLGSVITVIEKRG 126

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V+GA +I P L+V  G      P    +  I    +  +A+S  D+GQ+ V IGGR V
Sbjct: 127 LKVLGAADIAPSLVVDEGRFSG-APGTKDRNRIDLGFQLLDAMSPFDMGQACVVIGGRPV 185

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD+ML+RI+D R+NGR+   + GV+VK  K+ QD R D+P+IG +TV   + A
Sbjct: 186 AVEGAEGTDAMLRRIMDLRDNGRLPLQRGGVMVKAPKAGQDHRVDMPTIGPETVSRAVAA 245

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           GL GIA+ AG +L+LE+E     A    +F+ GI
Sbjct: 246 GLDGIAVRAGATLILERETCIDIAQRGDLFLTGI 279


>gi|260424776|ref|ZP_05733251.2| conserved hypothetical protein [Dialister invisus DSM 15470]
 gi|260403153|gb|EEW96700.1| conserved hypothetical protein [Dialister invisus DSM 15470]
          Length = 287

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 71/282 (25%), Positives = 139/282 (49%), Gaps = 14/282 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M+ + ++AG G+LP    +AA ++  + V  +V+       ++      E+ +     + 
Sbjct: 14  METVGLLAGIGILPVEFIEAAHIQGYKVVCIAVIPGVEKKLKEKADAYYEISVFKLNKVI 73

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGG--NAAILKASIDL 116
             L    +  + + G + +    +D    +   LR  K++ +L      +  I    ++ 
Sbjct: 74  KTLLSEGVQEVTMLGKVTKEWLYKD---HVIPDLRALKVLNRLRKKNFKDDTITLELVEE 130

Query: 117 LESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
           L   G+SV+   + +  L+          P  +   D+    K+A+A+  +D+GQ+ V  
Sbjct: 131 LGKDGISVLDQTKYLKPLMPGPQIFTKRRPTENEMLDVAFGFKAAKAIGGMDLGQTVVIK 190

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQ 236
              V+A+E IEGTD+ ++R       G +LA    V+VK  K  QD+R D+P++G +T+ 
Sbjct: 191 DQAVMAVEAIEGTDACIRR-------GGMLARGGAVVVKTAKPDQDLRFDVPAVGLETLH 243

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           ++++ G   +A+EA ++L +EK  V K AD AGI +  +++E
Sbjct: 244 SMMETGCKVLAIEAYRTLFVEKTSVLKEADCAGIAILSVEQE 285


>gi|1262295|gb|AAA96792.1| ORF9; hypothetical protein [Brucella abortus]
          Length = 323

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 103/263 (39%), Positives = 153/263 (58%), Gaps = 3/263 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           R+ ++ G+G+LP  VA+  +     P +  +  E      ++E +E+ + +F  L   + 
Sbjct: 20  RVAVVGGNGLLPIKVAETLQNAGQAPFLVPLRGEADPVLYNYEHQEISVVEFAKLVRSMK 79

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG +  RP+V+DL F    +LR    +   +  G+ A+L+A I LLES+G 
Sbjct: 80  TAGVSRVVLAGGVRNRPHVRDLKFDW-PTLRAVPYVLGALGKGDDALLRAFIGLLESFGF 138

Query: 123 SVVGAHEIVPELL-VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            VVGAHE+VP+LL      L    P+   +R+I  AM +A  L +LDVGQ A++ GGRVV
Sbjct: 139 KVVGAHEVVPDLLSPPPACLTRITPDARERRNIALAMDAALKLGDLDVGQGAIAAGGRVV 198

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALEG EGTD M++R+ + R  GRI + + GVLVKM K +QD RADLP+IG  TV+N    
Sbjct: 199 ALEGAEGTDLMIERVRELRTAGRI-SRRGGVLVKMAKPRQDERADLPAIGLSTVENPSVR 257

Query: 242 GLAGIALEAGKSLVLEKELVKKH 264
           G  G+    G+ L L  E   + 
Sbjct: 258 GWRGLPSRPGEPLFLVSEKRLQR 280


>gi|197121556|ref|YP_002133507.1| hypothetical protein AnaeK_1145 [Anaeromyxobacter sp. K]
 gi|220916320|ref|YP_002491624.1| protein of unknown function DUF1009 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196171405|gb|ACG72378.1| protein of unknown function DUF1009 [Anaeromyxobacter sp. K]
 gi|219954174|gb|ACL64558.1| protein of unknown function DUF1009 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 268

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 69/277 (24%), Positives = 123/277 (44%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M  + +IAG G  P   A++AR      V  +  +E   +          + LG    L 
Sbjct: 1   MATIGLIAGGGRFPLLFAESARRAGHRVVAVAHKSETDPELAKQVDAITWVKLGQIGHLL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L        V+ G+I ++    D            +++ ++    +  +L+A    LE
Sbjct: 61  EGLRAGGATECVMLGSITKKRFFADAMLDATG----VRVLARVAVRSDDNLLRAMARFLE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV++      + + L   G LG   P  +   D    ++ A  +  LD+GQ+ V    
Sbjct: 117 EEGVAITDPTPFLTDRLAPEGVLGRHQPTPEELEDARYGLELARGIGRLDLGQTVVVKDR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E +EGTD+ ++R  +   +G        V+ K  K  QD R DLP++G  TV ++
Sbjct: 177 VALAVEALEGTDACIRRGGELAKSG------GFVVAKAVKPHQDRRFDLPAVGPDTVVSL 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +A    +A+EAG +LV++   + + AD+A I + G+
Sbjct: 231 REARGRLLAVEAGATLVMDLPRMVELADKAKIVLLGL 267


>gi|317153116|ref|YP_004121164.1| hypothetical protein Daes_1404 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943367|gb|ADU62418.1| protein of unknown function DUF1009 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 277

 Score =  269 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 80/278 (28%), Positives = 138/278 (49%), Gaps = 13/278 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--LPLGDFCVLRSI 60
            + +IAG    P  VA+  +      V+A      + D   +      L LG    L + 
Sbjct: 7   TIGLIAGGRQFPILVARGVKAHGYRLVVAGFTGHTNMDVVPYADVWQELKLGKLGRLIAF 66

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
             +  + R+++AG ID+ P V D+       +R  K++++  + G++AIL +  +  E  
Sbjct: 67  FRENGVDRVIMAGTIDK-PKVMDIRH---LDMRAVKLLFRQKNKGDSAILGSLAEEFERE 122

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ VV AH+ +PELL  +G +    P+   + D+    K A+ L  +D+GQ  V   G +
Sbjct: 123 GMPVVPAHDYLPELLSPLGVMTRREPDEREREDLRYGWKIAKELGRMDIGQCVVLREGII 182

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
            A+E +EGTD+ + R       G  L G   V++K+ K  Q  + DLPS+G  TV+ +I 
Sbjct: 183 SAVEALEGTDAAIAR-------GCGLGGPGCVVIKVFKPGQQEQVDLPSLGLDTVRAMID 235

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
                + +EAG+SL  +++     AD AG+ + G+  +
Sbjct: 236 GKATCLGVEAGRSLFFDRDEALALADRAGMAIVGLATD 273


>gi|257468114|ref|ZP_05632210.1| hypothetical protein FulcA4_02182 [Fusobacterium ulcerans ATCC
           49185]
 gi|317062399|ref|ZP_07926884.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313688075|gb|EFS24910.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 267

 Score =  269 bits (688), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 75/278 (26%), Positives = 133/278 (47%), Gaps = 12/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-FECRELPLGDFCVLRS 59
           M +L II G+G LP Y  + A  +        +      + +     +   +G+   +  
Sbjct: 1   MDKLGIIVGNGKLPLYFLQEAEKQKINVFPIGLFETIEPEIKSCSNFKAFNIGEVGAIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                +I  I++ G +++    +++           +++ +L    +  +L A I     
Sbjct: 61  HFLLNDIREIIMLGKVEKEIIFKEMKLDKYGE----ELLKRLPDKKDETLLFAIIAFFRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   + Q        P+ +  + I   M++A+ALSE+D GQ+ V     
Sbjct: 117 NGIKVLPQNYLLKNFMFQENCYTQLKPSEEDMKTIKIGMEAAKALSEVDAGQTVVCKDSS 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEGIEGTD  ++R  +        AG   ++VKM + QQDMR D+P++G +T++  I
Sbjct: 177 VVALEGIEGTDKTIKRAGEL-------AGTGTIIVKMSRPQQDMRVDIPAVGIETIKRAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           + G  GI  EAGK L L ++   K A+E  +F+ GI  
Sbjct: 230 EIGAKGIVGEAGKMLFLNRDEAVKLAEENSLFIMGIKA 267


>gi|153003992|ref|YP_001378317.1| hypothetical protein Anae109_1125 [Anaeromyxobacter sp. Fw109-5]
 gi|152027565|gb|ABS25333.1| protein of unknown function DUF1009 [Anaeromyxobacter sp. Fw109-5]
          Length = 271

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 72/277 (25%), Positives = 124/277 (44%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLR 58
           M  + +IAG G  P   A++AR      V  +  +E     +        + LG    + 
Sbjct: 3   MATIGLIAGGGRFPILFAESARRAGHRVVAVAHRSETDPALEGAVDALTWVKLGQVGHIL 62

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L      + V+ GAI ++    D            +++ ++    +  +L+A    LE
Sbjct: 63  DALRAGGATQSVMLGAITKKRFFTDAMLDATG----LRVLARVGIRSDDNLLRAMARFLE 118

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV +      + + L   G LG   P  + + D    ++ A  +  LD+GQ+ V    
Sbjct: 119 EEGVPITDPTPYLRDRLAPEGVLGRHQPTDEERADAAYGLELARGIGRLDLGQTVVVKER 178

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E +EGTD+ ++R  +   +G        V+ K  K  QD R DLP++G  TV  +
Sbjct: 179 VALAVEALEGTDACIRRGGELARSG------GFVVAKAVKPNQDRRFDLPAVGPDTVDTL 232

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +AG   +A+EAG +LV++ E +   AD+A I + GI
Sbjct: 233 REAGGRVLAVEAGATLVMDLERMVARADKARIVLMGI 269


>gi|58040254|ref|YP_192218.1| hypothetical protein GOX1823 [Gluconobacter oxydans 621H]
 gi|58002668|gb|AAW61562.1| Hypothetical protein GOX1823 [Gluconobacter oxydans 621H]
          Length = 280

 Score =  268 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 89/276 (32%), Positives = 145/276 (52%), Gaps = 8/276 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILH 62
           + I+AGSG LP  VA AA  K  +  +    +       + +    + L     +   L 
Sbjct: 7   IGILAGSGPLPAQVAAAAIAKGRKVFVIGFRDFADRALLEPYPHEIIRLAAAGDILGALK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           + N   +V+ G + RRP  +DL    + + RI   + + +  G+  +L A + +L   G 
Sbjct: 67  RNNCRELVLIGPV-RRPAWRDLRPDAEGA-RILARLGRAIFSGDDGLLGAVVRVLGEEGF 124

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V GAHE +     + G+LG  +P+   K+DI   ++  + ++ LD+GQ  V   G V+A
Sbjct: 125 HVRGAHEFLEHATGRSGTLGRVLPDAQAKQDIARGVEVLKVMAALDIGQGCVVQNGLVLA 184

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGTD+ML R         + AG  GVLVKM K+ QD+RAD+P+IG +T++N  + G
Sbjct: 185 VEALEGTDAMLGRCGRL-----MQAGSGGVLVKMPKTGQDVRADMPTIGPETLENAARNG 239

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           L G+A + G +L+ +     K AD  G+F+ G+  E
Sbjct: 240 LRGVAFQPGVTLMTDPAGCVKLADRYGLFLYGLTPE 275


>gi|316933933|ref|YP_004108915.1| hypothetical protein Rpdx1_2595 [Rhodopseudomonas palustris DX-1]
 gi|315601647|gb|ADU44182.1| protein of unknown function DUF1009 [Rhodopseudomonas palustris
           DX-1]
          Length = 285

 Score =  268 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 87/274 (31%), Positives = 142/274 (51%), Gaps = 4/274 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRSIL 61
           ++ IIAG G LP+ VA     +   PV+ ++   C  +    +    LP+G    L  +L
Sbjct: 11  KVGIIAGGGALPFAVADTLAARGLTPVLFALKGSCDSERVSAYRHHWLPMGALGRLLRLL 70

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
                  +V  G++  RP + ++      ++++   +     GG+  +L     L E +G
Sbjct: 71  RAEGCRDLVFIGSLV-RPALSEMRLDW-GAIKVLPAVLAAYRGGDDHLLTGVGRLFERHG 128

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             ++G  ++  +LL+  G L    P+  V+ DI        ALS  D+GQ  V I G VV
Sbjct: 129 FRLLGLKDVASDLLIPQGCLTRAAPDASVEADIAKGRAVLAALSPFDIGQGCVVIDGHVV 188

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           A+E   GTD +L+R+   R++ RI A    GVLVK  K+ QD+R DLP++G  T++ ++ 
Sbjct: 189 AVEDTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKAGQDLRFDLPAVGPTTIEGLVA 248

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           A L G+A+ AG ++V E + +   AD AG+FV G
Sbjct: 249 ARLGGVAVVAGHTVVAEPQTMIAAADRAGLFVIG 282


>gi|86157513|ref|YP_464298.1| hypothetical protein Adeh_1086 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774024|gb|ABC80861.1| protein of unknown function DUF1009 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 268

 Score =  268 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 69/277 (24%), Positives = 124/277 (44%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M  + +IAG G  P   A++AR      V  +  +E   +          + LG    L 
Sbjct: 1   MATIGLIAGGGRFPLLFAESARRAGHRVVAVAHKSETDPELAKQVDAITWVKLGQIGHLL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L      + V+ G+I ++    D            +++ ++    +  +L+A    LE
Sbjct: 61  EGLRAGGASQCVMLGSITKKRFFADAMLDATG----VRVLARVAVRSDDNLLRAMARFLE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV++      + + L   G LG   P  +   D    ++ A  +  LD+GQ+ V    
Sbjct: 117 EEGVAITDPTPFLADRLAPEGVLGRHQPTPEELEDARYGLELARGIGRLDLGQTVVVKDR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             +A+E +EGTD+ ++R  +   +G        V+ K  K  QD R DLP++G  TV ++
Sbjct: 177 VALAVEALEGTDACIRRGGELARSG------GFVVAKAVKPHQDRRFDLPAVGPDTVVSL 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +A    +A+EAG +LV++   + + AD+A I + G+
Sbjct: 231 REARGRLLAVEAGATLVMDLPRMVELADKAKIVLLGL 267


>gi|218779639|ref|YP_002430957.1| hypothetical protein Dalk_1792 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761023|gb|ACL03489.1| protein of unknown function DUF1009 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 275

 Score =  268 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 76/277 (27%), Positives = 128/277 (46%), Gaps = 13/277 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRS 59
             + I+AG+G  P   A+AAR    +   A+  NE   D          + +G+   +  
Sbjct: 6   SNIGIVAGNGQFPLLFARAARKAGMQVYAAAHTNETEEDLAQETDGILWVKIGELQKIMD 65

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              Q N+ + V+ G I +      L           + +  + + G+  +L+A    +E 
Sbjct: 66  FFLQNNVTKAVMLGGITKAR----LMSDFAPDALALEALASIDATGDDMVLRAVAQAVEK 121

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           +G+ V+ A  I+P LL   G      P      DI    +  + +  LD+GQ  +   G 
Sbjct: 122 HGIQVIAATSILPHLLAPEGVWTQRQPTEQEAADIKLGHELLQKIGPLDIGQCLILTRGS 181

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E IEGTD+ ++R  +           + V+VKM K  QD R DLP+ GAKT++N+I
Sbjct: 182 VICVEAIEGTDAAIKRAGEL-------EASNAVVVKMPKPNQDHRFDLPAAGAKTIENMI 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
             G   +AL AG ++V ++E + + AD   I +  I+
Sbjct: 235 PNGCTALALAAGAAVVFDREAMVELADSHNIAIVAIN 271


>gi|114327609|ref|YP_744766.1| hypothetical protein GbCGDNIH1_0945 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315783|gb|ABI61843.1| hypothetical protein GbCGDNIH1_0945 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 294

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 91/275 (33%), Positives = 145/275 (52%), Gaps = 8/275 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-FECRELPLGDFCVLRSILH 62
           L IIAGSG LP  VA AA     +  I +V      +    +    + +G    + ++L 
Sbjct: 19  LGIIAGSGDLPGRVAAAAMRAGRDVFIIAVEGHAEPEVVGPYPHAFVRVGAAGRILALLK 78

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           Q     +V+ G + +RP++  L    + + RI   I +    G+  +L A + +L   G 
Sbjct: 79  QAGCRDLVLVGPV-KRPSILQLRPDAEGA-RILTRIGKAAFAGDDGLLAAVVRVLAEEGF 136

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAH+++ +++   G +   VP++  + DI   +   +AL  +DVGQ  V   G  +A
Sbjct: 137 QVIGAHDVLTDIVGPAGVMTRVVPDKTAQLDITRGIAVVQALGAVDVGQGCVVQQGIALA 196

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E IEGTD+ML R            G  GVL+K+ K  QD RADLP++G +TV+   +AG
Sbjct: 197 VEAIEGTDAMLARSATVAR-----PGPGGVLIKLVKPGQDRRADLPTLGPRTVRAATEAG 251

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           L GIA EAG +++  +  + + ADE G+F+ GID 
Sbjct: 252 LRGIAFEAGGTILTAQAEMVRLADEGGLFLIGIDP 286


>gi|237736789|ref|ZP_04567270.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420651|gb|EEO35698.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 267

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 74/277 (26%), Positives = 138/277 (49%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           MK++ II G+G LP Y  + A  +N +     + +      +  +      +G+   +  
Sbjct: 1   MKKVGIIVGNGKLPLYFLEEAEKQNIDVFPLGLFDTIDDRIKAHKNFVSFNIGEVGSIVK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 I  IV+ G +++    +D+           +++ +L    +  +L A I     
Sbjct: 61  YFLLNGIDEIVMLGKVEKDIIFKDMKLDRFGE----ELLKRLPDRKDETLLFAVIGFFRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++ + + +       VP+ + ++ I   +++A+ALSE+D GQ+ V     
Sbjct: 117 NGIKVLPQNHLLKDFMFRDECYTKIVPSDEDRKTIKIGIEAAKALSEVDAGQTVVCKDSS 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEGIEGTD  ++R  +        AG   ++VKM + QQDMR D+P++G +T++  +
Sbjct: 177 VVALEGIEGTDKTIKRAGEL-------AGSGCIVVKMSRPQQDMRVDIPAVGIETIKRAV 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           + G  GI  EAG+ L L ++   + A+E  +F+ GI 
Sbjct: 230 EIGARGIVGEAGRMLFLNRDEAIRLAEENSLFILGIK 266


>gi|299136293|ref|ZP_07029477.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX8]
 gi|298602417|gb|EFI58571.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX8]
          Length = 299

 Score =  266 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 68/269 (25%), Positives = 129/269 (47%), Gaps = 15/269 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--------FECRELPLGD 53
           + L +IAG+G  P+ +  AAR      V+A++  E   +  +             L LG+
Sbjct: 7   QTLGLIAGNGRFPFLLLDAARAHGLRVVVAAIKEETDLEINERAAREPEFVRVHWLSLGE 66

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKAS 113
              L  +  +  + R V+AG +  +     +        R++K++  L +     +L A 
Sbjct: 67  LSKLIEMFQRAGVARAVMAGQVKHKQIFSSIRPDW----RLAKLLLNLRTRNTDMLLGAV 122

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
             +LE  G++++ +   +  +L   G L +  P+   + DI   ++ A  ++  D+GQ+ 
Sbjct: 123 AKVLEDEGITLMSSTAFLEPMLAVEGVLTSRAPDATERGDIDYGLRVARGIAGFDLGQTV 182

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAG---KSGVLVKMCKSQQDMRADLPSI 230
           V   G  VA+E +EGTD+ + R  +        A    +   +VK+ K +QDMR D+P +
Sbjct: 183 VIAAGACVAVEAMEGTDATIARAGELFRTLEDEASTLDRRLTVVKVAKPKQDMRFDVPVV 242

Query: 231 GAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           G  T+Q +  AG   + +EAG++L+ ++E
Sbjct: 243 GLPTIQAMQAAGATCLCIEAGRTLLFDRE 271


>gi|159184741|ref|NP_354392.2| hypothetical protein Atu1385 [Agrobacterium tumefaciens str. C58]
 gi|159140029|gb|AAK87177.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 267

 Score =  266 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 119/256 (46%), Positives = 172/256 (67%)

Query: 25  NDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDL 84
            + P I  + ++  +DW  F+   + +GD   L  +L +  + R+V++GA+ RRP  +++
Sbjct: 2   GENPFIVRLRDDSRYDWSGFDNAVISVGDVAGLGRLLRENQVDRVVLSGAVARRPEWREI 61

Query: 85  CFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTC 144
             +    +++  ++  L+SGG+ A+L+  I ++ + G  V+GAHEI P LL   G LG  
Sbjct: 62  RPTAGILIKLPSIVKTLLSGGDDAVLQMVIKIISTLGAKVIGAHEIAPGLLATTGPLGGQ 121

Query: 145 VPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGR 204
            P  +  +DI  A ++A AL +LDVGQ AVS+GGR+VALEGIEGTD+ML R+   R  GR
Sbjct: 122 KPAEEDLKDIRGAAEAALALGKLDVGQGAVSVGGRIVALEGIEGTDAMLARVAALRAEGR 181

Query: 205 ILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKH 264
           I   + GVLVK+CK QQD+RADLP+IG +TV+N  KAGLAGIA+EAG++LVL++E + K 
Sbjct: 182 ISPRRKGVLVKLCKPQQDIRADLPTIGIETVENAKKAGLAGIAVEAGRALVLDREAMLKA 241

Query: 265 ADEAGIFVCGIDREFA 280
           ADEAGIFVCGID    
Sbjct: 242 ADEAGIFVCGIDTSLG 257


>gi|300023417|ref|YP_003756028.1| hypothetical protein Hden_1906 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525238|gb|ADJ23707.1| protein of unknown function DUF1009 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 425

 Score =  266 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 88/274 (32%), Positives = 134/274 (48%), Gaps = 2/274 (0%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
            R+ IIAGSG LP  VA++   +     +  V          F    +         + L
Sbjct: 6   DRIGIIAGSGSLPREVAESVVARGGHVHVVMVSGAADASLAMFPHTVVNWAQPGRATAAL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               +  +V+ G   +RP+ +     I     +  ++  L +GG+ A+L+  + L E  G
Sbjct: 66  KAAGVRDVVMLGGF-QRPDFRSARPDIAFFQVLPSVLRFLKAGGDDAVLRGLVALFERRG 124

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           +++VG  ++  +L V  G L     +     D         AL   D+GQ+AV   GRV 
Sbjct: 125 LNIVGVRDVARDLTVAEGVLTGPPLSSQNSTDAEKGFALIAALGRYDIGQAAVIANGRVE 184

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EG EGTD ML+R+ + R      + + GVLVK  K  QD+R DLP+IG  T++N+  A
Sbjct: 185 AIEGAEGTDRMLKRVAEARRAAGN-SKQGGVLVKRPKPGQDLRVDLPAIGPNTIENIASA 243

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           GLAG+A+ AG  L  E+E +   A   G+FV GI
Sbjct: 244 GLAGVAVMAGHVLAAERERMIALAGTRGVFVAGI 277



 Score = 47.0 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 54/136 (39%), Gaps = 15/136 (11%)

Query: 138 VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIV 197
            G LG+   +     DI        A  + + G +A+   GRV+A+    GT      ++
Sbjct: 295 PGWLGSVAIDARAMPDIRRGAGILAACGKFETGTAAIIDHGRVIAV----GTSESPIEVI 350

Query: 198 DCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +   + R    + GV+V     + D            ++   K   AG+A + G+++   
Sbjct: 351 EHVASLRKGDRRRGVIVVAPSQKLDDAL---------LRTAAKYKFAGVA-KLGETMNTA 400

Query: 258 KE-LVKKHADEAGIFV 272
            +    + AD  G+F+
Sbjct: 401 IDGATVRLADSLGLFI 416


>gi|313672271|ref|YP_004050382.1| hypothetical protein Calni_0306 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939027|gb|ADR18219.1| protein of unknown function DUF1009 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 270

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 72/277 (25%), Positives = 139/277 (50%), Gaps = 13/277 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSIL 61
           + +IAG G LP       + + D+ V+ S+  E + D+        +  +G    +   L
Sbjct: 3   VGLIAGYGRLPLIAYNKLKERYDKVVVVSLAEEVTVDFSSVAENLHQFSVGQVGKIIKTL 62

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               +  I+ AG +++    ++L           K++W L +  +  I+   ++ L+ +G
Sbjct: 63  KSEGVQDILFAGKVNKTLLYKNLKLDFTA----IKLLWALENRNDDTIMLKIVEELQKHG 118

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V+   +I+ +L +  G +    PN+ +  D+    K A+ L  +DVGQ+ V     V+
Sbjct: 119 IGVLKQSDILRDLFLPEGVISKKKPNKAIMDDVAFGYKVAKVLGSVDVGQTVVVKNKAVM 178

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALE IEGTD+ ++R       G  LA +  V+VK+ K +QD R D+P++G  T++ ++  
Sbjct: 179 ALEAIEGTDATIER-------GCRLAKEGAVVVKVAKPKQDERFDIPTVGIDTLKKILDN 231

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
               +A+EAG ++V++ + VKK  DE  + +   + +
Sbjct: 232 KGVCLAIEAGTTIVVDIDEVKKFCDENKLVMISFNGD 268


>gi|302392921|ref|YP_003828741.1| hypothetical protein Acear_2190 [Acetohalobium arabaticum DSM 5501]
 gi|302204998|gb|ADL13676.1| protein of unknown function DUF1009 [Acetohalobium arabaticum DSM
           5501]
          Length = 266

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 89/278 (32%), Positives = 147/278 (52%), Gaps = 16/278 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC---SFDWQDFECRELPLGDFCVL 57
           M R+ +IAG+G LP Y A+AA+ K  E V  SV  +      D    E  EL +     L
Sbjct: 1   MNRVGLIAGNGRLPLYFAQAAKDKAREVVAVSVTEQALVNKLDSIVDESYELSVAKLDKL 60

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
            + L    I  +V+ G +++     DL F++    R++K++  L    + AIL A ++ L
Sbjct: 61  ITKLQTAGIKEVVMVGKVNK-----DLMFNLDFDERMTKLLMNLEEKNDDAILLALVEEL 115

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
            + G+ V      +  LL Q+G+L    P+ D+ +D+    K A+ + +LD+GQ+ V   
Sbjct: 116 AAAGIKVKKQTTYLESLLPQLGTLTEIEPSPDIIKDMEFGFKMAKGIGDLDIGQTVVVKD 175

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             V+A+E IEGTD  + R             +  V  K+ K QQD R D+P+IG  T++N
Sbjct: 176 RAVIAVEAIEGTDQAILRSGQL--------AEGVVAAKVSKPQQDFRFDIPTIGKDTIKN 227

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +I+ G AG+ +EA K+ +L++  V + AD+AG+ +  +
Sbjct: 228 LIEIGAAGLVIEAAKTFILDRREVCQLADKAGLPIVAM 265


>gi|237740034|ref|ZP_04570515.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229422051|gb|EEO37098.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 267

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 73/275 (26%), Positives = 131/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G LP Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKLPLYFIEEAKNSNISVYPIGLFPSVDEEIKKSDNYAEFNVGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   +I +IV+ G I+++   ++L           K++  +    +  +L A I  L  
Sbjct: 61  YLLLNDITKIVMLGKIEKKLIFENLILDKYGE----KIMEIVPDKKDETLLFAIIGFLRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  +  +  L+ +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 NGIKVLPQNYSMKRLIFEAKCYTERHPDADDEKTISMGIEAARLLSRVDVGQTVVCRDKA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLHTVETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + G  GI  +A K + L ++   + A++  IF+  
Sbjct: 230 QNGFKGIVAQAKKMIFLNQKECIELANKNNIFIIA 264


>gi|108763981|ref|YP_632885.1| hypothetical protein MXAN_4723 [Myxococcus xanthus DK 1622]
 gi|108467861|gb|ABF93046.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 268

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 82/278 (29%), Positives = 140/278 (50%), Gaps = 12/278 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLR 58
           M R+ +IAG+G LP+  A+AAR K  E V  +   E          R   + +G    ++
Sbjct: 1   MDRIGLIAGNGRLPFLFARAARKKGLEVVAVAHRGETDPALAAEVDRLTWVRVGQVDRIQ 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
               +  + + V+AG I R   + +     +  L   ++I +L S  + A+L+A     E
Sbjct: 61  KAFREAGVKQAVMAGGIGRVRALAE----ARPDLGAVRIISRLRSFRDDALLRAVASDFE 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           S GV+++   + + E+L   G L     +   ++D+    + A  L + DVGQ+ V   G
Sbjct: 117 SRGVTIIAPTDFLGEVLCPEGHLAGPRLHPAQEKDVALGREVAMLLGQADVGQTVVVHNG 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE +EGTD  + R       GR+      V+VK CK QQD+R DLP++G  T++ +
Sbjct: 177 HVLALEAVEGTDEAILR------GGRLGGNSGAVVVKRCKPQQDLRFDLPAVGPHTLEVM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            + G   +ALE G++++L+   +   A+  GI + G+ 
Sbjct: 231 QEVGARVLALEVGRTVLLDAPALFAGAESRGITIVGVP 268


>gi|15604565|ref|NP_221083.1| hypothetical protein RP730 [Rickettsia prowazekii str. Madrid E]
 gi|3861260|emb|CAA15159.1| unknown [Rickettsia prowazekii]
 gi|292572372|gb|ADE30287.1| hypothetical protein rpr22_CDS711 [Rickettsia prowazekii Rp22]
          Length = 270

 Score =  265 bits (679), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 76/274 (27%), Positives = 135/274 (49%), Gaps = 8/274 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD-WQDFECRELPLGDFCVLRS 59
           +  L +IAG G LP+ +A     +  +  IA++ +E + +  ++FE +   +G       
Sbjct: 2   LPNLGMIAGRGSLPHLIACNYIKQGGKCYIAAIKDETNIEQIKEFEYKIFKIGMVGEAIR 61

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
               +N+  I+  G I+ RPN ++L       L + K++ Q    G+ ++LK   +  ES
Sbjct: 62  YFQDHNVENIIFIGGIN-RPNFKNLAVDKIGRLLLFKIVEQ-KIRGDDSLLKIVANFFES 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           YG  V+ +++I          +         K DI   +K    LS  D+ QS +   G 
Sbjct: 120 YGFKVISSNQIYQNQQCNSNIITNTTITNSDKNDIELGIKVLNHLSLFDIAQSVIVKNGY 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           ++ +E  EGTD+++ R  D R          G+LVK+ K  QD R D+P+IG  T++N+ 
Sbjct: 180 ILGIEAAEGTDNLIVRCADLRKKSH-----GGILVKIPKLGQDNRLDMPTIGPNTIKNLA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           K    G+A++    +++E+EL  K A++  IF+ 
Sbjct: 235 KYNYQGLAIQKNNVIIVEEELTIKLANKHKIFIT 268


>gi|237741613|ref|ZP_04572094.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|229429261|gb|EEO39473.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
          Length = 267

 Score =  265 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 131/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDDEIKKLDNYAEFNVGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   ++ +IV+ G +++R   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLRDVTKIVMLGKVEKRLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ + ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDFNDEKTISLGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTVETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|34764132|ref|ZP_00145004.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
 gi|27886094|gb|EAA23398.1| hypothetical protein [Fusobacterium nucleatum subsp. vincentii ATCC
           49256]
          Length = 267

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 71/275 (25%), Positives = 131/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDDEIKKLDNYAEFNVGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   ++ +IV+ G +++R   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLRDVTKIVMLGKVEKRLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISLGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTVETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|310778908|ref|YP_003967241.1| protein of unknown function DUF1009 [Ilyobacter polytropus DSM
           2926]
 gi|309748231|gb|ADO82893.1| protein of unknown function DUF1009 [Ilyobacter polytropus DSM
           2926]
          Length = 267

 Score =  265 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 83/277 (29%), Positives = 138/277 (49%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ II G+G LP Y  K A  K  E     + +    + +  E  R + +G    +  
Sbjct: 1   MEKIGIIVGNGKLPLYFLKEAGAKGYEVFPIGLFDTIEEEIKQHENFRMMNVGRIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   NI ++V+ G +++     ++ F         K++ +L    +  +L   I LL+ 
Sbjct: 61  HLLGNNIVKLVMLGKVEKSILFNEIEFDDHG----KKLLKKLPDNKDETLLFGIISLLKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   + +        P ++    I    ++A+ALSELD GQ+ V     
Sbjct: 117 CGIKVLPQNHLLGNFMFENKVYTNSSPEKNDSLTIKMGTEAAKALSELDAGQTVVCKDSS 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVALEGIEGTD  + R  +        AG + +++KM + QQDMR D+P++G  T++  I
Sbjct: 177 VVALEGIEGTDQTILRAGNY-------AGDNCIIIKMARPQQDMRVDIPAVGLDTIKRAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +    GI  EAGK L L++E   K ADE  +F+ GI 
Sbjct: 230 EIKAKGIVGEAGKMLFLDQEEAIKLADENKLFIMGIK 266


>gi|294782875|ref|ZP_06748201.1| conserved hypothetical protein [Fusobacterium sp. 1_1_41FAA]
 gi|294481516|gb|EFG29291.1| conserved hypothetical protein [Fusobacterium sp. 1_1_41FAA]
          Length = 267

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 130/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDEEIKKLDNYAEFNVGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   +I +IV+ G I+++   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLNDITKIVMLGKIEKKLIFENLILDKYGE----KIMEIVPDKKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  + ++   + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 NGIKVLPQNYLMKRFIFEAKCYTEKEPDADDEKTISMGIEAARLLSRVDVGQTVVCRDKA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLHTVETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           + G  GI  +A K + L ++   + A++  IF+  
Sbjct: 230 QNGFKGIVAQAKKMIFLNQKECIELANKNNIFIIA 264


>gi|262067091|ref|ZP_06026703.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
 gi|291379190|gb|EFE86708.1| conserved hypothetical protein [Fusobacterium periodonticum ATCC
           33693]
          Length = 267

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 71/275 (25%), Positives = 131/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G LP Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKLPLYFIEEAKNSNISVYPIGLFPSVDEEIKKSDNYAEFNVGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   +I +IV+ G I+++   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLNDITKIVMLGKIEKKLIFENLILDKYGE----KIMEIVPDKKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+  +  +  L+ +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 NGIKVLPQNYSMKRLIFEAKCYTERHPDADDEKTISMGIEAARLLSRVDVGQTVVCRDKA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  T++  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMARPQQDMRVDVPVIGLDTLETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A + + L ++   + A++  IF+  
Sbjct: 230 KNGFKGIVAQAKRMIFLNQKECIELANKNNIFIIA 264


>gi|225847953|ref|YP_002728116.1| hypothetical protein SULAZ_0119 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644181|gb|ACN99231.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 270

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 79/276 (28%), Positives = 141/276 (51%), Gaps = 11/276 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF-ECRELPLGDFCVLRSI 60
            ++ +IAG G LP   AK+A  KN +  I ++ +  S + + + +       +   +   
Sbjct: 4   DKIGLIAGWGDLPLTFAKSAFEKNQDLTIIAIKSSASKELEKYGKTYWFSFTEAQKIIDT 63

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  +  +V+ G I+ +  +  L    K   R    ++ L      +IL + I+ LE  
Sbjct: 64  LKKEKVKNLVMLGKIEHKSILFHLH---KFDERAKNFLFSLKDKRAKSILHSIINELEKE 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G   +     +  LLV+ G L   + + ++K+DI+  MK A+ +++LD+GQ+ +   G V
Sbjct: 121 GFEFIDPTPFLSSLLVEEGFLVNPIEDENIKKDIVFGMKIAKEVADLDIGQTVIVKDGVV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+EG+EGTD  +         G  L G+  V+ K  +  QDMR D+P +G KT++++ K
Sbjct: 181 IAVEGVEGTDKCI-------LRGGELGGEGTVVCKAARKNQDMRYDVPVVGVKTLESMKK 233

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           A    +A+E+GK+ +L K+   K A E  I V G+ 
Sbjct: 234 AKAKVLAVESGKTYLLNKDEFIKKAKEYKISVLGVK 269


>gi|91202217|emb|CAJ75277.1| conserved hypothetical protein [Candidatus Kuenenia
           stuttgartiensis]
          Length = 277

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 75/272 (27%), Positives = 130/272 (47%), Gaps = 11/272 (4%)

Query: 8   AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQYN 65
           AG+G  P   AK A+  N   +  ++  E S +   +  +   + +     L  I  Q N
Sbjct: 2   AGNGRFPILFAKGAKNNNVPVIAVAIEGETSPEVGQYVEKLYWIGVAQIGKLIKIFKQEN 61

Query: 66  IGRIVVAGAIDRRPNVQDLCF-SIKDSLRISKMIWQLVSGGNA-AILKASIDLLESYGVS 123
           + + V+AG + +      L    +   LR   + ++ V   +   +L A  D L   G+ 
Sbjct: 62  VSKAVMAGGLTKGNMFSSLRNLRLLPDLRTINLWYKNVKRRDDQTLLGAVADELLKDGIE 121

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  +   VP+LL + G L    P      DI  A+  A+ +++  +GQ  V     V+A+
Sbjct: 122 LQSSTLYVPQLLAKKGILTKKNPTDREMEDIYFAVPLAKEIAKHGIGQCIVVKEKVVLAV 181

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E  EGTD  ++R       G  L     V++K+CK   D R D+P++G  T++ + ++  
Sbjct: 182 EAFEGTDEAIRR-------GGKLGRSDVVVIKVCKQNFDPRFDIPTVGLDTIKTLKESSA 234

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + +ALEAG++++L+ E     AD+AGI V GI
Sbjct: 235 SVLALEAGRTIILDIEETLAEADKAGISVIGI 266


>gi|294785776|ref|ZP_06751064.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
 gi|294487490|gb|EFG34852.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
          Length = 267

 Score =  264 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 71/275 (25%), Positives = 131/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISLYPIGLFPSVDEEIKKLDNYAEFNIGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   ++ +IV+ G +++R   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLRDVTKIVMLGKVEKRLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISLGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTVETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|256844939|ref|ZP_05550397.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|256718498|gb|EEU32053.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
          Length = 267

 Score =  264 bits (676), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 72/275 (26%), Positives = 132/275 (48%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDDEIKKLDNYAEFNVGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   ++ +IV+ G +++R   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLRDVTKIVMLGKVEKRLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ IL  +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTILLGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTVETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|260459225|ref|ZP_05807480.1| protein of unknown function DUF1009 [Mesorhizobium opportunistum
           WSM2075]
 gi|259034779|gb|EEW36035.1| protein of unknown function DUF1009 [Mesorhizobium opportunistum
           WSM2075]
          Length = 305

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 117/277 (42%), Positives = 160/277 (57%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF--DWQDFECRELPLGDFCVLRSI 60
           R+ IIAG G LP  VA         P+I  V  +     D   +E   L L D   L ++
Sbjct: 23  RVGIIAGGGSLPVEVAAGLAEAGHPPIIILVDGQADRQSDLIIYEHESLALEDIGSLAAL 82

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  I  +V+AG I RRP + DL  S+   L +   +   ++ G+  +LK     LE+ 
Sbjct: 83  LRRQRITHLVLAGEIRRRPRLVDLRPSL-GLLGLIPSVAMALARGDDGLLKILTRGLEAR 141

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV VVGAHE+VP L+   G L   VP +   RDI AA  +A+A+  LD+GQ+A++IGGR 
Sbjct: 142 GVKVVGAHEVVPRLVATEGPLTKAVPRKSDWRDIEAARAAAKAIGALDIGQAAIAIGGRA 201

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +ALEG+EGT  +L+R    R +GR+     GVLVK  K  Q++RADLPSIG +TV+    
Sbjct: 202 IALEGVEGTHGLLERTQQLRGHGRLAGKTRGVLVKCAKPGQELRADLPSIGPRTVEAAHA 261

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AGLAGIA+EAG SL+LE   V   A+  G+FV G+  
Sbjct: 262 AGLAGIAVEAGHSLILEGPHVLARANALGLFVFGLPA 298


>gi|87307079|ref|ZP_01089225.1| hypothetical protein DSM3645_01460 [Blastopirellula marina DSM
           3645]
 gi|87290452|gb|EAQ82340.1| hypothetical protein DSM3645_01460 [Blastopirellula marina DSM
           3645]
          Length = 301

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 61/281 (21%), Positives = 115/281 (40%), Gaps = 13/281 (4%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILH 62
            ++AG G LP  +A A +          +         +       + LG         H
Sbjct: 13  GLLAGWGQLPIEMATALQRHGYAVHALLIKGHADPILAEISATHEWVGLGQIGKCVRFFH 72

Query: 63  QYNIGRIVVAGAIDRRPNVQ-----DLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
           ++ +    + G + +   +      +       +  I+  I       +  IL       
Sbjct: 73  RHQVTTATMVGKVHKVRILDRGALWNHFPDWYGARVIAPFILGKKDRKDDTILSGICRAF 132

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
            + G+  V A +  P+LLV+ G L     ++    D+      A+A+   D GQS     
Sbjct: 133 SNKGIEFVPATDYAPDLLVKFGQLAGKPLSKKQLSDVQYGWDLAKAIGLFDTGQSVAIKA 192

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
              +ALE +EGTD  ++R      +G         +VK+ K QQDMR D+P+IG  T++ 
Sbjct: 193 QMALALEAVEGTDECIRRAGQLCRSG------GFTIVKVAKPQQDMRFDVPTIGVGTIET 246

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           + ++G   + +EA K++++++  V   A++ GI +     +
Sbjct: 247 MAESGAVTLVIEADKTIIVDEPAVIALANKLGITILAATGD 287


>gi|254304239|ref|ZP_04971597.1| hypothetical protein FNP_1910 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148324431|gb|EDK89681.1| hypothetical protein FNP_1910 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 267

 Score =  263 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 69/275 (25%), Positives = 131/275 (47%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDEEIKKLDNYAEFNIGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   +I +IV+ G ++++   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLRDITKIVMLGKVEKKLVFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISMGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+K+ + QQDMR D+P IG  T++  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKVSRPQQDMRVDVPVIGLNTIETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|237744959|ref|ZP_04575440.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|256028417|ref|ZP_05442251.1| hypothetical protein PrD11_10579 [Fusobacterium sp. D11]
 gi|260494740|ref|ZP_05814870.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289766341|ref|ZP_06525719.1| conserved hypothetical protein [Fusobacterium sp. D11]
 gi|229432188|gb|EEO42400.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|260197902|gb|EEW95419.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|289717896|gb|EFD81908.1| conserved hypothetical protein [Fusobacterium sp. D11]
          Length = 267

 Score =  263 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 71/275 (25%), Positives = 132/275 (48%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISLYPIGLFPSVDEEIKKLDNYAEFNIGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   ++ +IV+ G ++++   ++L           K++  +    +  +L A I  +  
Sbjct: 61  YLLLRDVTKIVMLGKVEKKLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIRL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDFDDEKTISIGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  TV+N I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTVENAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|296327501|ref|ZP_06870047.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296155327|gb|EFG96098.1| conserved hypothetical protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 267

 Score =  263 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 132/275 (48%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDEEIKKIDNYTEFNIGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   +I +IV+ G ++++   ++L           K++  +    +  +L A I  ++ 
Sbjct: 61  YLLLRDINKIVMLGKVEKKLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKKPDVDDEKTISIGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  T++  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTIETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|291288192|ref|YP_003505008.1| hypothetical protein Dacet_2290 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885352|gb|ADD69052.1| protein of unknown function DUF1009 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 265

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 77/274 (28%), Positives = 126/274 (45%), Gaps = 13/274 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ--DFECRELPLGDFCVLRSIL 61
           + +IAG G LP   AK       E VI ++  E + D         ++ +     +  +L
Sbjct: 3   IGLIAGYGELPLIAAKNLIKDGHELVIIALYEEVTADLGSLGVTVEKVSVTQVGKIIKLL 62

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
              N  R++ AG +++     DL    K  L   K++  L +  +  I+      L + G
Sbjct: 63  KNNNSDRVLFAGKVNKSLLFSDL----KFDLTAMKLLATLPNRKDDTIMDVICHELNANG 118

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V+   E +  L +  G      P++    DI   ++ A  L  LD+GQ+ V     V+
Sbjct: 119 IEVMEQSEALYPLYLGKGIYSKKKPSKVQMEDIEFGLEVARELGRLDIGQTVVVKNKAVM 178

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           ALE IEGTD  + R       G  LAGK  V+VK  K  QD R D+P++G  T++N+   
Sbjct: 179 ALEAIEGTDKAVVR-------GCSLAGKGAVIVKCAKPSQDKRFDIPTVGVDTLKNIADN 231

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
               IA+EAG + V++ +   ++ADE  +    +
Sbjct: 232 NGKVIAVEAGTTFVVDVDSCVRYADENKLIFLAV 265


>gi|19703931|ref|NP_603493.1| hypothetical protein FN0596 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|19714103|gb|AAL94792.1| Hypothetical protein FN0596 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
          Length = 267

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 132/275 (48%), Gaps = 12/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE-CRELPLGDFCVLRS 59
           M+++ +I G+G  P Y  + A+  N       +      + +  +   E  +G    +  
Sbjct: 1   MEKIGLIVGNGKFPLYFIEEAKNSNISVYPIGLFPSVDEEIKKIDNYTEFNIGHIGEIIK 60

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L   +I +IV+ G ++++   ++L           K++  +    +  +L A I  ++ 
Sbjct: 61  YLLLRDINKIVMLGKVEKKLIFENLILDKYGE----KIMEIVPDNKDETLLFAIIGFIKL 116

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G+ V+    ++ + + +        P+ D ++ I   +++A  LS +DVGQ+ V     
Sbjct: 117 SGIKVLPQSYLMKKFIFETKCYTEKEPDIDDEKTISIGIEAARLLSRVDVGQTVVCRDRA 176

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EGIEGTD  L+R     +       K  +L+KM + QQDMR D+P IG  T++  I
Sbjct: 177 VIAVEGIEGTDETLKRAGQYSD-------KDNILIKMSRPQQDMRVDVPVIGLNTIETAI 229

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           K G  GI  +A K + L ++   + A++  IF+ G
Sbjct: 230 KNGFKGIVAQAKKMIFLNQKECIELANKNNIFIVG 264


>gi|315499842|ref|YP_004088645.1| hypothetical protein Astex_2856 [Asticcacaulis excentricus CB 48]
 gi|315417854|gb|ADU14494.1| protein of unknown function DUF1009 [Asticcacaulis excentricus CB
           48]
          Length = 281

 Score =  262 bits (671), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 80/275 (29%), Positives = 137/275 (49%), Gaps = 3/275 (1%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M +L +IAG G++P  +A+  +       +  +      +       ++ +G F  +   
Sbjct: 1   MDKLGLIAGGGLVPVEIARYLKRSGRPYCVIRLEGLADAELAAHPGHDIDVGHFQKIFVA 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L Q     + + G + +RP+   +      +  +   I     GG+ ++L+    + ES 
Sbjct: 61  LAQEGCRAVCMVGYV-KRPDFDAMQRDEGGAAHLPG-IQAAGRGGDDSLLRQVARVFESQ 118

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G ++ GAH+  PEL ++ G      P+ + + D+  A + A AL  LD+GQ+AV  G   
Sbjct: 119 GYAIEGAHDANPELCLEEGLQAGEAPSPEAREDMEEAFRVAHALGALDIGQAAVVAGRIT 178

Query: 181 VALEGIEGTDSMLQRIVDCRN-NGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +A+E  EGTD++L+R+             + GVL K+ K  QD+R D+P+IG +TV+   
Sbjct: 179 LAVEAQEGTDALLKRVATLSPVLIGTQGRRKGVLAKVPKPIQDLRLDMPTIGVQTVEAAA 238

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            AGL GI  +AG  LV++K  V   A E G+F+ G
Sbjct: 239 AAGLCGIVGQAGALLVVDKARVYARAAELGLFIYG 273


>gi|304437452|ref|ZP_07397410.1| protein of hypothetical function DUF1009 [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
 gi|304369502|gb|EFM23169.1| protein of hypothetical function DUF1009 [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
          Length = 272

 Score =  262 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 79/277 (28%), Positives = 142/277 (51%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M++L ++AG G LP   A+AAR +  E    ++L +C  + +D     RE+ +G    + 
Sbjct: 6   MEKLGLLAGVGHLPAACARAARAQGFEVHAIALLPDCDPELKDAANAYREISIGSIASIL 65

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L Q  I ++ + G + +         +++    +  M+ QL +  +  I+   I  L 
Sbjct: 66  AYLQQEKIQKVTMIGKVTKELLFT---GAVQPDEMLRGMLMQLPNQNDDTIMMMFIGALM 122

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV+ +    ++  L+   G L +  P+   + D+   ++ A  +  LDVGQ+AV    
Sbjct: 123 KIGVTPLDQTALIRPLMPPAGVLTSRQPSAAERADMEYGLQMAREIGRLDVGQTAVVKDR 182

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ ++R       G  LAG   V+ K  K QQD R D+P++G  T++++
Sbjct: 183 AVMALEAIEGTDACIRR-------GGQLAGGGAVVAKAAKPQQDSRFDVPAVGLDTIESL 235

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +    + +A+EAGK+L ++KE     A+  GI +  +
Sbjct: 236 VAVKASALAIEAGKTLFVDKERAIALAEANGITIAAM 272


>gi|238927539|ref|ZP_04659299.1| protein of hypothetical function DUF1009 [Selenomonas flueggei ATCC
           43531]
 gi|238884821|gb|EEQ48459.1| protein of hypothetical function DUF1009 [Selenomonas flueggei ATCC
           43531]
          Length = 272

 Score =  261 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 78/277 (28%), Positives = 141/277 (50%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M++L ++AG G LP   A+AAR +  E    ++L +C  + +D     RE+ +G    + 
Sbjct: 6   MEKLGLLAGVGHLPAACARAARAQGFEVHAIALLPDCDPELKDAASAYREISIGSIASIL 65

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L Q  I ++ + G + +         +++    +  M+ QL +  +  I+   I  L 
Sbjct: 66  AYLQQEKIQKVTMIGKVTKELLFT---GAVQPDEMLRAMLMQLPNQNDDTIMMMFIGALM 122

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV+ +    ++  L+   G L +  P+   + D+   ++ A  +  LDVGQ+ V    
Sbjct: 123 KIGVTPLDQTALIRPLMPSAGVLTSRQPSAAERADMEYGLQMAREIGRLDVGQTVVVKDR 182

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ ++R       G  LAG   V+ K  K QQD R D+P++G  T++++
Sbjct: 183 AVMALEAIEGTDACIRR-------GGQLAGGGAVVAKAAKPQQDSRFDVPAVGLDTIESL 235

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + A  + +A+EA K+L ++KE     A+  GI +  +
Sbjct: 236 VAAKASALAIEADKTLFIDKERAIALAEANGITIAAM 272


>gi|114704864|ref|ZP_01437772.1| hypothetical protein FP2506_08006 [Fulvimarina pelagi HTCC2506]
 gi|114539649|gb|EAU42769.1| hypothetical protein FP2506_08006 [Fulvimarina pelagi HTCC2506]
          Length = 287

 Score =  261 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 95/279 (34%), Positives = 143/279 (51%), Gaps = 1/279 (0%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           +RL I+AG G LP  VA AA  K  EPV A   +  + D      R    G        L
Sbjct: 7   ERLGIVAGGGGLPMIVANAAIEKGMEPVFARFSDGMTNDSIIGRSRAFAWGRTGDAIEWL 66

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               + ++V  G I  RP+ + +  S K   R+ + + ++V GG+  +L+     LES G
Sbjct: 67  KAEGVQKLVFCGTISSRPDFRSILPSFKTLKRLPRAL-RIVKGGDDRLLRNLSRYLESEG 125

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             ++    + PELL   G L    P  +    +  A ++A AL  LD GQ+ ++   R++
Sbjct: 126 FDLLPVQAVAPELLAPEGVLTARTPTAEESAALDLAHRAATALGVLDAGQAVIASNERII 185

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+EGIEGT +M++R+ + R   +I  G+   LVK  K  QD R DLPSIG +T+     A
Sbjct: 186 AMEGIEGTRAMMRRVAEYRAARKIGRGERLALVKAVKPGQDRRFDLPSIGVQTIDEAEAA 245

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           G+  I + AG+SL+L  + V   A+ AG+ VCG+  E  
Sbjct: 246 GITAIGVSAGESLILGFDDVIDRANTAGLAVCGLGGEQG 284


>gi|32476481|ref|NP_869475.1| hypothetical protein RB10538 [Rhodopirellula baltica SH 1]
 gi|32447026|emb|CAD78932.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 326

 Score =  261 bits (668), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 73/281 (25%), Positives = 130/281 (46%), Gaps = 15/281 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSIL 61
           + +IAG G  P  VA+  +         ++      +  D         +G F       
Sbjct: 35  VGLIAGWGRFPICVAEKLKALGHPVHCVAITGHAGEELNDICESVLWAGVGRFGGHLRYF 94

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDS-------LRISKMIWQLVSGGNAAILKASI 114
            + ++  + +AG + +   +      I+ +            +        +  +L A I
Sbjct: 95  KRNDVAHVTMAGKLFKSDLLYSGSVWIRHTPDWTCIKTFWPCLFGARRDARDDRLLGAVI 154

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           D  E++ + +  A ++ PELL + G L    P+  ++ DI +  + A+ +  LD+GQ+  
Sbjct: 155 DTYENHAMKICSATDLAPELLAKTGQLTRRKPSSAIQSDISSGWQIAKTMGGLDIGQAIT 214

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
              G ++A+E IEGTD+ + R  +    G         LVK+ K  QDMR D+P+IG +T
Sbjct: 215 IKDGTIIAVEAIEGTDACIARTGELCRRG------GWTLVKVSKPDQDMRFDVPTIGPQT 268

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +Q V +AG A IA+EAGK+++L+ E   + AD  GI +  +
Sbjct: 269 IQRVHEAGGAAIAIEAGKTILLDSEETIQLADRLGIALVAM 309


>gi|187735386|ref|YP_001877498.1| protein of unknown function DUF1009 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187425438|gb|ACD04717.1| protein of unknown function DUF1009 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 287

 Score =  261 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 71/276 (25%), Positives = 135/276 (48%), Gaps = 15/276 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKN--DEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           L ++AG G+ P Y+ + AR +      V      E +          +E  +G      +
Sbjct: 8   LGLVAGDGVYPEYIVRGARRRTPELRIVAVGFKGETNPAVIPLCDAYQEFSVGQISKPFT 67

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L ++ +  +++AG I+ +  +     S++  LR   ++ ++      ++L A I   E 
Sbjct: 68  FLKKHGVRNVIMAGGINPKNIL-----SLRPDLRALSVLMRMPEKNADSLLGAVITEAEK 122

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  ++ A   + E + Q G +    P  +   D    M++A+ +S L +GQS +  GG 
Sbjct: 123 EGFIILPASTYMEEHMPQPGHIAGPPPTPEQWEDARFGMQTAKEISRLHIGQSVIVHGGT 182

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E IEGT++ ++R  +  N      GK   L K+ +   DMR D+P++G  T++   
Sbjct: 183 VIAVEAIEGTNNCIRRGGELGN------GKPATLAKVARLGHDMRFDIPTVGPVTIETCA 236

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + G+  IALEAGK+++LE++ V++      I +  +
Sbjct: 237 ECGVRQIALEAGKTILLERDRVEELCKRHKISLHAL 272


>gi|327543221|gb|EGF29655.1| protein containing DUF1009 [Rhodopirellula baltica WH47]
          Length = 320

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 74/281 (26%), Positives = 130/281 (46%), Gaps = 15/281 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSIL 61
           + +IAG G  P  VA+  +         ++      +  D         +G F       
Sbjct: 29  VGLIAGWGRFPICVAEKLKALGHPVHCVAITGHAGEELNDICESVLWSGVGRFGGHLRYF 88

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDS-------LRISKMIWQLVSGGNAAILKASI 114
            + ++  + +AG + +   +      I+ +            +        +  +L A I
Sbjct: 89  KRNDVAHVTMAGKLFKSDLLYSGSVWIRHTPDWTCIKTFWPCLFGARRDARDDRLLGAVI 148

Query: 115 DLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV 174
           D  E++ + +  A ++ PELL + G L    P+  ++ DI A  + A+ +  LD+GQ+  
Sbjct: 149 DTYENHAMKICSATDLAPELLAKTGQLTRRKPSSAIQSDISAGWQIAKTMGGLDIGQAIT 208

Query: 175 SIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKT 234
              G ++A+E IEGTD+ + R  +    G         LVK+ K  QDMR D+P+IG +T
Sbjct: 209 IKDGTIIAVEAIEGTDACIARTGELCRRG------GWTLVKVSKPDQDMRFDVPTIGPQT 262

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +Q V +AG A IA+EAGK+++L+ E   + AD  GI +  +
Sbjct: 263 IQRVHEAGGAAIAIEAGKTILLDSEETIQLADRLGIALVAM 303


>gi|83592933|ref|YP_426685.1| hypothetical protein Rru_A1598 [Rhodospirillum rubrum ATCC 11170]
 gi|83575847|gb|ABC22398.1| Protein of unknown function DUF1009 [Rhodospirillum rubrum ATCC
           11170]
          Length = 286

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 87/277 (31%), Positives = 142/277 (51%), Gaps = 10/277 (3%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD--WQDFECRELPLGDFCVLRSIL 61
           L IIAG G LP  V +A + +    V+  +  +            +   LG    +   L
Sbjct: 13  LAIIAGGGDLPKRVVEACQAQGRPFVVVGLNGQAETTGWPPGVPHQWTRLGKCGGMAEDL 72

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               I  + +AG + +RP++  L    + +  ++K+    +  G+  +L A +  LES G
Sbjct: 73  RDRGILHLCMAGRV-KRPSLVSLLPDWRTAAFLAKVGAAAL--GDDGLLSAIVRELESNG 129

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            ++    +++    +  G +G  VP+   +RD+  A + A+AL  LD+GQ  V   G V+
Sbjct: 130 FTIEAPDQVIGARPLGAGVIGRIVPDDQARRDLAHAFRMAKALGALDIGQGVVVQQGLVL 189

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E IEGTD+ML+R      +G        VLVK CK QQD R DLP++GA+T++   +A
Sbjct: 190 AVEAIEGTDAMLERCACLLRDG-----PGAVLVKACKPQQDRRVDLPALGARTLEVAARA 244

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GL G+  EAG  ++L+   + K AD+ G+F  G+  E
Sbjct: 245 GLRGVGFEAGAVVLLDPAGLGKRADDLGLFFVGLSAE 281


>gi|116625259|ref|YP_827415.1| hypothetical protein Acid_6204 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228421|gb|ABJ87130.1| protein of unknown function DUF1009 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 272

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 73/276 (26%), Positives = 134/276 (48%), Gaps = 12/276 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLR 58
           M R  +IAG+G  P    ++AR    E V+ ++  E S + +     C  + +G    L 
Sbjct: 1   MIRYGMIAGNGRFPLLALESARQLGYEIVVIALQEEASKEVEALAARCYWVSIGQLGRLI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            I  Q  I  +++ G +       ++        R+ K++  L S     ++   I +L+
Sbjct: 61  EICQQEGISEVMMCGQVKHAKIFSNIRPDW----RLVKLLAMLPSKNTDGLIGGVIRVLQ 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ +  +  ++  +L   G++     +++   DI    + A AL+  DVGQS      
Sbjct: 117 DEGIQLRDSTMLLKPMLATAGAMTRRKADKEEGVDIDYGRRVANALAGFDVGQSVAICDR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
             VA+E +EGTD+ML+R     N      G+   LVK+ + ++ +  D+P +G  T+  +
Sbjct: 177 ACVAVEAMEGTDAMLRRAATLVN------GRRMALVKVARRREHLLFDVPVVGLDTIPVM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            + G   +A+EAG++L+L+KE + + AD AGI + G
Sbjct: 231 RETGTTVLAVEAGRTLMLDKEKMLETADAAGIAIVG 266


>gi|90419603|ref|ZP_01227513.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336540|gb|EAS50281.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 299

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 98/275 (35%), Positives = 155/275 (56%), Gaps = 1/275 (0%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L ++AG G LP  VA+AAR      V+  + +  + DW  +E    P G      + +  
Sbjct: 13  LGLVAGGGSLPRLVAEAARASGWRVVVVRIGDGMADDWSGYEGGAYPWGRTGDAIAYMKS 72

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+V  G +  RP+ + L  S +  +R+   + ++V GG+  +L+A    +E  G  
Sbjct: 73  CGVQRMVFCGTVSHRPDFRSLIPSFQTLIRLPAAL-KIVRGGDDRLLRALSRYMERQGFE 131

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           ++   +IVP+LL   G+L   +P+ D ++ ++ A ++A  L ELD+GQ+ V+   RV+AL
Sbjct: 132 MLAVQDIVPQLLTPGGTLTRRMPDADEEQALVLAARAAGRLGELDIGQAVVASRDRVIAL 191

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EGIEGT  MLQR+ D ++ GRI   +  VLVK  K  QD R DLPSIG  T++    AG+
Sbjct: 192 EGIEGTREMLQRVADLKSRGRIGRSERCVLVKSVKPTQDERFDLPSIGGATIEEAAVAGI 251

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
             I   AG+SLVL  + V + A+ AGI + G++ +
Sbjct: 252 TVIGATAGRSLVLGIDDVLEAAEAAGIAIVGLEPD 286


>gi|329889369|ref|ZP_08267712.1| hypothetical protein BDIM_10510 [Brevundimonas diminuta ATCC 11568]
 gi|328844670|gb|EGF94234.1| hypothetical protein BDIM_10510 [Brevundimonas diminuta ATCC 11568]
          Length = 279

 Score =  259 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 86/277 (31%), Positives = 138/277 (49%), Gaps = 3/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
            +L +IAGSG LP  VA+    +  E  I  +          +  ++  + +   +   +
Sbjct: 5   PKLALIAGSGDLPIRVAQRCEAEGREVFIIRLKGFADAHLHRWPGQDFGMAEIGKIVKAM 64

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
                  + +AG ++ RP+ + L   +K +  +  +I    S G+ A+L+  + + E  G
Sbjct: 65  RAEGCRAVCLAGYVN-RPDFKTLKPDLKGASLLPGIIAAA-SKGDDALLRKILSVFEDEG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            +V GA +I+   ++  G+LG   P  +   D+  A+  AE   ELD+GQ AV   G V+
Sbjct: 123 FAVEGADDILGGEMLAAGALGHVTPTAEQLADLKKALHIAEKSGELDIGQGAVVCDGLVL 182

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           A+E  EGTD ML+R+     + R   G   G L K  K  QD+R D+P IG  TV+    
Sbjct: 183 AVEAQEGTDEMLRRVASLPVDLRGSPGFARGALGKAPKPIQDLRVDMPVIGPTTVELAAA 242

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AGLAGI    G+ +V++ E + + AD  G+FV G  R
Sbjct: 243 AGLAGIGGFEGRLIVIDHEGLVEAADRLGLFVWGEPR 279


>gi|294795179|ref|ZP_06760313.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
 gi|294453971|gb|EFG22346.1| conserved hypothetical protein [Veillonella sp. 3_1_44]
          Length = 261

 Score =  259 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 66/264 (25%), Positives = 125/264 (47%), Gaps = 12/264 (4%)

Query: 18  AKAARLKNDEPVIASVLNECSFDW--QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAI 75
            +AA +   E V+  V+ +       +     ++ +     +   L +  +  + + G +
Sbjct: 1   MRAAHVLGHEVVVIGVVPDVDPALKAEADAFYDIGVAKLGKIFKTLKKEEVQELTMLGKV 60

Query: 76  DRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELL 135
            +    + L F     L+   ++ +L +  +  I+ A +D +E  G  V+     +   +
Sbjct: 61  TKEILFKGLTF---PDLKTLGVLKRLKNRKDDTIMLAIVDEIEREGFKVLDQTAYLKPFM 117

Query: 136 VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQR 195
            +VG L    P  +   DI    + A+ +  LD+GQ+ V      +A+E IEGTD  + R
Sbjct: 118 PKVGVLSKAQPTDEQWADICFGFELAKQMGALDIGQTVVVKHKAAMAIEAIEGTDKCILR 177

Query: 196 IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLV 255
                  G  L     V+VK  K  QD+R D+P++G KT+ ++I +G   +A+EA K++ 
Sbjct: 178 -------GGELGRGDAVVVKTEKPNQDVRFDVPAVGIKTLMSMIDSGCKVLAVEAEKTIF 230

Query: 256 LEKELVKKHADEAGIFVCGIDREF 279
           ++++ V   AD  GI +C +D+EF
Sbjct: 231 VQQQDVLDMADRHGIVICAVDQEF 254


>gi|225874201|ref|YP_002755660.1| hypothetical protein ACP_2639 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793020|gb|ACO33110.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 282

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 74/272 (27%), Positives = 133/272 (48%), Gaps = 14/272 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-------FECRELPLGD 53
           M +L +IAG+G  P+ + +AAR    E V+A++  E   +  D            L LG+
Sbjct: 1   MSKLGLIAGNGRFPFLLLEAARASGLEVVVAAIKEETDPEMNDRAAADPGLRVYWLSLGE 60

Query: 54  FCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKAS 113
              L    H+  + R V+AG +  +     +        R++K++  L +     +L A 
Sbjct: 61  LSKLIDTFHKEGVTRAVMAGQVRHKQIFSSIRPDW----RLAKLLMSLRTRNTDMLLGAV 116

Query: 114 IDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSA 173
             +L   G+ ++ +   +  +LV+ G L    P  D +RDI    + A+ ++  D+GQ+ 
Sbjct: 117 AKVLGDEGIELISSTTYLEPMLVEPGVLTERAPEEDEQRDIAYGREVAKGIAGYDLGQTV 176

Query: 174 VSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGK---SGVLVKMCKSQQDMRADLPSI 230
           V      VA+E +EGTD+ ++R           A        +VK+ K +QDMR D+P I
Sbjct: 177 VVAAQACVAVEAMEGTDATIERAGALMRTLDDEASTLSHRLTVVKVAKPKQDMRFDVPVI 236

Query: 231 GAKTVQNVIKAGLAGIALEAGKSLVLEKELVK 262
           G +T++ +I AG   +A+EA ++L+ +++ V 
Sbjct: 237 GLRTIETMIAAGATCLAIEAKRTLIFDRDGVL 268


>gi|187250501|ref|YP_001874983.1| hypothetical protein Emin_0079 [Elusimicrobium minutum Pei191]
 gi|186970661|gb|ACC97646.1| Uncharacterized protein conserved in bacteria DUF1009
           [Elusimicrobium minutum Pei191]
          Length = 273

 Score =  258 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 81/278 (29%), Positives = 137/278 (49%), Gaps = 8/278 (2%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNEC---SFDWQDFECRELPLGDFCVL 57
           M+++ IIAG G +P Y+A  A+ K     +A +        F+       E  +G     
Sbjct: 1   MEKIGIIAGEGKMPVYIAAEAKEKGVAVYVACIKGNAFPSDFEAYSASTVEFKMGQLSKG 60

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
            +   +  + ++++AG +       ++       LR +KM+  L       IL+A I+  
Sbjct: 61  INFFKENGVTKVLMAGRVKHTAIFSNIM----PDLRGAKMLAGLKDMKAQTILRAIINEF 116

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G+S + +   + + +   G LG   P  + K  I   ++ A+ALS LD+G + V   
Sbjct: 117 EKEGISFISSVSFLEKYMPGPGLLGKRPPTEEEKLSIEFGIEIAKALSGLDIGLTVVVAD 176

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
             VVALEG+EGTD  ++R      N      KS V+VK+ + QQD R DLP IG  T+++
Sbjct: 177 RAVVALEGMEGTDECIKRAGMLYKN-SSKKNKSLVVVKVARPQQDFRFDLPIIGKGTIKS 235

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +++G   + +E  K+L+L+ + V K AD+A I +   
Sbjct: 236 AVESGAKVVVIEGRKTLILDMDEVIKMADKASITLLAF 273


>gi|304570500|ref|YP_002502.2| hypothetical protein LIC12578 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 282

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 65/277 (23%), Positives = 131/277 (47%), Gaps = 13/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M +L I+AG+G LP+   K A L  ++P+  S++ E  F    +E R +P+       L 
Sbjct: 1   MGKLGILAGAGELPHIGMKEALLAGEDPIFFSII-ESDFHVGMYEDRNIPIHIVKIGTLL 59

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +  ++N+ R+++ G + +    ++L    K  L+   ++ ++++  + +I K   D   
Sbjct: 60  KLCKRHNVDRLLLLGKVKKEIIFKNL----KFDLKAIALLARMINKHDYSIFKTVADEFA 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              ++++     +  L +  G        +    DI   M  AE ++ LD+GQ+ V +  
Sbjct: 116 KEKITIISQKTFLQSLFLPEGRFTKKPLTQKELEDIAFGMDYAEKMAGLDIGQTVVVLDK 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTD  + R       G+        + K  K  QD R DLP++G  T++ +
Sbjct: 176 SVLAVEAVEGTDLAICRGGSFAKKGK------ATVCKSSKPNQDHRFDLPTVGENTLKTM 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +     +AL  G+++++  +     A++  I +  I
Sbjct: 230 YENNCGTLALRTGETIIVHPKEFINLAEKFKINILSI 266


>gi|114778068|ref|ZP_01452968.1| hypothetical protein SPV1_05682 [Mariprofundus ferrooxydans PV-1]
 gi|114551674|gb|EAU54227.1| hypothetical protein SPV1_05682 [Mariprofundus ferrooxydans PV-1]
          Length = 273

 Score =  258 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 69/275 (25%), Positives = 127/275 (46%), Gaps = 14/275 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRS 59
           +R+ +IAG G  P  +A+A      E  + +   E S + +        L +G    +  
Sbjct: 7   RRIGLIAGYGHFPLELAQALNETGFEVHVVAAREETSKEIEALVASTCWLHVGQIGGMIK 66

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
              +  + ++V+AG + +      L  + +  L   K + +L    + +IL    +LL  
Sbjct: 67  AFKKAGVDQVVMAGKVRK----LHLFRNFRPDLTAMKGLLRLKDRRDDSILNTIAELLAE 122

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G++++        +L   G L      +    DI      A+A++ LD+GQ+ V     
Sbjct: 123 AGLTLIDQTRYAGAMLASEGLLAGPAAAKR-MPDIRFGFTHAKAIAGLDIGQTIVVQDQA 181

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E IEGTD  + R       G  L      ++K+ K  QD+R D+P++G  T+  + 
Sbjct: 182 VLAVEAIEGTDEAITR-------GGSLGSGKAAVIKVAKPNQDLRFDVPAVGPDTLATMH 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            +G   +A+EA K+L++E++  ++ A   GI V G
Sbjct: 235 ASGCTLLAVEAEKTLIIERQRFRELAASYGISVYG 269


>gi|206890962|ref|YP_002247941.1| hypothetical protein THEYE_A0089 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206742900|gb|ACI21957.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 269

 Score =  258 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 73/276 (26%), Positives = 132/276 (47%), Gaps = 12/276 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLRSIL 61
           + +IAG G LP  V    + +  + +  ++         +       + +G    +   L
Sbjct: 3   IGVIAGGGCLPLIVTNELKKRGYKVITVALEGLADDALSNHSDVFESINIGKAGQIIDFL 62

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
              N+  +++ G + ++   +    +IK  +R  KM++     G+  +LK     L + G
Sbjct: 63  KNNNVKEVILTGKVPKKLIFE--RKTIKPDMRALKMLFSAKIRGDNELLKLVEKELLTEG 120

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + +    E  PEL+   G L    P ++  +DI    K A+ + ELD+GQ+ V     V+
Sbjct: 121 IKIAEISEFCPELITPEGVLTRKKPTKEEWKDIEYGFKIAKKIGELDIGQTVVVKERSVI 180

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E IEGTD  + R             K+ ++VK+ K QQD+R D P+ G  T+  + KA
Sbjct: 181 AVEAIEGTDETILRAGRFV--------KNSIVVKVSKPQQDLRLDPPAAGVDTIVIMGKA 232

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
               +ALEAGK+ ++E++ + + A+E  I V G+ +
Sbjct: 233 NAKILALEAGKTFLIERDKLIEKANEINIIVVGVKQ 268


>gi|313895258|ref|ZP_07828815.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976153|gb|EFR41611.1| conserved hypothetical protein [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 267

 Score =  257 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 77/277 (27%), Positives = 140/277 (50%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M+++ ++AG G LP   A+AAR    E    ++L +   + +D      E+ +G    + 
Sbjct: 1   MEKIGLLAGVGHLPAACARAARALGYEVHAVALLPDTDPELKDAANVYHEISIGQIASIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L Q  I ++ + G + +         +I     +  M+ QL +  +  I+   +  L 
Sbjct: 61  AYLQQEEIKKVTMIGKVTKELLFT---GAIVPDEMLRGMLMQLPNQNDDTIMMMFVGALM 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV+ +    ++  L+   G+L +  P+   +RD+   ++ A  +  LDVGQ+AV    
Sbjct: 118 KIGVTPLDQTALIRPLMPAEGTLTSRAPSEAERRDMEFGLQMAREIGRLDVGQTAVVKDM 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ ++R       G  LAG   V+ K  K QQD R D+P++G  T++++
Sbjct: 178 AVMALEAIEGTDACIRR-------GGQLAGSGAVVAKAAKPQQDSRFDVPAVGLDTIESL 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +    + +A+EAGK+L ++KE     A+  GI +  +
Sbjct: 231 VAVKASALAIEAGKTLFIDKERAVALAEANGITIAAL 267


>gi|24213797|ref|NP_711278.1| hypothetical protein LA_1097 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24194627|gb|AAN48296.1|AE011292_9 conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
          Length = 282

 Score =  257 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 65/277 (23%), Positives = 131/277 (47%), Gaps = 13/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M +L I+AG+G LP+   K A L  ++P+  S++ E  F    +E R +P+       L 
Sbjct: 1   MGKLGILAGAGELPHIGMKEALLAGEDPIFFSII-ESDFHVGMYEDRNIPIHIVKIGTLL 59

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +  ++N+ R+++ G + +    ++L    K  L+   ++ ++++  + +I K   D   
Sbjct: 60  KLCKRHNVDRLLLLGKVKKEIIFKNL----KFDLKAIALLARMINKHDYSIFKTVADEFA 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              ++++     +  L +  G        +    DI   M  AE ++ LD+GQ+ V +  
Sbjct: 116 KEKITIISQKTFLQSLFLPEGRFTKKPLTQKELEDIAFGMDYAEKMAGLDIGQTVVVLDK 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTD  + R       G+        + K  K  QD R DLP++G  T++ +
Sbjct: 176 SVLAVEAVEGTDLAICRGGSFAKKGK------ATVCKSSKPNQDHRFDLPTVGENTLKAM 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +     +AL  G+++++  +     A++  I +  I
Sbjct: 230 YENNCGTLALRTGETIIVHPKEFINLAEKFKINILSI 266


>gi|320529924|ref|ZP_08031001.1| hypothetical protein HMPREF9555_01076 [Selenomonas artemidis F0399]
 gi|320137942|gb|EFW29847.1| hypothetical protein HMPREF9555_01076 [Selenomonas artemidis F0399]
          Length = 267

 Score =  256 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 78/277 (28%), Positives = 141/277 (50%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M+++ ++AG G LP   A+AAR    E    ++L +   + +D     RE+ +G    + 
Sbjct: 1   MEKIGLLAGVGHLPAACARAARALGYEVHAVALLPDTDPELKDAANVYREISIGQIASIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L Q  I ++ + G + +         +I     +  M+ QL +  +  I+   +  L 
Sbjct: 61  AYLQQEEIKKVTMIGKVTKELLFT---GAIVPDEMLRGMLMQLPNQNDDTIMMMFVGALM 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV+ +    ++  L+   G+L +  P+   +RD+   ++ A  +  LDVGQ+AV    
Sbjct: 118 KIGVTPLDQTALIRPLMPAEGTLTSRAPSEAERRDMEFGLQMAREIGRLDVGQTAVVKDM 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ ++R       G  LAG   V+ K  K QQD R D+P++G  T++++
Sbjct: 178 AVMALEAIEGTDACIRR-------GGQLAGSGAVVAKAAKPQQDSRFDVPAVGLDTIESL 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +    + +A+EAGK+L ++KE     A+  GI +  +
Sbjct: 231 VAVKASALAIEAGKTLFIDKERAVALAEANGITIAAL 267


>gi|260886280|ref|ZP_05897543.1| conserved hypothetical protein [Selenomonas sputigena ATCC 35185]
 gi|330839736|ref|YP_004414316.1| protein of unknown function DUF1009 [Selenomonas sputigena ATCC
           35185]
 gi|260863999|gb|EEX78499.1| conserved hypothetical protein [Selenomonas sputigena ATCC 35185]
 gi|329747500|gb|AEC00857.1| protein of unknown function DUF1009 [Selenomonas sputigena ATCC
           35185]
          Length = 268

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 71/277 (25%), Positives = 134/277 (48%), Gaps = 11/277 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLR 58
           M+++ ++AG G LP   A+AA+    E    S+L     +  +   + R + +     + 
Sbjct: 1   MEKIGLLAGVGRLPVVCAQAAKALGIEVSAVSLLAGTDKELAEVASDHRAINVAQLGAII 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
             L +  + ++ + G + +           +  +R+ +++  L    +  I+ A +  L 
Sbjct: 61  DYLKERGVTKVTLLGKVTKELLFAGSHE--QPDMRMMQLLMSLPDKKDDTIMLAFVKELA 118

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+       ++  L+   G+L    P  + + D+  A+  A+ +  LD+GQ+AV    
Sbjct: 119 KEGLEAFDQTALLKTLMPPAGTLTKREPTAEERADMEMALAMAKEIGRLDIGQTAVVKAK 178

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ ++R  +    G  +   +         QQDMR D+P+IG  T++++
Sbjct: 179 AVMALEAIEGTDACIRRGGELSGGGAAVGKAAK-------PQQDMRFDVPAIGTATIESM 231

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           I AG   +A+EAG+ LV+++  V   ADE GI +  I
Sbjct: 232 IAAGAKALAIEAGRVLVVDQAKVAALADENGITIAAI 268


>gi|114768807|ref|ZP_01446433.1| hypothetical protein OM2255_03735 [alpha proteobacterium HTCC2255]
 gi|114549724|gb|EAU52605.1| hypothetical protein OM2255_03735 [alpha proteobacterium HTCC2255]
          Length = 282

 Score =  255 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 65/276 (23%), Positives = 131/276 (47%), Gaps = 3/276 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L I+AG+G LP  + +  +  N +  I           +              L + L+ 
Sbjct: 6   LAIVAGAGDLPIQIVEHCKNNNIDFKIIHFEGVDLHWLKQLPVINAKFEKPNALFASLND 65

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
               ++V AGA+ +RP +  L F  K  L+I+  +   +  G+   LK   ++ E  G  
Sbjct: 66  CGCNQVVFAGAM-KRPKLNPLKFDAKF-LKIASKLLPALKKGDDTTLKIIAEIFEKEGFE 123

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           ++   +I+  + V  G      P+ +   D++   +    +S+ D+GQ+ V   G  + +
Sbjct: 124 IIATDKILKNIFVPEGVFTKKNPSENDLIDVMRGFEILNIISKADIGQACVIAQGLCLGI 183

Query: 184 EGIEGTDSMLQRIVDCRNN-GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           E I+G+D++++     + N     +   GV +K  K  QD R D+P++G +T++ + +AG
Sbjct: 184 ETIQGSDALIKFAGQSKKNYLNDESDGKGVFIKSPKLNQDKRIDVPTVGVETIRTIAEAG 243

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           L+G+A++A    +++K      A++ GIF+  +  +
Sbjct: 244 LSGLAIKADCVQMIDKNACIDTANQLGIFITSVSSD 279


>gi|260433797|ref|ZP_05787768.1| phosphatidate cytidyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417625|gb|EEX10884.1| phosphatidate cytidyltransferase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 264

 Score =  255 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 83/269 (30%), Positives = 129/269 (47%), Gaps = 13/269 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G+LP  +        + P+I ++        +       PL       + L  
Sbjct: 2   LALIAGTGVLPDELVSHLA---ERPLICALEGFEPDRLR--PDISFPLEHLGSFIAELKA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  I +AGA+ RRP +       + +  +  +I + +  G+   L+A I +LE  G+ 
Sbjct: 57  RGVTHICMAGAV-RRPKIDPSRIDAQTA-PLVPIIQKALVSGDDGALRAVIGVLEDAGLQ 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AH+I P+LL  +G L    P      D   A+    A+   D+GQ+ V   G+V+A+
Sbjct: 115 VQAAHQIAPDLLPPLGCLTQAQPTEAELADANRAVGVLRAMGAADIGQACVVHQGQVLAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG  GT  MLQ +    + G       G+L K  K  QD RADLP+IG  TV   + AGL
Sbjct: 175 EGAFGTAWMLQSLAARPDAG------GGILFKGPKPGQDRRADLPAIGPDTVTGAVAAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
           +GI +E G  +VL++  V    D  G+F+
Sbjct: 229 SGIVVEKGGVIVLQRAEVVAECDRLGLFL 257


>gi|121535891|ref|ZP_01667688.1| protein of unknown function DUF1009 [Thermosinus carboxydivorans
           Nor1]
 gi|121305510|gb|EAX46455.1| protein of unknown function DUF1009 [Thermosinus carboxydivorans
           Nor1]
          Length = 267

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 67/277 (24%), Positives = 128/277 (46%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLR 58
           MK + ++AG G LP   A+AAR      +  +V+     +      +   + +G+   + 
Sbjct: 1   MKTIGLLAGVGRLPVEFARAARGMGFTVIAVAVVGGVDDELAAAADKLYTIGIGEVGKII 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L    +  + + G + +         +++   R  +++  L    +  I+ A +  L 
Sbjct: 61  NTLKAEGVKEVTMLGKVTKELMFS---GAVRLDERAQRLLAGLKDNSDDTIMLAFVRELA 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + G+ V+     +  L+   G+L    P    + D+      A  +  LD+GQ+ V    
Sbjct: 118 AEGIGVLDQTAFIRSLMPAPGTLTKREPTPAERADMEFGYAMARQIGGLDIGQTVVVKNK 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ +         G  L      + K+ K  QDMR D+P++G  T++ +
Sbjct: 178 AVMAVEAIEGTDACI-------RRGGALGRGGVTVAKVAKPNQDMRFDVPAVGVGTLEAM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           I+AG   + +EAGK+LV+++E V   AD+  I +  +
Sbjct: 231 IEAGATALVIEAGKTLVVDRERVVALADQHNITIVAM 267


>gi|254510140|ref|ZP_05122207.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
 gi|221533851|gb|EEE36839.1| conserved hypothetical protein [Rhodobacteraceae bacterium KLH11]
          Length = 264

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 85/274 (31%), Positives = 130/274 (47%), Gaps = 13/274 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G+LP  V          P+I ++                PL       + L  
Sbjct: 2   LALIAGTGVLPDEVVACLPK---RPLICALEGFEPDTLTADVI--FPLEQLGSFIADLKS 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA+ RRP V          + +  ++ + +  G+   L+A I++ E  G+S
Sbjct: 57  RGVTEVCMAGAV-RRPAVDPARIDAAT-MPLVPILQKAIMSGDDGALRAVIEIFEQAGLS 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AH I P+LL  +G L    P+     D   A     A+   D+GQ+ V + G+ +A+
Sbjct: 115 VRAAHAIAPDLLPALGCLTEVQPSASDLSDADRAAGILRAMGAADIGQACVVLKGQALAI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EGI GT  MLQ +    + G       GVL K  K  QD RAD+P+IG  TV   + AGL
Sbjct: 175 EGIYGTAWMLQSLTQRPDAG------GGVLFKGPKPDQDRRADMPAIGPDTVSGAVAAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           +GI +E G  LVL +E V +  +  G+F+   +R
Sbjct: 229 SGIVIEKGGVLVLHRERVIEECNRLGLFLTIRER 262


>gi|116327597|ref|YP_797317.1| hypothetical protein LBL_0829 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331792|ref|YP_801510.1| hypothetical protein LBJ_2278 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116120341|gb|ABJ78384.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125481|gb|ABJ76752.1| conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 282

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 68/277 (24%), Positives = 136/277 (49%), Gaps = 13/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLR 58
           M RL I+AG G LP+   K A    ++P+  S++ E  F   D+  R +P+       L 
Sbjct: 1   MGRLGILAGGGELPHIGMKEALAAGEDPIFFSII-ESDFHEGDYGDRNVPVHIVKIGTLM 59

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +  +Y+I R+++ G + +    ++L    K  L+   ++ ++++  + +I K + D   
Sbjct: 60  KLCKRYDIDRLLLLGKVKKEIIFKNL----KFDLKAISLLARMINKHDYSIFKTASDEFS 115

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
              ++++     +  L +  G     V N+    D+   M+ AE ++ELD+GQ+ + +  
Sbjct: 116 KEKIAIISQKTYLQSLFLPEGRFTKKVLNKKELEDVSFGMEYAEKMAELDIGQTVIVLDK 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTDS ++R       G     +   + K  K  QD R DLP++G  T++ +
Sbjct: 176 SVLAVEAVEGTDSAIRR------GGSFAKKRKATVCKSSKPDQDHRFDLPTVGENTLRIM 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            +     +AL  G+++++  +     A++  I +  I
Sbjct: 230 HENNCETLALRTGETIIVHPKEFINLAEKLKINILSI 266


>gi|46202584|ref|ZP_00052965.2| COG3494: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 259

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 84/263 (31%), Positives = 131/263 (49%), Gaps = 10/263 (3%)

Query: 16  YVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRSILHQYNIGRIVVAG 73
            VA A R +       ++           E     + LG+       L Q  +  +V+ G
Sbjct: 1   MVAAACRAQGRPFHFLALSGHADPQVIGQEAAQDWIRLGEAGTGFERLRQAGVAEVVMIG 60

Query: 74  AIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPE 133
            + RRP + +L    + +   +++   L + G+  +L+A    LES G  VVG  +++ +
Sbjct: 61  PV-RRPTLMELAPDFRTARFFARV--GLKALGDDGLLRAVAAELESEGFKVVGVDDVLSD 117

Query: 134 LLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSML 193
            L   G  G+  P+   + DI   +  A  L  LDVGQ+ V   G V+ +E IEGTD+++
Sbjct: 118 CLATPGPYGSRTPDEQAQADITRGIAVARGLGALDVGQAVVVQQGIVLGVEAIEGTDNLI 177

Query: 194 QRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKS 253
           +R       G     + GVLVK+ K  QD R DLP+IG  T++    AGL GIA+EAG +
Sbjct: 178 RRCGPLAREG-----EGGVLVKLKKPGQDRRIDLPTIGLTTLREAASAGLRGIAVEAGGA 232

Query: 254 LVLEKELVKKHADEAGIFVCGID 276
           LVL  + + + AD  G+FV GI+
Sbjct: 233 LVLGGKTLGEEADRLGLFVTGIE 255


>gi|149200512|ref|ZP_01877524.1| hypothetical protein LNTAR_23869 [Lentisphaera araneosa HTCC2155]
 gi|149136400|gb|EDM24841.1| hypothetical protein LNTAR_23869 [Lentisphaera araneosa HTCC2155]
          Length = 272

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 77/276 (27%), Positives = 124/276 (44%), Gaps = 14/276 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKN-DEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           K+L IIAG G  P+ + + AR    D+  +A++  + S D +        +  G      
Sbjct: 5   KQLGIIAGRGHYPFLILREARKNGVDKIAVAAIQGDASEDLEQESDAMAWVYPGQINRTI 64

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
               +  I   V+ G +        L    K  LR   M+ +L       +  A  +  +
Sbjct: 65  KFFQKQGITEAVMVGQVKPSRLFTGL----KPDLRTLFMLGKLKERNADTLFSAVCNEFQ 120

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G++++ A   + E L   G L     ++   RD   A   A+ +S +D+GQS V   G
Sbjct: 121 KSGITILSAITYLDEHLAGEGLLNNVKADKSRLRDAEYAFSVAKEVSRMDIGQSVVVKRG 180

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            ++A+EG EGTD  + R       G  L      + K+ K   DMR D+P IG +TV ++
Sbjct: 181 TILAVEGFEGTDKAIIR-------GGELGRGGVTVCKVTKPDHDMRFDVPCIGMRTVDSL 233

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           I+A    + +EA ++L +EKE V +  D A I V G
Sbjct: 234 IQAKARTLVVEAKRTLFIEKERVLEALDRAKISVIG 269


>gi|83858375|ref|ZP_00951897.1| hypothetical protein OA2633_02711 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853198|gb|EAP91050.1| hypothetical protein OA2633_02711 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 287

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 91/278 (32%), Positives = 140/278 (50%), Gaps = 4/278 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           +RL +IAG G LP YVA+AA+  +    + ++         D       +     +   L
Sbjct: 5   QRLGLIAGGGDLPVYVARAAQTGDRLACVIALKGFADPTRYDSPVIR-GIAQLGQVVKDL 63

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            Q +   +  AG +  RP+   L   +K    + + +    + G+ A+L+  +   E  G
Sbjct: 64  RQADCDAVCFAGIVT-RPDFSALKPDLKGMAFLPQALAAA-ARGDDALLRVIVGFFEKEG 121

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
            +V+GA++I  ELLV+ G +G+  P+   + D   A+  A      D+GQ AV   G V+
Sbjct: 122 FTVIGANDIADELLVEPGLIGSIRPDAIAEADAKKALHVAGVTGAEDIGQGAVVCKGLVL 181

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           A+E  EGTD ML R+       R     +SGVL K  K  Q+ R DLP IG  TVQ   +
Sbjct: 182 AVEAQEGTDQMLARVAGLPAELRGDELNRSGVLAKRPKPGQERRIDLPVIGVSTVQGAAR 241

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AGLAGI + AG ++VL +E V + AD AG+ V  ++ +
Sbjct: 242 AGLAGIVIPAGGAMVLGREAVGQAADAAGLAVWAVEMD 279


>gi|189219872|ref|YP_001940513.1| hypothetical protein Minf_1861 [Methylacidiphilum infernorum V4]
 gi|189186730|gb|ACD83915.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 280

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 15/276 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKN-DEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSI 60
           L IIAG G+ P  VA+AA+    ++      ++E     +        + +G    +   
Sbjct: 17  LGIIAGRGVYPILVAEAAKKAGVEKIYSVCFVSETDQKMESLSTTVEWIRVGQLSKMLQF 76

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
             +  + R ++AG +      +     ++  L+   ++ +L      ++  A  + LE  
Sbjct: 77  FKKNEVKRAIMAGGVAPSHLFE-----LRPDLKTLLLLAKLKERNAHSLFGAIAEELEKI 131

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV ++ A   + + LV  G  G     +    D+    + A+ ++ LD+GQS V   G V
Sbjct: 132 GVLLLKATTFLEDQLVPSGHFGGPQIKKRFWGDVEFGFRIAKEIARLDIGQSVVVKNGTV 191

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +++E  EGTD  ++R       G  L     +LVK+ K  QD R D+P IG KT+   ++
Sbjct: 192 LSVEAFEGTDETMKR-------GGELGKGGAMLVKVSKPDQDFRFDVPVIGLKTIDAALR 244

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            G+  I  E+ K+LVLEK  V + AD++ I + G  
Sbjct: 245 YGIGVIVCESEKTLVLEKGKVIEMADQSKISLVGFP 280


>gi|183221443|ref|YP_001839439.1| hypothetical protein LEPBI_I2061 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189911531|ref|YP_001963086.1| hypothetical protein LBF_2008 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167776207|gb|ABZ94508.1| conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779865|gb|ABZ98163.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 288

 Score =  252 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 74/276 (26%), Positives = 132/276 (47%), Gaps = 14/276 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLRSI 60
           RL IIAG G LP+   K A L  ++P+   ++ E  F  +  E R +P+       +   
Sbjct: 6   RLAIIAGDGELPHIGMKEALLAGEDPLFLGLI-ESDFSPRGQESRTIPVHITQVGKILKT 64

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           + +  I RI++ G + +    Q L    K  L+   ++ + ++  +  I  A  +  E+ 
Sbjct: 65  IQKEKISRILMLGKVRKDLLFQKL----KFDLKALSILARTINRNDYPIFLAIAEEFEAM 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV V+     +  LL+  G       +    +DI+  M+ AE +++LD+GQ  V     V
Sbjct: 121 GVKVISQKIYLKSLLLPEGRYTPKKFSTQELKDIMFGMEYAEKMADLDIGQMVVVSDESV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E +EGTD  ++R                V+ K  K++QD R DLP+IG  T Q +++
Sbjct: 181 IAVEAVEGTDETIRRGGLYTKK-----KGDAVVCKSPKTKQDERFDLPTIGIHTFQVMLE 235

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGI--FVCG 274
           +G   + +  G++LV+  + V + A +  +   V G
Sbjct: 236 SGCKTLCIREGETLVVNPKEVIEFATKHKLNFCVLG 271


>gi|154253622|ref|YP_001414446.1| hypothetical protein Plav_3183 [Parvibaculum lavamentivorans DS-1]
 gi|154157572|gb|ABS64789.1| protein of unknown function DUF1009 [Parvibaculum lavamentivorans
           DS-1]
          Length = 291

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 98/278 (35%), Positives = 149/278 (53%), Gaps = 4/278 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           ++L I AG+G LP  +A+AA+    E  I  +    + D   F    + LG       +L
Sbjct: 8   RKLGIAAGAGPLPVALAEAAQAAGREVFIVGIEGAANEDIARFPHAWVKLGAMGEFLRLL 67

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES-Y 120
                  IV+ G + RRP++  L   +   +++   + + +  G+  +L+   +  E  +
Sbjct: 68  KSAGCQDIVLIGGL-RRPDISKLGLDVTG-MKLLPRVARWMKEGDDGLLRGLAEYFEKDH 125

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVGAHEI   LL+    L    P+   +RDI  A+++A A+  LD+GQ AV+  G V
Sbjct: 126 GFHVVGAHEIAASLLMPEALLTKAAPSDQQERDIDTAIRAALAIGALDIGQGAVACRGIV 185

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAG-KSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           +ALE  EGTD ML R+               GVLVK+ K  Q+ R D+P+IG +TV+N  
Sbjct: 186 LALEAAEGTDEMLHRVARLPAELTGSPEVPDGVLVKLSKPGQERRVDMPTIGIQTVENAA 245

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            AGLAGIA+EAG +LV++ E V + A+  G+FV G+ R
Sbjct: 246 AAGLAGIAVEAGGTLVVDGEAVARAANAKGLFVLGLSR 283


>gi|171913838|ref|ZP_02929308.1| hypothetical protein VspiD_21705 [Verrucomicrobium spinosum DSM
           4136]
          Length = 278

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 68/282 (24%), Positives = 124/282 (43%), Gaps = 15/282 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKN-DEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
             + +IAG+G+ P    +AAR    D  V+A  ++E     +          +G    + 
Sbjct: 8   STIALIAGNGVYPETFVRAARKAGVDRLVVAGFVDETRPSLEGSVDAMAWFRVGQLSKMI 67

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           +   +  +  +V+ G I  +         ++  LR+  M+ +L       +     D ++
Sbjct: 68  AFFKKEGVKHVVMVGQIAPKNLF-----DLRPDLRLLMMLARLKRRNAETLFGGIADEMK 122

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ ++ A   + E +   G +    P +    D       A+A S+LD+GQ+ V   G
Sbjct: 123 KDGIELLPATTFLEEFMPAAGHVAGPNPKKRRWEDAEYGFTIAKASSKLDIGQTVVVRNG 182

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E  EGT+  ++R       G  L   S  +VK+ K  QDMR D+P +G  T+   
Sbjct: 183 TVLAVEAFEGTNEAIKR-------GGALGKGSATMVKVSKPNQDMRFDVPVVGPDTISTA 235

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
             AG+  IA+EAG +L+L++  V +   E  + +  +     
Sbjct: 236 AAAGVDVIAVEAGMTLILDQSEVFRRCAELKVSLLAVGDSVG 277


>gi|254465037|ref|ZP_05078448.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685945|gb|EDZ46427.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 262

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 131/270 (48%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP  VA  AR      + A   +E      +   R   LG F      L  
Sbjct: 2   LALIAGTGGLPAEVA--ARAPGRPLICAMAGSEPDAVDPEITFRFEQLGSF---LERLKA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  I +AGA+ +RPN+          L +  ++   ++ G+   L+A I + E  G +
Sbjct: 57  AEVTEICMAGAV-QRPNIDPSAIDAAT-LPLVPVLQGALAAGDDGALRAIIGIFEQAGFA 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHE+ P+LL+  G      P    K D     +   A+S  D+GQS      + +A+
Sbjct: 115 VRAAHEVAPDLLMAAGVPTKVQPGELDKADAERGAEIVAAMSAADIGQSCAVRKRQAIAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD ML  +    +      G+ G+L K  K  QD RADLP+IG +TV+   +AGL
Sbjct: 175 ENVFGTDWMLAALAQRPD------GQGGLLFKAPKPAQDRRADLPAIGVETVEAAARAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +GI LEAG  +VL+++ V    D  G+++ 
Sbjct: 229 SGIVLEAGGVIVLDQDAVIAACDRLGLYLW 258


>gi|323140923|ref|ZP_08075836.1| hypothetical protein HMPREF9443_00601 [Phascolarctobacterium sp.
           YIT 12067]
 gi|322414661|gb|EFY05467.1| hypothetical protein HMPREF9443_00601 [Phascolarctobacterium sp.
           YIT 12067]
          Length = 268

 Score =  251 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 72/275 (26%), Positives = 127/275 (46%), Gaps = 11/275 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M+ L +++G G LP  VA++A+      V   V+     +         ++ +G    + 
Sbjct: 1   MEVLGVLSGVGHLPVEVARSAKELGYHVVAVGVVPGIDEELPGSVDVYYDINIGKIGKII 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           S L +  + ++ + G + +    +     I   LR  K++  +    +  I+ A +  LE
Sbjct: 61  STLKKNKVTKVTMIGKVTKEVLYKAGR--IVPDLRAIKILATIPDRKDDTIMNAIVKELE 118

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V+    ++  LL   G L    P      D+    + A+A+  LD+GQ+ V    
Sbjct: 119 DEGIEVMDQTLLIKPLLPPPGVLTKRKPTEAELADMEFGFEMAKAIGGLDIGQTVVVKNR 178

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ + R       G  L     ++ K  K +QD R D+P  G  T++++
Sbjct: 179 AVMAVEAIEGTDACILR-------GGFLGKGGVIVAKAAKPKQDQRFDIPGFGTTTIESM 231

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           I AG  G  +EAG +++ E+E V   ADE  I + 
Sbjct: 232 IHAGATGAVIEAGNTIIPEREKVIALADEHNITIL 266


>gi|56696556|ref|YP_166913.1| hypothetical protein SPO1674 [Ruegeria pomeroyi DSS-3]
 gi|56678293|gb|AAV94959.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 264

 Score =  251 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 80/270 (29%), Positives = 127/270 (47%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP  +        + P++ ++                P+     L + L  
Sbjct: 2   LALIAGTGALPEELVARLS---EPPLVCAMEGFAPERLA--VDIPFPIEHLGSLVADLKA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  I +AGA+  RP V          L +  +I Q ++ G+   L+A + + E+ G++
Sbjct: 57  RGVSEICLAGAVG-RPAVDPARIDAAT-LPLVPVIQQALTSGDDGALRAVMGIFENAGLT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHEI P+LL+  G      P      D     +   A+S  D+GQ+ V   G+ +A+
Sbjct: 115 VRAAHEIAPDLLMPAGCPTKAQPEPAELADARRGAEIVAAMSAADIGQACVVHRGQALAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GT+ ML  +    + G       GVL K  K  QD RADLP+IG  TV   + AGL
Sbjct: 175 ESVFGTNWMLGSLGQRPDAG------GGVLFKAPKPDQDRRADLPTIGPDTVTAAVVAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +G+ + AG  +VLE++ V    D  G+F+ 
Sbjct: 229 SGLVIAAGGVIVLERDRVIAECDRLGLFLF 258


>gi|197105230|ref|YP_002130607.1| hypothetical protein PHZ_c1767 [Phenylobacterium zucineum HLK1]
 gi|196478650|gb|ACG78178.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 279

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 86/266 (32%), Positives = 136/266 (51%), Gaps = 3/266 (1%)

Query: 14  PYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAG 73
           P  +A+          +  +          +   E+ + +       L +     + +AG
Sbjct: 14  PVEIAEHCERSGRPLFVIRLKGFAGAQLAPYAGAEVGIAEVGKCIKALKRAGCEAVCLAG 73

Query: 74  AIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPE 133
            +  RP+   L   ++  L++          G+ A+L+  ++  E+ G +V GAHE++ +
Sbjct: 74  IVA-RPDFTSLMPDLRG-LKLLPRAVAAARKGDDALLRLLVEEFEAEGFAVEGAHEVMDD 131

Query: 134 LLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSML 193
           L +  G LG    + D  RD   A++ A A+  LD+GQ+AV   G V+A+E  EGTD+ML
Sbjct: 132 LTLPSGFLGRARGSDDDLRDADRALEVARAVGRLDIGQAAVVTQGLVLAVEAQEGTDAML 191

Query: 194 QRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGK 252
            R+ D   + R   G   GVL K  K  Q+ R DLP+IG  TVQ V +AGLAGI  EAG+
Sbjct: 192 ARVADLPAHLRGRPGAGRGVLAKAPKPIQETRVDLPTIGLATVQGVARAGLAGIVGEAGR 251

Query: 253 SLVLEKELVKKHADEAGIFVCGIDRE 278
            +VL++E V   ADE G+F+ G++ E
Sbjct: 252 VIVLDREAVISLADELGVFIFGVEPE 277


>gi|254421053|ref|ZP_05034777.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196187230|gb|EDX82206.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 279

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 84/276 (30%), Positives = 135/276 (48%), Gaps = 3/276 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAG G LP  VA     +     I  +    +     +   E  +     +   L 
Sbjct: 6   KLGLIAGGGDLPAAVAARCDAEGRPVFIIRLAGFAAPHLTRWPGAEFGMAQIGAILKALK 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 + +AG ++ RP+ + L    K +  +  ++    + G+ A+L+  + + E+ G 
Sbjct: 66  AEACTTVCLAGIVN-RPDFKSLKPDFKGATLLPGIVAAA-TQGDDALLRKILSVFEAEGF 123

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V GA +++    +  G+LG   P  D   D+  A+  AE   ELD+GQ AV   G V+A
Sbjct: 124 AVEGADDVLGGETLASGALGAVSPTPDQIADLKKALHVAEKSGELDIGQGAVVCDGLVLA 183

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E  EGTD+ML R+     + R  A    G L K  K  QD+R D+P IG +TV+    A
Sbjct: 184 VEAQEGTDAMLHRVAGLPADLRGSASAPKGALGKAPKPIQDLRVDMPVIGPRTVELAAAA 243

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           GLAGIA   G+ +++++  +   AD  G+FV G DR
Sbjct: 244 GLAGIAGVTGRLILIDRPAIVAAADRLGLFVWGEDR 279


>gi|168698124|ref|ZP_02730401.1| hypothetical protein GobsU_01282 [Gemmata obscuriglobus UQM 2246]
          Length = 266

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 65/264 (24%), Positives = 124/264 (46%), Gaps = 11/264 (4%)

Query: 17  VAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILHQYNIGRIVVAGA 74
            A+ AR  N   V    +       +D   E   L       +     +    R  +AG 
Sbjct: 3   FAEKARECNIPVVCVGAVGLADPVLRDLCTEFVWLHRMSIGSVCRAFRRGGARRWTMAGK 62

Query: 75  IDRRPNVQDLCF-SIKDSLRISKM--IWQLVSGGNAAILKASIDLLESYGVSVVGAHEIV 131
            +++   +   +       ++ +   + +  +  + ++L   ID   + G+  V A ++ 
Sbjct: 63  FEKKILFRPWRWLHYIPDWKMLRFWFLRRRKANNDDSLLLGLIDEFRAEGLECVSALDLC 122

Query: 132 PELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDS 191
           PELLV  G L    P +  +RDI    + A  +  LDVGQS +     V+A+E IEGTD 
Sbjct: 123 PELLVPEGVLTKRHPTKSEQRDIAFGWELAREMGRLDVGQSVMIRERAVLAVEAIEGTDM 182

Query: 192 MLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAG 251
            ++R  +  + G        V++K+ K +QD R D+P++G +T++ + +AG   +A+EAG
Sbjct: 183 AIRRAGELCSRG------GFVVIKLAKPEQDKRFDVPTVGTQTIETMHRAGATALAIEAG 236

Query: 252 KSLVLEKELVKKHADEAGIFVCGI 275
           +++V+++      A++ GI +  +
Sbjct: 237 RTIVIDQAATVALAEKYGITITSL 260


>gi|296536114|ref|ZP_06898245.1| protein of hypothetical function DUF1009 [Roseomonas cervicalis
           ATCC 49957]
 gi|296263559|gb|EFH10053.1| protein of hypothetical function DUF1009 [Roseomonas cervicalis
           ATCC 49957]
          Length = 295

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 89/281 (31%), Positives = 133/281 (47%), Gaps = 9/281 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSI 60
             L +I G G++P   A AA      P +  +       D+  +      LG    +   
Sbjct: 12  PPLGMIVGGGLMPQRAAAAALAAGRRPHVVVLEGFGDPRDYAAYPHIVCRLGAAGRMLDW 71

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L       +V+AG + +RP+   L      + R+   I     GG+ ++L A + +L   
Sbjct: 72  LRAAGCRDLVLAGQV-KRPSFLSLRPDA-GAARLLPRIGMKAFGGDDSLLNAVLRVLVEE 129

Query: 121 GVSVVGAHEIVPELLVQV-GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
           G   + A  ++ ELLVQ  G LG   P+    +DI   +     +   DVGQ  V   G 
Sbjct: 130 GFRPLAAQTLLAELLVQAPGQLGLVAPDEQAAQDIRRGVFVLRRMGAADVGQGCVVQQGL 189

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E IEGTD+ML R    R  G       GV VK+ K  QD R DLP+IG  T++ V 
Sbjct: 190 VLAVEAIEGTDAMLARAGTLRREG-----PGGVFVKILKPGQDRRVDLPTIGPDTIRAVA 244

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           +AGL G+A+EA  ++V+++      AD AG+F+  ID   A
Sbjct: 245 EAGLRGLAIEAKGTIVIDRAETVAAADAAGLFLLAIDPAAA 285


>gi|163741165|ref|ZP_02148557.1| hypothetical protein RG210_16935 [Phaeobacter gallaeciensis 2.10]
 gi|161385518|gb|EDQ09895.1| hypothetical protein RG210_16935 [Phaeobacter gallaeciensis 2.10]
          Length = 262

 Score =  249 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 87/270 (32%), Positives = 130/270 (48%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  +A       D P+I ++        +        L       + L  
Sbjct: 2   LALIAGQGALPAELAARLS---DRPLICAMRGSEPDHIE--AELTFRLEQLGSFIARLAA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  I +AGA+ RRP ++      +  L +  ++   ++ G+   L+A I + E  G++
Sbjct: 57  SGVTEICLAGAV-RRPAIEPAEIDAET-LPLVPVLQGALAAGDDGALRAIIGIFEQAGMN 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHE+ P+LL+  G      P    K D     +  EA+S  DVGQS     G+ +A+
Sbjct: 115 VRAAHEVAPDLLMAEGIPTEVKPGELDKPDAERGAEVVEAMSRADVGQSCAVRRGQAIAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD ML  +    +      G  G+L K  K  QD RADLP+IG +TV+   KAGL
Sbjct: 175 ENLFGTDWMLNALQSRPD------GTGGLLFKAPKPGQDRRADLPTIGVQTVELAAKAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           AGI LEAG  +VL +E V    +  G+F+ 
Sbjct: 229 AGIVLEAGGVIVLNQEDVVATCNRLGLFLW 258


>gi|163736306|ref|ZP_02143725.1| hypothetical protein RGBS107_14281 [Phaeobacter gallaeciensis
           BS107]
 gi|161390176|gb|EDQ14526.1| hypothetical protein RGBS107_14281 [Phaeobacter gallaeciensis
           BS107]
          Length = 262

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 87/270 (32%), Positives = 130/270 (48%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  +A       D P+I ++        +        L       + L  
Sbjct: 2   LALIAGQGALPAELAARLS---DRPLICAMRGSEPDHIE--AELTFRLEQLGSFIARLAA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  I +AGA+ RRP ++      +  L +  ++   ++ G+   L+A I + E  G++
Sbjct: 57  SGVTEICLAGAV-RRPAIEPGEIDAET-LPLVPVLQGALAAGDDGALRAIIGIFEQAGMN 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHE+ P+LL+  G      P    K D     +  EA+S  DVGQS     G+ +A+
Sbjct: 115 VRAAHEVAPDLLMAEGIPTEVKPGELDKPDAERGAEVVEAMSRADVGQSCAVRRGQAIAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD ML  +    +      G  G+L K  K  QD RADLP+IG +TV+   KAGL
Sbjct: 175 ENLFGTDWMLNALQSRPD------GTGGLLFKAPKPGQDRRADLPTIGVQTVELAAKAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           AGI LEAG  +VL +E V    +  G+F+ 
Sbjct: 229 AGIVLEAGGVIVLNQEDVVATCNRLGLFLW 258


>gi|84500831|ref|ZP_00999066.1| hypothetical protein OB2597_01812 [Oceanicola batsensis HTCC2597]
 gi|84390898|gb|EAQ03316.1| hypothetical protein OB2597_01812 [Oceanicola batsensis HTCC2597]
          Length = 268

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 81/274 (29%), Positives = 135/274 (49%), Gaps = 9/274 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M R  IIAGSG LP  +A           + +     + D  +       +     L   
Sbjct: 1   MPRTGIIAGSGGLPRLLADGLPEA----RVIAFEG-TATDVPEHRLSRHRIERLGALFDD 55

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    + R+V+AGA+ R      +   +   L  +  I Q + GG+ A+L+  + + E  
Sbjct: 56  LRAAGVDRVVLAGAMSRPALDPAVLDPVMRDL--APRILQAMQGGDDALLRLVVGIFEEQ 113

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G +V+GAHE +P+L  + G L    P+   + DI  A     AL  +DVGQ  V  GG  
Sbjct: 114 GFAVIGAHEALPDLTCEPGVLAGPGPSEATRADIARAEAILAALGPVDVGQGCVVSGGLC 173

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           + +E ++GTD+ML+ + +  +  R      G+L+K  K  QD+R D+P+IG +T +    
Sbjct: 174 LGIETLQGTDAMLRFVAETPDGLR--GRPGGILLKRPKPGQDLRVDMPAIGPETARAAAA 231

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AGL+GI + AG++L++++  +    D  G+F+  
Sbjct: 232 AGLSGIVVAAGRTLLIDRAALCAECDARGLFLLA 265


>gi|86138413|ref|ZP_01056987.1| hypothetical protein MED193_04896 [Roseobacter sp. MED193]
 gi|85824938|gb|EAQ45139.1| hypothetical protein MED193_04896 [Roseobacter sp. MED193]
          Length = 262

 Score =  248 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 83/270 (30%), Positives = 130/270 (48%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G+LP  V      +   P+I ++      D  D E     +       + L  
Sbjct: 2   LAVIAGTGLLPKEV---CDRQLKRPLICAMEG-SEPDCVDAEIS-FRIEHLGSFLARLKS 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA++R P   D       +L +  +I   +  G+   L+A + L+E  G +
Sbjct: 57  AGVTEVCLAGAVNRPPI--DPTAIDAATLPMVPVIQAALGAGDDGALRAVMGLIEQAGFT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  AHE+ PELL+  G      P    K D     +   A+S  D+GQ       + +A+
Sbjct: 115 LRAAHEVAPELLMAEGVASKFQPGALDKADADRGAEVVAAMSAADIGQCCAIRARQAIAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E   GT+ MLQ +    +      G+ G+L K  K  QD RADLP++G +TV+   +AGL
Sbjct: 175 ENTFGTNWMLQSLRQRPD------GQGGILFKAPKPGQDRRADLPAVGPQTVELAAQAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +GI LEAG  +VLE+E V    D  G+F+ 
Sbjct: 229 SGIVLEAGSVIVLEQEEVVAACDRLGLFLW 258


>gi|223935930|ref|ZP_03627845.1| protein of unknown function DUF1009 [bacterium Ellin514]
 gi|223895531|gb|EEF61977.1| protein of unknown function DUF1009 [bacterium Ellin514]
          Length = 361

 Score =  248 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 72/278 (25%), Positives = 124/278 (44%), Gaps = 13/278 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDE-PVIASVLNECSFDWQDFECR--ELPLGDFCVLRS 59
            L IIAG+  LP   A+ AR    +  V     NE      +       L +G    + S
Sbjct: 91  TLGIIAGNRSLPLIFARQARSMGIKKLVAVGFENETDPKLAELVDELIWLRVGQLSKMIS 150

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
                 + + V+ G I  +         ++  LR   ++++L       I  A  + L+ 
Sbjct: 151 AFTDRGVTQCVMVGQISPKNLF-----DLRPDLRAMTLLFKLKEKNAHTIFGAIANELKK 205

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            GV ++ A   +  L+           + D + D+    K A+ +S L+VGQ  V   G 
Sbjct: 206 DGVELIEAIPWLEPLMPAGEFRLGPKLSSDQQADLAFGYKIAKEISRLEVGQIVVVKNGT 265

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+EG EGTD  L R  +             + VK+ K + D+R D+P IG +T++  +
Sbjct: 266 VLAVEGFEGTDKCLARGGELAGKDG-----GAIAVKVAKEKHDLRFDIPCIGPQTLETCV 320

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            A ++ +ALEAG++L+LE E+ ++ A +  I +  +  
Sbjct: 321 AARVSVLALEAGRTLLLEPEVCEQLARKHKITLTTVSE 358


>gi|302383595|ref|YP_003819418.1| hypothetical protein Bresu_2486 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194223|gb|ADL01795.1| protein of unknown function DUF1009 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 281

 Score =  248 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 80/277 (28%), Positives = 134/277 (48%), Gaps = 3/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAG G LP+ +A+    +     I  +          +      + +   +   L 
Sbjct: 7   KLGLIAGGGELPHAIARRCDEEGRPLFIVRLDGFADHHLDRWPGATFGMAEIGGILKALK 66

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           Q     + +AG +  RP+ + L   +K +  +  +I    + G+ A+L+  + + E+ G 
Sbjct: 67  QQGCAAVCLAGTVS-RPDFKRLKPDLKGASVLPGIIAAA-TKGDDALLRKILSVFETEGY 124

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V GA +I+    +  G+LG   P  +   D+  A+  AE   ELD+GQ AV   G V+A
Sbjct: 125 GVEGADDILGGETLPGGALGAITPTPEHLSDLKKALHVAEKAGELDIGQGAVVCDGLVLA 184

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E  EGTD+ML R+ +   + R     + G L K  K  QD+R D+P IG +TV+    A
Sbjct: 185 VEAQEGTDAMLSRVAELPADLRGSPSARKGALGKAPKPIQDLRVDMPVIGTRTVEMAAAA 244

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           GLAGI       ++++++ +   AD  G+FV G  R 
Sbjct: 245 GLAGIGGLTDHLILIDRKSIIDTADRLGLFVWGETRS 281


>gi|292669899|ref|ZP_06603325.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
 gi|292648696|gb|EFF66668.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541]
          Length = 267

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 73/277 (26%), Positives = 137/277 (49%), Gaps = 12/277 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFE--CRELPLGDFCVLR 58
           M++L ++AG G LP   A+AAR +  E    ++L +   + Q+     R + +G    + 
Sbjct: 1   MEKLGLLAGVGHLPAACARAARAQGYEVHAIALLPDVDPELQEAASVYRAISIGSIAEIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L Q  I ++ + G + +         +I+    +  M+ QL +  +  I+   +  L 
Sbjct: 61  AYLRQEEIKKVTMIGKVTKELLFT---GAIQPDEMLRGMLMQLPNQNDDTIMMMFVGALM 117

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             GV+ +    ++  L+   G L + +P    + D+   ++ A  +  LD+GQ+AV    
Sbjct: 118 KIGVTPLDQTALIRPLMPAAGILTSRLPTDAERADMEYGLQMAREIGRLDIGQTAVVKNR 177

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD+ ++R       G ++A       K  K QQD R D+P++G  T++++
Sbjct: 178 AVMALEAIEGTDACIRRGGALAGGGAVVA-------KAAKPQQDSRFDVPTVGLDTIESL 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           + A  + + LEA K+L ++KE     A+  GI +  +
Sbjct: 231 VAAKASALVLEADKTLFIDKERAVALAEANGITIAAM 267


>gi|163795629|ref|ZP_02189595.1| glutamyl-tRNA synthetase [alpha proteobacterium BAL199]
 gi|159179228|gb|EDP63761.1| glutamyl-tRNA synthetase [alpha proteobacterium BAL199]
          Length = 282

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 86/275 (31%), Positives = 129/275 (46%), Gaps = 9/275 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD-FECRELPLGDFCVLRS 59
           M  L I+AG G LP  +A+AA        I + +     D  D F    L LG       
Sbjct: 9   MDGLGIVAGGGELPRRIAEAAASDGRPVFIVAFIGHTDADTVDGFPHAWLKLGQTGAALQ 68

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L       +V+AG + RRP++  L    +    +++        G+  +L   ++ +E 
Sbjct: 69  NLRDAACSDVVMAGPM-RRPSLSSLSLDRRSVAALAR--AGTRVFGDDGLLSVIVEEIER 125

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  VVG  +++   L   G L    P+RD + DI   +    AL   DVGQ+     G 
Sbjct: 126 DGFRVVGVDDLLGGYLASTGVLAGRAPDRDDEIDIARGIAVLRALGTADVGQAVAVQEGL 185

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E IEGTD+M+ R  D R +GR       VLVK  K  Q+ RAD P+IG  T     
Sbjct: 186 VLAVEAIEGTDAMIARAGDLRRDGR-----GPVLVKGSKPGQERRADRPTIGEGTAVAAA 240

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
            AG  GI +EAG +L++++    +  + AG+F+  
Sbjct: 241 AAGFRGIVVEAGATLIVDRVPTVRALEAAGLFLVA 275


>gi|254430214|ref|ZP_05043917.1| phosphatidate cytidyltransferase [Cyanobium sp. PCC 7001]
 gi|197624667|gb|EDY37226.1| phosphatidate cytidyltransferase [Cyanobium sp. PCC 7001]
          Length = 276

 Score =  245 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 88/273 (32%), Positives = 134/273 (49%), Gaps = 5/273 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
             L IIAG+G+LP  +++A        ++         + +  +  E            L
Sbjct: 4   PTLAIIAGAGVLPRMLSQALTASGRPHLVCRPHG---LEVEIDDAEEFYFERSISFFRSL 60

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            Q  I ++V+ G    RP   ++      +L  +  I   +  G+ A L+A  +++E  G
Sbjct: 61  EQRGIRQVVMVGKF-HRPRALNIMRFEGSTLMAAPRILASLRKGDDASLRALAEIIEELG 119

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + VVG  E+ P LL + G   + +P+   + D+  A    EA+S +DVGQ AV  GG  +
Sbjct: 120 LEVVGVEEVAPNLLPEPGLYASRLPSEADRADVERAAHIVEAISMVDVGQGAVVAGGLCL 179

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A E + GTD+ML  +   R  G   A +SGVL K  K QQD R DLP+IG  TV     A
Sbjct: 180 ATEALPGTDAMLDWVASSRALGPE-APRSGVLYKAPKLQQDRRMDLPAIGPTTVAKAAAA 238

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           GL+GIA EA  +L+L+ E     A+  G+F+  
Sbjct: 239 GLSGIAWEARGALLLDAERTMADAERLGLFLWA 271


>gi|99081244|ref|YP_613398.1| hypothetical protein TM1040_1403 [Ruegeria sp. TM1040]
 gi|99037524|gb|ABF64136.1| protein of unknown function DUF1009 [Ruegeria sp. TM1040]
          Length = 262

 Score =  245 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 87/270 (32%), Positives = 126/270 (46%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +IAG G LP  +   ARL     V A   +E      D   R   L         L  
Sbjct: 2   IALIAGRGALPAELI--ARLPERPMVCAMSGSEPDQVEADVTFR---LEQLGSFLEELKS 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             I ++ +AGA+  RP +         +L +  ++   ++ G+   L+A I +LE  G  
Sbjct: 57  KGITQVCMAGAVT-RPQIDPSAID-GATLPLVPVLQAAIAAGDDGALRAVIGILEQSGFE 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHEI P+LL+  G      P    K D   A   A  LS  D+GQ+     G+ +A+
Sbjct: 115 VKAAHEIAPDLLMPEGVPTKVKPGEIDKADAERAAVIAFGLSAADIGQACAVRSGQAIAI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD ML+ +    +      G+ G+  K  K+ QD RADLP+IG  TV    +AGL
Sbjct: 175 ETLFGTDWMLESLAQRPD------GQGGLFYKAPKAGQDRRADLPTIGPATVAGAARAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
            GI LEA   +VL++E V    D  G+F+ 
Sbjct: 229 NGIVLEAEGVIVLDREEVVAACDRHGLFLW 258


>gi|114764261|ref|ZP_01443489.1| hypothetical protein 1100011001356_R2601_25051 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543209|gb|EAU46226.1| hypothetical protein R2601_25051 [Roseovarius sp. HTCC2601]
          Length = 261

 Score =  244 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 79/275 (28%), Positives = 121/275 (44%), Gaps = 16/275 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  VA A     + P+I ++             R   +         L +
Sbjct: 2   LALIAGQGALPRAVADAC---PERPLICALEPHMPEGLA--VDRSFRIETLGSFLHWLRK 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + RI + G +  RP ++      +  L +     + +  G+   L+  I LLE  G  
Sbjct: 57  RGVTRICMVGRVA-RPEIRLTQLDWRTVL-MLPAFRRALKRGDDGALRIVIGLLEGAGFE 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVGAHE  P+LL   G L    P            + +      D GQ+ V   G V+A 
Sbjct: 115 VVGAHEAAPDLLPPSGVLTQVQPGAADIGAARLGDQVSREQGARDFGQACVIRDGAVLAR 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E   GTD+M+  +          A   GVL K  K  QD RADLP +G +T +  ++AGL
Sbjct: 175 EDEAGTDAMIDSL---------EAAAGGVLYKAEKPGQDHRADLPVVGPRTAEGAVRAGL 225

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +GI L AG  + +++  + +  D AG+F+   +R+
Sbjct: 226 SGIVLSAGGVMTVDRPAMIEALDAAGLFLWVRERD 260


>gi|260426988|ref|ZP_05780967.1| phosphatidate cytidyltransferase [Citreicella sp. SE45]
 gi|260421480|gb|EEX14731.1| phosphatidate cytidyltransferase [Citreicella sp. SE45]
          Length = 261

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 82/275 (29%), Positives = 126/275 (45%), Gaps = 17/275 (6%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  VA+A     + P+I ++             R   +         L +
Sbjct: 2   LALIAGQGALPRAVAEA---STERPLICALEPHAPEGLT--VDRSFRVERLGGFLHWLRR 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + RI + G + +RP ++      + +L +  M  + +  G+   L+  I LLE  G  
Sbjct: 57  KGVRRICMCGRV-QRPELRLSRLDWRTALMLPAM-RRALKRGDDGALRIVISLLEEQGFE 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +VGAHE  P LL   G      P+   +   L   + +      D GQ+ V  G  ++A 
Sbjct: 115 IVGAHEAAPSLLPPEGVPTRAQPDEAARAAALLGDRVSAEQGARDFGQACVIRGTELLAR 174

Query: 184 E-GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           E    GTD+M+           +   + GVL K  K  QD R DLP IG +T +  I+AG
Sbjct: 175 EDDATGTDAMID---------ALTGAEGGVLYKAEKPGQDTRVDLPVIGPRTARGAIRAG 225

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           LAGI + AG  +VL+++ V    DEAG+F+   +R
Sbjct: 226 LAGIVVSAGGVMVLDRDEVLSLLDEAGLFLWVRER 260


>gi|322434320|ref|YP_004216532.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX9]
 gi|321162047|gb|ADW67752.1| protein of unknown function DUF1009 [Acidobacterium sp. MP5ACTX9]
          Length = 288

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 68/266 (25%), Positives = 125/266 (46%), Gaps = 14/266 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-------QDFECRELPLGDFC 55
           RL +IAG+G  P+ +  AAR    + V+A++  E   +               + LG+  
Sbjct: 9   RLGLIAGNGRFPFLLLDAARAHGLDVVVAAIKEETDVEMDERAALDAGVRVHWMSLGELS 68

Query: 56  VLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASID 115
            L        + R V+AG +  +     +        R++K++  L +     +L A   
Sbjct: 69  KLIETFRAEGVTRAVMAGQVKHKQIFSSIRPDW----RLAKLLLNLRTRNTDMLLGAVAK 124

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVS 175
           +L   G+ ++ +   +  LL  VG +G  +P  D ++DI   M  A  ++  D+GQ+ V 
Sbjct: 125 VLGDEGIELISSTAYLEPLLATVGVMGARMPTEDERKDIEYGMTVARGIAGFDLGQTVVV 184

Query: 176 IGGRVVALEGIEGTDSMLQRIVDCRN---NGRILAGKSGVLVKMCKSQQDMRADLPSIGA 232
                VA+E +EGTD+ + R  +      +G     ++  +VK+ K  QDMR D+P +G 
Sbjct: 185 AAQACVAVEAMEGTDATIARAGELFRTLGDGDATLSRALTVVKVAKPNQDMRFDVPVVGV 244

Query: 233 KTVQNVIKAGLAGIALEAGKSLVLEK 258
            T+  +  AG   + +EAG++L+ ++
Sbjct: 245 PTIAAMKDAGATCLCVEAGRTLLFDR 270


>gi|209964507|ref|YP_002297422.1| hypothetical protein RC1_1195 [Rhodospirillum centenum SW]
 gi|209957973|gb|ACI98609.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 278

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 92/275 (33%), Positives = 147/275 (53%), Gaps = 10/275 (3%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD--WQDFECRELPLGDFCVLRS 59
            RL I+AG G LP  +A+       + V+ ++  +   D            +G    +  
Sbjct: 3   PRLAILAGGGDLPGRLAETCHSAGRDVVLVALEGQAEPDRLPSGLPTAWFRMGAVGAILD 62

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    +G I +AG + RRP++ +L    K +  ++++    ++ G+  +L+A   +LE+
Sbjct: 63  HLRTAGVGDIALAGRV-RRPSLGELRPDWKAAQILARV--GALALGDDGLLRAVACVLEA 119

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  VVG  +++ +LL+  G +G      + + DI   +  A AL  LDVGQ+ V   G 
Sbjct: 120 EGFRVVGVPDLMADLLMPEGPVGGLDAPAECRDDIGRGVAVARALGRLDVGQAVVVQQGI 179

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+ +E IEGTD+++ R  D +  GR       VLVK+ K QQD R DLP+IG +TV    
Sbjct: 180 VLGVEAIEGTDALIDRCGDLKREGR-----GPVLVKVRKPQQDRRLDLPTIGTETVARAA 234

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           +AG AGIA EAG +++L ++ V + AD AG+FV G
Sbjct: 235 RAGFAGIAAEAGSAILLGRDQVARAADAAGLFVVG 269


>gi|114797181|ref|YP_760484.1| hypothetical protein HNE_1780 [Hyphomonas neptunium ATCC 15444]
 gi|114737355|gb|ABI75480.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 282

 Score =  243 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 84/281 (29%), Positives = 137/281 (48%), Gaps = 3/281 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L +IAG G LP  +A+ A        +  +        + F+   + LG+   +   L
Sbjct: 3   EPLGLIAGLGELPVAIAENAVATGQGVYVLRLKGFEEPGLEKFQGSIVGLGEIGAVVDRL 62

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
                  +V AG +  RP+ ++L   ++    + ++I +    G+ A+L+  +   E +G
Sbjct: 63  KAAGCKEVVFAGNVS-RPDFKNLKLDLRGIALLPRVIAEA-RKGDDALLRVLVTEFEKHG 120

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+G+     +L+   G +    P+  + +D+    K A A   LD+GQ  V   G V+
Sbjct: 121 FHVIGSDAAHAQLIAPGGLIAGPAPSESMLQDVETGAKVAAAAGALDIGQGCVVCDGLVL 180

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           A+E  EGTD ML+R        R     + GVLVK  K  Q+ R DLP+ G  TV+    
Sbjct: 181 AVEAQEGTDEMLRRCAGLPEAIRGQPEARRGVLVKRPKPVQERRIDLPTTGVSTVELAAA 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGLAGIA+E G +L+L + L+++ A E GIF+ G   E  +
Sbjct: 241 AGLAGIAIEQGGALMLNRPLMEQRAAELGIFIFGFPAELGL 281


>gi|119386615|ref|YP_917670.1| hypothetical protein Pden_3908 [Paracoccus denitrificans PD1222]
 gi|119377210|gb|ABL71974.1| protein of unknown function DUF1009 [Paracoccus denitrificans
           PD1222]
          Length = 265

 Score =  243 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 86/274 (31%), Positives = 134/274 (48%), Gaps = 11/274 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M R+ +IAG G L   +A A     D+P++ ++           E +   L         
Sbjct: 1   MSRIALIAGEGSLAPAIAAAL----DQPLVYAL----DNLKPQVEAKPFRLERLVPFLDE 52

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    + + V AGAI RRP ++   F  +    + +++  + S G+ A L+A +D+ E  
Sbjct: 53  LADQGVTQAVFAGAI-RRPKIEPELFDARTLTIVPRILMGMQS-GDDAALRAVLDVFEEA 110

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+S+    +I+PEL+   G L    P++  ++D   A +    L  LD+GQ AV   G  
Sbjct: 111 GISICSVDQILPELVPGEGVLSG-EPSQRDQKDAARAAEIVAGLGALDIGQGAVVAQGLC 169

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+E + GT +ML+             G  GVL K  K  QD R DLP+IG  TV    +
Sbjct: 170 LAVEALPGTQAMLEFAKLHAGLKPDPKGAGGVLYKAPKPGQDRRIDLPTIGPDTVTQAAE 229

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AGLAGIA EAG  ++L++    + A  AG+F+  
Sbjct: 230 AGLAGIAWEAGSVILLDRAEALRRAQAAGLFLWA 263


>gi|289523521|ref|ZP_06440375.1| putative phosphatidate cytidyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503213|gb|EFD24377.1| putative phosphatidate cytidyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 271

 Score =  243 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 73/276 (26%), Positives = 127/276 (46%), Gaps = 15/276 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPL--GDFCVLRS 59
           K + +IAG G LP  +A+    K   PV+ S           +    + L       L  
Sbjct: 7   KTIALIAGDGQLPLEIARRLTCKGCPPVVYSFGEHAG-RLSKYALELVRLSGLSLGFLFD 65

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            +    I  I++AG + +               ++ +++ +L S  +  +L   +   E 
Sbjct: 66  DMRSRGIKEIIMAGVVPKTLMYHQGLQD----SKLRQLLKKLHSRDDHNLLANIVSAFEV 121

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G  VVG  +++ + L   G +       +   D+    K A+ L  L  GQ+ V     
Sbjct: 122 SGFLVVGYRDLISDWLATEGHIAGRYVTEEELDDVNYGRKVAKVLLPLSFGQTLVIHKRA 181

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           VVA+E +EGTD+ML R             + G+++KM +  QD R DLP++G KT+QN+ 
Sbjct: 182 VVAVEAMEGTDAMLLRAGSL--------TRGGIVLKMMRPDQDERYDLPTVGIKTLQNMS 233

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
            AGL  +A+EA +++++E +  K++A+   I V G+
Sbjct: 234 NAGLKCLAIEADRTIIIEPDEFKRYAESFDIAVLGV 269


>gi|196228849|ref|ZP_03127715.1| protein of unknown function DUF1009 [Chthoniobacter flavus
           Ellin428]
 gi|196227130|gb|EDY21634.1| protein of unknown function DUF1009 [Chthoniobacter flavus
           Ellin428]
          Length = 271

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 76/279 (27%), Positives = 129/279 (46%), Gaps = 15/279 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKND-EPVIASVLNECSFDWQDF--ECRELPLGDFCVLR 58
           K L IIAG+G+ P  +A+AAR        +A+  NE          +   + +G    + 
Sbjct: 5   KTLAIIAGNGVYPQAMARAARAAGVSRLAVAAFQNETDPALTALVDQVEWMRVGQLGKML 64

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           + L +      V++G I  +         ++  ++   ++ +L      +I  A  D ++
Sbjct: 65  NFLQKSGASHAVMSGQIHPKNLF-----DLRPDIKALIVLARLKRRNAESIFGAIADEMK 119

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           S GV ++ A   + E L   G +         + D+      A+  S LD+GQ+ V   G
Sbjct: 120 SVGVELLPATTYMEEHLAPAGLIAGPKLKTRDEEDLHYGFHIAKESSRLDIGQTVVVKNG 179

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E  EGT++ ++R       G  L  K  ++VK+ K  QD R D+P IG  T++  
Sbjct: 180 TVLAVEAFEGTNAAIKR-------GGELGRKDAMMVKVSKPNQDFRFDVPVIGPLTLEAA 232

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
            +A L  I +EAG +L+LEKE +   A E  I + G+  
Sbjct: 233 REARLRAIGVEAGYTLLLEKEKLAALAQEHRISIFGLKE 271


>gi|170749835|ref|YP_001756095.1| hypothetical protein Mrad2831_3435 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656357|gb|ACB25412.1| protein of unknown function DUF1009 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 287

 Score =  242 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 94/273 (34%), Positives = 139/273 (50%), Gaps = 4/273 (1%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L++IAG+G LP  VA++ R       + ++        +      + L D      +L +
Sbjct: 12  LVLIAGAGRLPELVAESLRRARRPFRVIALRGFTGPALRAGADATVDLLDLAATLKLLRR 71

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           +    +V AG + R         +   +LR  + +  +  GG+  +L+A++ L+E  G  
Sbjct: 72  WGPATVVPAGGVSRPS--PAAILNAGAALRNREALRAIAGGGDDRLLRAAVALVEEEGHR 129

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVG HE  P+LL   G LG   P+ +    I       +ALS  D+GQ+ V  G R++A+
Sbjct: 130 VVGVHEAAPDLLCPDGPLGRRAPDAEAAASIRTGRGVLDALSPYDLGQAVVLAGDRILAV 189

Query: 184 EGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           EG EGTD ML R         G   A  S VLVK  K  QD R DLP+IGA+TV+N  +A
Sbjct: 190 EGPEGTDRMLARARALGRRPFGFGRAMPSTVLVKAPKVGQDRRIDLPAIGARTVRNAARA 249

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           G  G+ALEAG +LV+++      AD  G+FV G
Sbjct: 250 GCVGLALEAGGTLVIDRAATAAEADRLGLFVVG 282


>gi|254489041|ref|ZP_05102246.1| conserved hypothetical protein [Roseobacter sp. GAI101]
 gi|214045910|gb|EEB86548.1| conserved hypothetical protein [Roseobacter sp. GAI101]
          Length = 263

 Score =  242 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 81/271 (29%), Positives = 126/271 (46%), Gaps = 13/271 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP+ VA A   + D P++           +    +   L     L   L  
Sbjct: 2   LALIAGGGGLPHRVASA---QADRPLVCGYEGVAVEGVE--VDQTFRLETLGSLIKSLQD 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + ++ + GAI  RP+           + +     + +  G+   L+  ID+ E+ G +
Sbjct: 57  QGVTQVCLCGAIA-RPSFDPSKLDALT-MPLVPAFQKALGAGDDGALRVLIDIFETSGFT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHE+ P+LL   G L T  P+  + +D   A +    L+ +D+GQ  V  GG+V  +
Sbjct: 115 VRAAHELAPDLLASPGVLSTKAPDTQMTQDAARAAQVVATLAPMDIGQCCVVGGGQVYGI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  + D   +       S +L K  K  Q    D+P+IG  T++   KAGL
Sbjct: 175 ETIGGTDHLLATLPDRVQSA------SAILFKGPKPDQSRLVDMPTIGPATLEAAHKAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AGI + AG  +VLE E  K  AD+ G+ +  
Sbjct: 229 AGIVIVAGNVIVLEPERCKTLADDLGLVLWS 259


>gi|15606496|ref|NP_213876.1| hypothetical protein aq_1276 [Aquifex aeolicus VF5]
 gi|2983714|gb|AAC07277.1| putative protein [Aquifex aeolicus VF5]
          Length = 305

 Score =  241 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 14/274 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           +++ +IAG G LP    K+A  K  E +   V     F+       ++  G    L  +L
Sbjct: 42  EKIGLIAGKGKLPLEFKKSAVQKGYEVITIGVEGITDFEC----DYKVSFGKVGKLIKLL 97

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            +     +V+ G  + +  + DL       L   +++ +        ++K  +D +E  G
Sbjct: 98  EKEEAYSLVMLGKFEHKLALTDLFH---FDLTGIQILSRAKDKRPETLIKTFMDYMEKRG 154

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
              +     +  +L + G +    P+     + L A + A+ ++ LDVGQ+ V     VV
Sbjct: 155 FKFIDPKPFLEGILAEKGPMTKKEPDNKTLEEALWAFEIAKTIASLDVGQTIVVKDKAVV 214

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGT   ++R       G  +AGK   ++K+ +  QD R D+P++G  T++ + + 
Sbjct: 215 AVEAMEGTQETIRR-------GGKIAGKGCTVIKVARRNQDYRIDVPTVGEDTLRVMKEV 267

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           G   + LE GK  +++KE   K AD  GI V GI
Sbjct: 268 GAKALFLEEGKVFIVDKENFLKEADRLGICVYGI 301


>gi|126726878|ref|ZP_01742717.1| hypothetical protein RB2150_03159 [Rhodobacterales bacterium
           HTCC2150]
 gi|126703836|gb|EBA02930.1| hypothetical protein RB2150_03159 [Rhodobacterales bacterium
           HTCC2150]
          Length = 263

 Score =  241 bits (616), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 82/272 (30%), Positives = 141/272 (51%), Gaps = 12/272 (4%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
            + IIAGSG LP  +  +A       V+  +    +         E        L + LH
Sbjct: 2   TVGIIAGSGSLPEML--SAETAG---VLVRLKGVATTANSKNTIIEAEFERLGELFAALH 56

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + ++V AGA+ +RP +         +++++  I   ++ G+  +L+  + +    G 
Sbjct: 57  DEGVTKLVFAGAM-QRPALDPARLD-STTMQLAPRIMAALAKGDDGLLREVLAIFTEAGF 114

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            +V AH+++P+LLV  G +     ++ ++ D L  ++   ALS LDVGQ  V   G+ + 
Sbjct: 115 EIVAAHDLLPDLLVMDGIMCGAELDK-LQNDALRGIEILAALSPLDVGQGCVVSNGQCIG 173

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E ++GTD +L+ + + R    +   K GVLVK  KS QD+R D+P+IG  T++ V  AG
Sbjct: 174 IETLQGTDQLLKFVQNTR----VQLPKGGVLVKRTKSGQDLRIDMPTIGPATIKAVSDAG 229

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           L GI L+AG  +VL++    + AD+AGI +  
Sbjct: 230 LTGICLQAGHVMVLDRAQTIQLADDAGITIWA 261


>gi|83953539|ref|ZP_00962260.1| hypothetical protein NAS141_04928 [Sulfitobacter sp. NAS-14.1]
 gi|83841484|gb|EAP80653.1| hypothetical protein NAS141_04928 [Sulfitobacter sp. NAS-14.1]
          Length = 263

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 76/271 (28%), Positives = 125/271 (46%), Gaps = 13/271 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  VA A       P+I +                  L     L + L  
Sbjct: 2   LALIAGGGGLPQRVAGALADA---PLICAYEGTTPVGL--VPDLVFRLETLGTLLAELTA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + ++   GA+  RP+           L +  +  Q ++ G+   L+A +D+ ++ G++
Sbjct: 57  RGVTQVCFCGAVA-RPSFDPSKLDAAT-LPLVPVFQQALAAGDDGALRALVDIFQTAGLT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV AH++ P+L+ + G L    P+  ++ D          L+ +DVGQ  V   G+V+ +
Sbjct: 115 VVAAHDLAPDLMAREGVLSQRQPDAQMRDDAARGAALVRCLAPMDVGQCCVVGQGQVMGI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  + D   +       S VL K  KS Q    D+P+IG  T++   +AGL
Sbjct: 175 EAIGGTDHLLSTLPDRARSA------SAVLFKGPKSGQSHLVDMPTIGPDTLRRAHEAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AG+ +EAG  ++LE +     ADE  + +  
Sbjct: 229 AGVVIEAGSVILLEPDACVALADELDLVLWA 259


>gi|258592397|emb|CBE68706.1| conserved hypothetical protein [NC10 bacterium 'Dutch sediment']
          Length = 266

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 80/276 (28%), Positives = 132/276 (47%), Gaps = 13/276 (4%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQD--FECRELPLGDFCVLR 58
           M+RL IIAG G LP   A+ AR++  + V  +V    S D  D       + +G    L 
Sbjct: 1   MERLGIIAGGGPLPIVAARDARMQGLKVVAVAVEEAASADLADEVDAICWVGVGQLGRLI 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
           S L +  +   V+ G +            +   L      W+L       IL    DLL 
Sbjct: 61  SALKREQVTDAVMLGKVPLDLLFSRAKIDLAGLLFY----WKLKDRRGDTILAGVGDLLA 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+++      +  +L++ G L    P  + ++DI    + A ++++L +GQ+ V    
Sbjct: 117 EEGITLHDCRRFLSSILLRKGVLTARAPRLEEQQDIDFGRELARSMAQLRIGQTVVVKRR 176

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E IEGTD+ ++R       G  L  +  V+VK+ +  +DMR DLP IG +TV  +
Sbjct: 177 TVLAVEAIEGTDAAIRR-------GGTLGNREVVVVKVGRPHKDMRFDLPVIGPETVAAL 229

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
             AG   +AL+A ++L+L++E V   AD  G+ +  
Sbjct: 230 EDAGATALALDADQTLILDREKVVARADRLGLTIVA 265


>gi|188584403|ref|YP_001927848.1| hypothetical protein Mpop_5219 [Methylobacterium populi BJ001]
 gi|179347901|gb|ACB83313.1| protein of unknown function DUF1009 [Methylobacterium populi BJ001]
          Length = 282

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 95/277 (34%), Positives = 141/277 (50%), Gaps = 5/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L ++AG+G LP  VA +         + +V        +      + L D      IL
Sbjct: 6   RPLALVAGAGRLPELVAASLDRARRPFRVLAVRGFTERAMRRRADAVVDLLDIPGTLRIL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
             +    +V AG +  RP+   L  +   ++R   ++  L +GG+  +L+A + LLE  G
Sbjct: 66  KDWAPAAVVPAGGVT-RPSPAALL-NAAHAVRNRDILKSL-AGGDDRLLRAVLSLLEENG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+G HE+ P+LL + G LG   P+ D    I        ALS  DVGQ+AV    R++
Sbjct: 123 HQVLGVHEVAPDLLGRPGRLGRLAPDADAALSIATGRAMLGALSPFDVGQAAVVAAERII 182

Query: 182 ALEGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           A+EG EGTD ML R         GR    K  VLVK+ K  QD+R DLP+IG +TV    
Sbjct: 183 AVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVHRAA 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AG AG+A+ AG +LV++       AD AG+F+ G++
Sbjct: 243 EAGCAGLAIGAGHTLVIDGPETVAAADAAGLFLIGVE 279


>gi|269792896|ref|YP_003317800.1| hypothetical protein Taci_1287 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100531|gb|ACZ19518.1| protein of unknown function DUF1009 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 269

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 67/275 (24%), Positives = 122/275 (44%), Gaps = 15/275 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLRSIL 61
           + +IAG G LP  +A+      + PVI S   +       +    + L   D       +
Sbjct: 3   VALIAGEGDLPVEIARRLTDLGEPPVIYSFREKAG-GISKYALEVVSLHRLDLGGTLMDM 61

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
               + R+ +AG + +    Q          R+  ++  L    + ++L A +   E  G
Sbjct: 62  ASRGVQRVYMAGVVPKTLLYQPAMLD----QRVKDLVEGLRDRDDHSLLGAVVRAFEEAG 117

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
           + V    +++ +L+  +G +    P      D+   +  A  +  L  GQ+ V     VV
Sbjct: 118 MEVRSYRDLILDLMAPLGHVAGPEPFPWQLSDVEYGVSVARRIVGLSFGQTVVVHRRSVV 177

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGTD+ L R             + G +VKM ++ QD R D+P++G  T++ +  A
Sbjct: 178 AVEAMEGTDATLLRAGSL--------CRGGTVVKMMRADQDERYDIPTVGPHTLKRMASA 229

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
            L  +A+EAG++++LE ++    A   GI V G+ 
Sbjct: 230 SLKCLAVEAGRTIILEPQVFVPMAQSEGICVLGVS 264


>gi|254477136|ref|ZP_05090522.1| conserved hypothetical protein [Ruegeria sp. R11]
 gi|214031379|gb|EEB72214.1| conserved hypothetical protein [Ruegeria sp. R11]
          Length = 253

 Score =  238 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 75/256 (29%), Positives = 123/256 (48%), Gaps = 10/256 (3%)

Query: 18  AKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDR 77
           A+ A    D P++ ++        +        L       + L    +  I +AGA+ R
Sbjct: 3   AELAHRLKDRPLVCAMRGSEPDHIE--AELTFRLEQLGSFIARLTASGVTEICLAGAV-R 59

Query: 78  RPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQ 137
           RP +       +  + +  ++   ++ G+   L+A I + E  G+SV  AHE+ P+LL+ 
Sbjct: 60  RPAIDPSEIDAET-MPLVPILQGAIAAGDDGALRAIIGIFEQAGLSVRAAHEVAPDLLMG 118

Query: 138 VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIV 197
            G      P    + D     +  EA+S  DVGQS     G+ +++E + GTD ML+ + 
Sbjct: 119 EGVPTEIQPGELDRPDADRGAEVVEAMSRADVGQSCAIRRGQAISVENLFGTDWMLRALA 178

Query: 198 DCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
              +      G  G+L K  K  QD RADLP+IG +TV+   +AGL+GI LEAG  +VL 
Sbjct: 179 QRPD------GTGGLLFKAPKPDQDRRADLPTIGPQTVELAAQAGLSGIVLEAGGVIVLS 232

Query: 258 KELVKKHADEAGIFVC 273
           ++ V    +  G+F+ 
Sbjct: 233 QDEVIAACNRLGLFLW 248


>gi|259416465|ref|ZP_05740385.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259347904|gb|EEW59681.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 262

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 86/270 (31%), Positives = 125/270 (46%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +IAG G LP  +   ARL     V A   +E      D   R   L         L  
Sbjct: 2   IALIAGRGALPAELI--ARLPERPMVCAMAGSEPDLAEADVTFR---LEQLGSFLEQLKS 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA+  RP +          L +  ++   ++ G+   L+A I +LE  G +
Sbjct: 57  QGVTEVCLAGAVT-RPQIDPGAIDAAT-LPLVPVLQAAIAAGDDGALRAVIGILEQSGFA 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHEI P+LL+  G      P    K D   A   A  LS  D+GQ+     G+ +A+
Sbjct: 115 VKAAHEIAPDLLMDEGVPTKVQPGEIDKADAERASVIAFGLSAADIGQACAVRSGQAIAI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD ML  + +  +      G+ G+  K  K+ QD RADLP+IG  TV+    AGL
Sbjct: 175 ETLFGTDWMLASLANRPD------GQGGLFYKAPKAGQDRRADLPTIGPATVEGAAMAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
            GI LEA   +VL++E V    D  G+F+ 
Sbjct: 229 NGIVLEAEGVIVLDREEVIAACDRRGMFLW 258


>gi|126737633|ref|ZP_01753363.1| hypothetical protein RSK20926_18367 [Roseobacter sp. SK209-2-6]
 gi|126721026|gb|EBA17730.1| hypothetical protein RSK20926_18367 [Roseobacter sp. SK209-2-6]
          Length = 262

 Score =  236 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 82/270 (30%), Positives = 119/270 (44%), Gaps = 13/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G+LP  VA     +     +   L     D  D E     L  F      L  
Sbjct: 2   LALIAGRGLLPKEVAARLPER----ALICALAGSEPDCVDAEI-TFRLEHFGSFLERLKA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA+  RP +          L +       ++ G+   L+A + +LE  G +
Sbjct: 57  AGVTEVCLAGAVT-RPQIDPTAIDAAT-LPLVPAFQAALAAGDDGALRAVMAILEQAGFT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  AHE  P+LL+  G      P      D     +   A+S  D+GQS      + +A+
Sbjct: 115 LRAAHEAAPDLLMGEGVFTRVQPGELDHADAARGAEIVAAMSAADIGQSCAVRACQAIAV 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E   GTD ML  +    +      G+ G++ K  K  QD RADLP+IG +TV     AGL
Sbjct: 175 ENAFGTDWMLHSLSARPD------GEGGLMFKAPKPGQDRRADLPTIGPETVAAAATAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +GI LEAG  LVL +E V    D  G+F+ 
Sbjct: 229 SGIVLEAGGVLVLNQEEVIAACDRHGLFLW 258


>gi|289548057|ref|YP_003473045.1| hypothetical protein Thal_0283 [Thermocrinis albus DSM 14484]
 gi|289181674|gb|ADC88918.1| protein of unknown function DUF1009 [Thermocrinis albus DSM 14484]
          Length = 260

 Score =  236 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 72/273 (26%), Positives = 129/273 (47%), Gaps = 14/273 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           ++ +IAGSG LPY   K+A+ K +E  +  V +             LPLG    L   L 
Sbjct: 2   KICLIAGSGSLPYIFLKSAQEKGEEVFVVGVRHVTDIQ----AHETLPLGKVGSLVKTLE 57

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  I  IV+ G  + +     L   +       +++ +        ++K  +  LES G 
Sbjct: 58  RRGIKHIVMLGKFEHKLLFSHL---LTLDELAVRILRKSPDKRPQTLIKTMMQELESMGF 114

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
             +     + ++L   G +    P+     D L  M  A+AL+++DVGQ+ V     VV+
Sbjct: 115 QFLDPRPYLEDILAPSGVINRVRPSDSAMEDGLFGMPIAKALADMDVGQTIVVKEKSVVS 174

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGT   ++R          + GK   ++K+ +  QD R D+P++G +T++ + K  
Sbjct: 175 VEAMEGTQETIERAGR-------IGGKGCRVIKVARKNQDFRIDVPTVGPQTLELMRKIK 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
              + LEA K  +++KE + + AD+ GI + G+
Sbjct: 228 ADALFLEANKVYMVDKEKMLRLADKWGIAIYGL 260


>gi|83942320|ref|ZP_00954781.1| hypothetical protein EE36_14807 [Sulfitobacter sp. EE-36]
 gi|83846413|gb|EAP84289.1| hypothetical protein EE36_14807 [Sulfitobacter sp. EE-36]
          Length = 263

 Score =  235 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 74/271 (27%), Positives = 123/271 (45%), Gaps = 13/271 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  VA A       P+I +         +        L     L + L  
Sbjct: 2   LALIAGGGGLPQRVAGALADA---PLICAYEGTTPVGLE--PDLVFRLETLGTLLAELTA 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
            N+ +    GA+  RP+           L +  +  + ++ G+   L+A +D+ ++ G++
Sbjct: 57  RNVTQACFCGAVA-RPSFDPSKLDAAT-LPLVPVFQKALAAGDDGALRALVDIFQTAGLT 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV AH++ P+L+ +   L    P+  ++ D          L+ +DVGQ  V   G+V+ +
Sbjct: 115 VVAAHDLAPDLMARERVLSQRQPDAQMRDDAARGAALVRCLAPMDVGQCCVVGQGQVMGI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  + D           S VL K  K  Q    D+P+IG  T++   +AGL
Sbjct: 175 EAIGGTDHLLSTLPDRARLA------SAVLFKGPKPGQSHLVDMPTIGPDTLRRAHEAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AG+ +EAG  ++LE +     ADE  + +  
Sbjct: 229 AGVVIEAGSVILLEPDACVALADELDLVLWA 259


>gi|148261434|ref|YP_001235561.1| hypothetical protein Acry_2449 [Acidiphilium cryptum JF-5]
 gi|146403115|gb|ABQ31642.1| protein of unknown function DUF1009 [Acidiphilium cryptum JF-5]
          Length = 287

 Score =  235 bits (601), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 97/278 (34%), Positives = 143/278 (51%), Gaps = 8/278 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILH 62
           L I+AG G LP  VA AAR       I ++      +    F    + LG        L 
Sbjct: 9   LGIVAGGGRLPGQVAAAARAAGRGVFIVALDAHADPEVVAPFPHETIRLGAVGAAIDALK 68

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     IV+AG + RRP++ DL      + R+   I +    G+   L A + +L   G 
Sbjct: 69  RAGCREIVLAGPV-RRPSLFDLRPDAVGA-RLLARIGRAAFAGDDGFLAAIVRVLGEEGF 126

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V+GAHE++ E+    G L    P+     DI   +    AL  +DVGQ AV   G V+A
Sbjct: 127 TVLGAHEVISEVFAPEGLLSGAAPDAAALADIARGIAVVRALGAVDVGQGAVVQQGIVLA 186

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E  EGTD+ML R    R       G  GVLVK+ K  Q+ RADLP++G +TV+  ++AG
Sbjct: 187 VEAAEGTDAMLARAATLRR-----PGPGGVLVKLVKPGQERRADLPTLGVRTVRGAVEAG 241

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           L GIA EA  ++++++E + + A+ AG+F+ GID   A
Sbjct: 242 LRGIAFEAEGAILMDREAMVREAEAAGLFLLGIDPGAA 279


>gi|260655095|ref|ZP_05860583.1| conserved hypothetical protein [Jonquetella anthropi E3_33 E1]
 gi|260630206|gb|EEX48400.1| conserved hypothetical protein [Jonquetella anthropi E3_33 E1]
          Length = 272

 Score =  234 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 76/279 (27%), Positives = 134/279 (48%), Gaps = 18/279 (6%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG---DFCVLRS 59
           +L ++AG G LP  + +  R + +      +L++ S  W D  C    +     F V+ +
Sbjct: 4   KLALVAGEGRLPLAILQGLRRRGETDPAVFLLSDDSAPWTDLGCAFKSVKNPLAFGVILT 63

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISK-MIWQLVSGGNAAILKASIDLLE 118
            +    + R+++AG + ++     L +  K+    S+  + +     + ++L A +  +E
Sbjct: 64  SMRLAGVRRLILAGRVPKK-----LMYDRKNMDETSRSTLAEASERNDHSLLGAVVRTIE 118

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
            +G+ VV   ++VPE++V  G + +  P+ +   D        E +  L  GQS V    
Sbjct: 119 RFGIRVVPYEDVVPEMVVSEGQVSSGRPSENEMADAQYGWSVLEKILPLSFGQSLVVADK 178

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+A+E +EGTD M++R       G        VLVK  +  QD R DLP +G +T+  +
Sbjct: 179 SVIAVEAMEGTDGMIERAGALAGRG--------VLVKGMRRDQDRRYDLPVVGLRTLHKM 230

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
             AGL  + L+AG  L+L+ E     AD+ GI V G+  
Sbjct: 231 ADAGLTALFLQAGSVLLLD-ESFVSEADKLGIAVWGVSA 268


>gi|312142805|ref|YP_003994251.1| protein of unknown function DUF1009 [Halanaerobium sp.
           'sapolanicus']
 gi|311903456|gb|ADQ13897.1| protein of unknown function DUF1009 [Halanaerobium sp.
           'sapolanicus']
          Length = 276

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 73/276 (26%), Positives = 144/276 (52%), Gaps = 14/276 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRE--LPLGDFCVLR 58
           M +  ++AG G +P   A+ A  + ++ ++  +  E +  + D +C+E  + L DF +L 
Sbjct: 1   MAKTALLAGWGDMPRLWAERAEARGEDFIVIKIAEEITAQFSDLDCKEQTVNLADFNLLL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            +L +  I R+++ G I +    +D    +K  +    ++  L +  +  ILKA +D   
Sbjct: 61  ELLKKEGISRLILLGKIHKEKLFKDFEADLKLKM----LLASLPNFNDDTILKALVDQFI 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
             G+ V+  H ++ ++L + G L    P+  +K+++    K+A  L   D+GQ+A+   G
Sbjct: 117 ELGIDVLAQHYLLEDILAKRGILAG-DPSAKLKKELAYGFKTAYNLGRFDIGQTALVKDG 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE +EGTD  ++R            G   V+ K  K +QD R D+P++G  T++ +
Sbjct: 176 AVMALEAVEGTDEAIKRAAK-------FGGPGFVMAKCSKKEQDFRFDIPTVGLNTLELL 228

Query: 239 IKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           ++   AG+ +EA K+ +L++    + A++ G+ V  
Sbjct: 229 LEHQAAGLVIEAEKTFMLDQAEFCRRAEKEGLVVAA 264


>gi|326404914|ref|YP_004284996.1| hypothetical protein ACMV_27670 [Acidiphilium multivorum AIU301]
 gi|325051776|dbj|BAJ82114.1| hypothetical protein ACMV_27670 [Acidiphilium multivorum AIU301]
          Length = 287

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 97/278 (34%), Positives = 144/278 (51%), Gaps = 8/278 (2%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILH 62
           L I+AG G LP  VA AAR       I ++      +    F    + LG        L 
Sbjct: 9   LGIVAGGGRLPGQVAAAARAAGRGVFIVALDAHADPEVVAPFPHETIRLGAVGAAIDALK 68

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +     IV+AG + RRP++ DL      + R+   I +    G+   L A + +L   G 
Sbjct: 69  RAGCREIVLAGPV-RRPSLFDLRPDAVGA-RLLARIGRAAFAGDDGFLAAIVRVLGEEGF 126

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +V+GAHE++ E+    G L    P+     DI   +    AL  +DVGQ AV   G V+A
Sbjct: 127 TVLGAHEVISEVFAPEGLLSGAAPDAAALADIARGIAVVRALGAVDVGQGAVVQQGIVLA 186

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E  EGTD+ML R    R       G  GVLVK+ K  Q+ RADLP++G +TV+  ++AG
Sbjct: 187 VEAAEGTDAMLARAATLRR-----PGPGGVLVKLVKPGQERRADLPTLGVRTVRGAVEAG 241

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFA 280
           L GIA EA  ++++++E++ + A+ AG+F+ GID   A
Sbjct: 242 LRGIAFEAEGAILMDREVMVREAEAAGLFLLGIDPGAA 279


>gi|254459479|ref|ZP_05072895.1| conserved hypothetical protein [Rhodobacterales bacterium HTCC2083]
 gi|206676068|gb|EDZ40555.1| conserved hypothetical protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 266

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 82/276 (29%), Positives = 128/276 (46%), Gaps = 11/276 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M RL I++G+G LP  +A A        ++ S         +  E           L + 
Sbjct: 1   MSRLAILSGNGALPQRLADAQPDA----ILVSFAGVAHDLQRASEVHAF--EKMGTLFAS 54

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L   N+  IV+AGA+ R P       ++   L  +  +   + GG+ A+L+  I + E  
Sbjct: 55  LKAQNVSEIVMAGAMSRPPLDPSAFDAVMTGL--APRLIAAMQGGDDALLRLVIAIFEEQ 112

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  V GAHEI P L V  G L     +     D+   +   E LS +DVGQ  V   G  
Sbjct: 113 GFRVRGAHEIDPTLTVDAGLLCGAALSEITGNDVAKGIAILETLSPMDVGQGVVVENGLC 172

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           + +E ++GTD++L  +     + R +    GV VK  K  QD+R D+P+IG  T+  +  
Sbjct: 173 LGIETLQGTDALLNFVAATPLHLRKM---GGVFVKAPKRGQDLRVDMPTIGPDTITAMKT 229

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           AGL+ + + +G  L+LE +   + A +A I V   D
Sbjct: 230 AGLSTLVIASGAVLLLECDDTIRLAKQANITVFARD 265


>gi|225164360|ref|ZP_03726625.1| protein of unknown function DUF1009 [Opitutaceae bacterium TAV2]
 gi|224801040|gb|EEG19371.1| protein of unknown function DUF1009 [Opitutaceae bacterium TAV2]
          Length = 291

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 68/279 (24%), Positives = 127/279 (45%), Gaps = 16/279 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----QDFECRELPLGDFCVL 57
           + + +++G G+ P  VA++ R       + +   E   +      + E R + +G    +
Sbjct: 25  RPIALLSGKGLYPQLVARSIRAAGIPLRLVAFDEETPQELIATFPEAERRTILVGQLGKM 84

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
              + +   G  ++AG I  R   + L       L+   ++ +L       I  A    +
Sbjct: 85  LKAIRELRAGYALMAGQITPRRLFKGLH----PDLKALAILARLKRRNAETIFGAIASEI 140

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E+ GV ++ A   +   L   G +         +  +   +  A   + LD+GQ  V   
Sbjct: 141 EALGVRLLDARCFIDAHLATPGVMTRGK-FPIERESVDHGLHIARECARLDIGQGCVVRK 199

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G V+A+E  EGTD ML+R+ + + +         V VK+ K+ QD R D+P  G +T++N
Sbjct: 200 GTVLAVEAYEGTDPMLRRVGEFKTD-------EAVFVKVVKTAQDYRFDVPCFGLQTLEN 252

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +  +G+   A+EAG+ ++L+K  V   A E GI + G++
Sbjct: 253 MHASGIKAAAIEAGRVIILDKPAVLARAHELGISLLGVE 291


>gi|45601659|gb|AAS71139.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 260

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 54/254 (21%), Positives = 116/254 (45%), Gaps = 13/254 (5%)

Query: 24  KNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLRSILHQYNIGRIVVAGAIDRRPNV 81
             ++P+  S++ E  F    +E R +P+       L  +  ++N+ R+++ G + +    
Sbjct: 2   AGEDPIFFSII-ESDFHVGMYEDRNIPIHIVKIGTLLKLCKRHNVDRLLLLGKVKKEIIF 60

Query: 82  QDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSL 141
           ++L    K  L+   ++ ++++  + +I K   D      ++++     +  L +  G  
Sbjct: 61  KNL----KFDLKAIALLARMINKHDYSIFKTVADEFAKEKITIISQKTFLQSLFLPEGRF 116

Query: 142 GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN 201
                 +    DI   M  AE ++ LD+GQ+ V +   V+A+E +EGTD  + R      
Sbjct: 117 TKKPLTQKELEDIAFGMDYAEKMAGLDIGQTVVVLDKSVLAVEAVEGTDLAICRGGSFAK 176

Query: 202 NGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELV 261
            G+        + K  K  QD R DLP++G  T++ + +     +AL  G+++++  +  
Sbjct: 177 KGK------ATVCKSSKPNQDHRFDLPTVGENTLKTMYENNCGTLALRTGETIIVHPKEF 230

Query: 262 KKHADEAGIFVCGI 275
              A++  I +  I
Sbjct: 231 INLAEKFKINILSI 244


>gi|110679827|ref|YP_682834.1| hypothetical protein RD1_2597 [Roseobacter denitrificans OCh 114]
 gi|109455943|gb|ABG32148.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 263

 Score =  233 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 82/271 (30%), Positives = 124/271 (45%), Gaps = 13/271 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +I G G LP  VA A   +   P++  +                 L       + L +
Sbjct: 2   LALITGRGGLPARVAAA---QTARPLVCVLEGFAPEGLD--ADITFRLEHLGSFIAQLKE 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +   GAI+R P   D       ++ +   + Q +  G+ A L+A + L E  G  
Sbjct: 57  RGVTSVCFCGAIERPPF--DPAALDGATVPLVPTLMQAMGAGDDAALRAVMALFEQQGFE 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  AH + P++L   G L    P+  ++ DI  A    +ALS +DVGQ  V   G V  +
Sbjct: 115 IAAAHVLAPDILAPEGVLSEAQPDTQMQADIARADDVLQALSPVDVGQGCVVGQGLVWGI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  +       R       VLVK  K+ QDMRADLP+IG  TV+    AGL
Sbjct: 175 ETIGGTDHLLATLPTAVRRAR------AVLVKAPKTGQDMRADLPAIGPDTVEAAGAAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AGI ++AG  ++L+ E     A++ G+ +  
Sbjct: 229 AGIVIQAGAMILLDPEATIAGANKTGLVLWS 259


>gi|294084075|ref|YP_003550833.1| hypothetical protein SAR116_0506 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292663648|gb|ADE38749.1| protein of unknown function DUF1009 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 273

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 69/278 (24%), Positives = 133/278 (47%), Gaps = 10/278 (3%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           M +L IIAG G +P  +  AA     + V+  + ++   D+  F+   + L +    R +
Sbjct: 1   MTKLAIIAGQGHIPVDIGHAAIANGHDVVMMPLEHQADADYSSFQTEPIGLANIGRTRKL 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           +  +    +++ G + R P        ++  +   K++ +++  G+   L+   +     
Sbjct: 61  MLDHACDAMIMVGKVRRPPI-----GDLRPDVDGVKLLGKMLMRGDDQTLRLVAEYFAEV 115

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ V+ A +I+P+  + +G +      +  + DI       +++   D+GQ  V   GR+
Sbjct: 116 GIKVMAASDIMPDRHLAIGLVAGSRLGKQNRADIDLGCAVLDSIGSHDIGQGVVVQDGRI 175

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +++E  EGTD+ML R  D  +          V VK+ KS QD R D+P IG +TV+ V+ 
Sbjct: 176 ISIEAAEGTDAMLARSADLIDK----TASGAVFVKIPKSAQDKRLDIPFIGLETVKAVVD 231

Query: 241 AGLAGIALEAGKSLVLE-KELVKKHADEAGIFVCGIDR 277
           AG+  +A+EAG  ++ + +E V        I + G+  
Sbjct: 232 AGIRVMAIEAGGVMLADPREQVIAACIAGNISLVGLKP 269


>gi|126736311|ref|ZP_01752053.1| hypothetical protein RCCS2_00929 [Roseobacter sp. CCS2]
 gi|126714132|gb|EBA11001.1| hypothetical protein RCCS2_00929 [Roseobacter sp. CCS2]
          Length = 293

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 85/293 (29%), Positives = 126/293 (43%), Gaps = 31/293 (10%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP  +          P+I ++         D   R   +       + L  
Sbjct: 2   LALIAGTGDLPPALVARL---PTRPLICAMDGFRPALTPDVTFR---IEQLGSFLADLKT 55

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGA+ R P   D       +  +   I   +  G+   L+A I + E  G+S
Sbjct: 56  RGVTDVCMAGAVTRPPI--DPTAIDAATQPLVTRIMDAIGQGDDGALRAIIAIFEEAGLS 113

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AH+I P+LL Q G L       D ++D + A  +   +   DVGQ+ +   GRV+A 
Sbjct: 114 VKPAHQIAPDLLPQTGVLSRKPVTIDNRQDAVTAEHTIAEMGRADVGQACIVRNGRVLAR 173

Query: 184 EGIEGTDSMLQRIVDCRN-----------------------NGRILAGKSGVLVKMCKSQ 220
           EG  GTD+ML R     +                        G     +  +L K  K  
Sbjct: 174 EGQAGTDAMLARFAPSDDPLWGAVDGLGAVLGGAAEWLSGAEGEPTDARGAILFKAPKPG 233

Query: 221 QDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           QD RADLP IG +T Q V+ AG AG+ +EA   +VLE + V    D AG+F+ 
Sbjct: 234 QDRRADLPVIGPQTAQGVVAAGFAGVVIEADGVMVLELDAVLSILDRAGLFLW 286


>gi|288572983|ref|ZP_06391340.1| conserved hypothetical protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568724|gb|EFC90281.1| conserved hypothetical protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 275

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 75/275 (27%), Positives = 132/275 (48%), Gaps = 16/275 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFC--VLRSI 60
           +L ++AG G LP  + K      + PV+ ++  +   D + +    +P+ +     +   
Sbjct: 9   KLALVAGEGDLPLVILKNLVASGETPVVYAIRPDW-QDIEAYGVSVIPVKEINLVKIFGS 67

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L    I R+++AG + +                I  ++  L    + A+L A ID +E  
Sbjct: 68  LVFRRIKRLLLAGYVSKTVIY-----DDSADSEIKGIVAGLDDRNDHALLGAVIDRVEKL 122

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+SV+G   I+P+++   G +    P+     D+         L  L  GQS V     V
Sbjct: 123 GISVLGYDSILPDMIAPEGRIAGPEPSSSDLVDVDYGRAVLGRLLPLSFGQSLVVCRRSV 182

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VA+E +EGTD  ++R  D    G        VLVK  ++ QD R D+P +G KT+ ++ +
Sbjct: 183 VAVEAMEGTDETVKRAGDISGAG--------VLVKGMRADQDRRYDIPVVGTKTLDSMSE 234

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +GL+ +A+EAG  L++++E + + A   GI V G+
Sbjct: 235 SGLSCLAVEAGNVLIMDREKLSEAASRLGISVIGV 269


>gi|115377101|ref|ZP_01464316.1| phosphatidate cytidyltransferase [Stigmatella aurantiaca DW4/3-1]
 gi|115365876|gb|EAU64896.1| phosphatidate cytidyltransferase [Stigmatella aurantiaca DW4/3-1]
          Length = 242

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 71/252 (28%), Positives = 130/252 (51%), Gaps = 13/252 (5%)

Query: 27  EPVIASVLNECSFDWQD--FECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDL 84
           + V  +   E     +        + LG    + S   + ++ +  +AG I R   + + 
Sbjct: 2   DVVAVAHRGETDPALEREVAAFTWVRLGQVGRIVSTFQKASVTQAAMAGGIGRVRALTE- 60

Query: 85  CFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTC 144
               +  +   +++ +L S  + A+L+A  D  E++GV++V   + + +++   G L   
Sbjct: 61  ---ARPDMGAVRILSRLRSLRDDALLRAVADHFEAHGVTIVAPTDYLAQVMCPAGHLAGP 117

Query: 145 VPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGR 204
             + + ++D+   ++ A  L + DVGQ+ V  GG V+ALE +EGTD  ++R       G 
Sbjct: 118 RLHPEQEKDVALGVEVASLLGKADVGQTVVVKGGNVLALEAVEGTDETIRR-------GA 170

Query: 205 ILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKH 264
            L GK  V+VK CK  QD+R DLP+ G +T++ + + G   +ALEAG++++LE + +   
Sbjct: 171 KLGGKGAVVVKRCKPGQDLRFDLPAAGPRTLEVMAEVGAKVLALEAGRTVLLETQALFAR 230

Query: 265 ADEAGIFVCGID 276
           A+  GI V GI 
Sbjct: 231 AEADGITVVGIP 242


>gi|83951894|ref|ZP_00960626.1| hypothetical protein ISM_15065 [Roseovarius nubinhibens ISM]
 gi|83836900|gb|EAP76197.1| hypothetical protein ISM_15065 [Roseovarius nubinhibens ISM]
          Length = 266

 Score =  231 bits (591), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 84/275 (30%), Positives = 139/275 (50%), Gaps = 13/275 (4%)

Query: 1   MKR-LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRS 59
           M R L I+A  G LP  +A+A         I ++           +     L     L  
Sbjct: 1   MSRDLAILACGGALPVRLAEAHPEA----HIYTLKGV----PSAVKGEAHQLEKIGSLFD 52

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            +    + R+V AG + R       C      L I+  I Q +  G+ A+L+  I + E 
Sbjct: 53  AMKSAGVTRMVFAGHLARPAINPAEC--DAQMLSIAPRIMQALPKGDDALLREVIAIFEE 110

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G +VVGAHE++PEL+V+ G      P++  + D+  A++    +S LD+GQ  V  GG+
Sbjct: 111 QGFAVVGAHELLPELVVESGLALGPAPSKAEEADVARAIEILSHMSPLDIGQGCVVAGGQ 170

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
            + +E ++GTD+ML  +       R   G+ GV VK  K  QD+R D+P+IGA TV+ V 
Sbjct: 171 CLGIETVQGTDAMLGFVAGTPEALR--RGQKGVYVKAPKRGQDLRVDMPAIGANTVEAVA 228

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           KAGLAG+ + A + ++++++   +  ++ G+F+  
Sbjct: 229 KAGLAGLVVAADQVMMIDRKTTLEALEKTGVFLVA 263


>gi|317051793|ref|YP_004112909.1| hypothetical protein Selin_1623 [Desulfurispirillum indicum S5]
 gi|316946877|gb|ADU66353.1| protein of unknown function DUF1009 [Desulfurispirillum indicum S5]
          Length = 266

 Score =  231 bits (590), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 61/275 (22%), Positives = 121/275 (44%), Gaps = 17/275 (6%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECR--ELPLGDFCVLRSIL 61
           + II G G        A R K        +  E + +  D   R  ELP+     +    
Sbjct: 6   VGIICGQGDFARLAIDAYRQKGYRTFAVVLREENTMEVADKADRSMELPIEKIGRIIRFF 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
             + +  ++ AG + ++   + +   I       +++ +     +A+++   +  LE  G
Sbjct: 66  RDHGVTDLLFAGKVHKKVVYRTIFTDITA----MRLLRRFKDHRDASMMNVIMYFLEEEG 121

Query: 122 VSVVGAHEIVPELLVQVGSL-GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
             ++   + + ELL   G + G   P+  + RDI    + A  L++ ++GQ+   +   V
Sbjct: 122 FRILPQTQYLEELLAPKGVIWGKIEPD--LARDIQYGYRIARMLADEEIGQTVAVLREAV 179

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VA E +EGTD  + R  +          +   +VK+ +++QD+R D+P +G +TV   ++
Sbjct: 180 VAAEALEGTDRTIVRAGEL--------ARDTTIVKVERTRQDLRFDVPVVGLETVTWAVQ 231

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           A    +A+EA K    ++E     A +  + + GI
Sbjct: 232 ARCRCLAMEAEKVFFFQREESIALARKHNLVLYGI 266


>gi|294054921|ref|YP_003548579.1| protein of unknown function DUF1009 [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614254|gb|ADE54409.1| protein of unknown function DUF1009 [Coraliomargarita akajimensis
           DSM 45221]
          Length = 286

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 69/279 (24%), Positives = 121/279 (43%), Gaps = 16/279 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----QDFECRELPLGDFCVLRS 59
           + +IAG G  P   A+  R       + S   E   D+       E  ++ +G    +  
Sbjct: 18  IGLIAGKGRYPILTAERIRSAGIPLRVISFAGETDPDFVASIPRDEHIQIKVGQLGKMLK 77

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L +      ++AG I  R   + L       L+  +++  L       I  A    +E+
Sbjct: 78  SLQKLGCAYALMAGQITPRRLFKGLH----PDLKALRILNSLKIKNAETIFGAIASEIEA 133

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
             + ++ A   + + +   G +      +  +  I   M+ A  L++LDVGQ AV   G 
Sbjct: 134 INIQMLDARAFLDDQMASPGIMTQGKL-KVTQDAIDHGMQIARGLADLDVGQGAVVRKGT 192

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A E  EGTD ML+R  + + +         +  K  K  QD R D+P  G++T++ + 
Sbjct: 193 VIAAEAYEGTDPMLRRAGEFKTD-------DLIFAKTVKRVQDYRFDVPVFGSRTLEVMK 245

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           +AG+    LE+GK ++L+KE + + A    I + G   E
Sbjct: 246 EAGIETAVLESGKVIMLDKEALLQEAKRMKISLIGFSAE 284


>gi|89068198|ref|ZP_01155608.1| hypothetical protein OG2516_02014 [Oceanicola granulosus HTCC2516]
 gi|89046115|gb|EAR52173.1| hypothetical protein OG2516_02014 [Oceanicola granulosus HTCC2516]
          Length = 269

 Score =  230 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 84/275 (30%), Positives = 125/275 (45%), Gaps = 9/275 (3%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G+LP  +        + P++  +         D       L     L   L  
Sbjct: 2   LALIAGTGLLPGLLCARLAENGEVPLVCEMAGFAPDLPPDLPRLPFRLETLGSLIGALRS 61

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+ +AGA+ RRP +          + +   +   +  G+   L+  + L E  G+ 
Sbjct: 62  RGVERVCLAGAV-RRPVIDPAAIDAAT-VPLVPRLKAALGKGDDGALREIVGLFEEAGME 119

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVGAH+IVPELL   G      P   +K D   A      L   D+GQ+    GGRV+A 
Sbjct: 120 VVGAHDIVPELLPPAGHYAGPAPGEALKADAALAEAVVAELGAADLGQACAVRGGRVLAQ 179

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG EGT +ML  +            ++G+L K  K  QD R DLP+IG +T  +V +AGL
Sbjct: 180 EGPEGTAAMLALLT-------PDGPRTGLLYKAAKPGQDRRVDLPAIGPQTPMSVAEAGL 232

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
            GI +EAG  +VL+   V     + G+ +   DR 
Sbjct: 233 GGIVVEAGGVVVLDLARVIDRCRDLGLTLWIRDRS 267


>gi|312879635|ref|ZP_07739435.1| protein of unknown function DUF1009 [Aminomonas paucivorans DSM
           12260]
 gi|310782926|gb|EFQ23324.1| protein of unknown function DUF1009 [Aminomonas paucivorans DSM
           12260]
          Length = 282

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 126/275 (45%), Gaps = 13/275 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILH 62
           + ++AG G LP  +A+    +   PV+ S+        +  ++   L   D     + + 
Sbjct: 16  IALVAGEGTLPLEIARRLTDRGTPPVVYSLRENVGALSKFAWDVVVLSRLDLASTLADMK 75

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              I R+++AG + +    Q             +++  L    + ++L A +   E   +
Sbjct: 76  GRGIRRVLLAGVVPKTLLYQPAMLDAGA----RELVAGLAVRDDHSLLAALVQAFERLDL 131

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V G   ++ +L+   G       + + + D+   M+ A  L  L  GQ+ V     VVA
Sbjct: 132 RVEGYRHLIEDLMAPSGEFAGRPLSEEERADVAYGMEVARVLLPLSFGQTVVVHRRSVVA 191

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGTD+ L R             K G +VKM +  QD R DLP++G +T+ ++ +AG
Sbjct: 192 VEAMEGTDAALLRAGSL--------CKGGTVVKMMRVDQDDRYDLPTVGPRTLHHMARAG 243

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           L  +A+E G+++VLE E  ++ A   GI V G+  
Sbjct: 244 LRCLAVEVGRTIVLEPEAFRETARAEGIAVTGVSP 278


>gi|149915225|ref|ZP_01903753.1| hypothetical protein RAZWK3B_15348 [Roseobacter sp. AzwK-3b]
 gi|149810946|gb|EDM70785.1| hypothetical protein RAZWK3B_15348 [Roseobacter sp. AzwK-3b]
          Length = 268

 Score =  229 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 84/273 (30%), Positives = 134/273 (49%), Gaps = 16/273 (5%)

Query: 3   RLLIIAGSGMLPYYVAKA---ARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRS 59
           RL I+A SG LP  +A+A   A     + V  ++  +                    +  
Sbjct: 4   RLAILACSGGLPVRIAEAQPDALKLGFQGVPNALQGDV---------HLHRFEKMGAVFD 54

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L    + R+V AG++ R P   +        L ++  +   + GG+ A+L+  I + E 
Sbjct: 55  GLRAQGVDRVVFAGSLSRPPL--NPAEFDPVMLGLAPRLMVAMQGGDDALLREVIAIFEE 112

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G +V+GAHE+VP L  + G       +     D   A     ALS LDVGQ  V  GG+
Sbjct: 113 QGFAVMGAHELVPGLTAEEGLCVGAEMSETDLTDAGRAWDILMALSPLDVGQGCVVAGGQ 172

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
            + +E ++GTD++L  +       R   G  GV VK  K  QD+R D+P IG KT++ V 
Sbjct: 173 CLGIETVQGTDALLGFVAATPEALR--RGVRGVYVKAAKRGQDLRVDMPVIGPKTIEAVA 230

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           +AGLAG+ +EA + ++LE+E   +  ++AG+F+
Sbjct: 231 EAGLAGLVVEASRVMILEREKTVQAVEKAGLFL 263


>gi|254440125|ref|ZP_05053619.1| hypothetical protein OA307_4995 [Octadecabacter antarcticus 307]
 gi|198255571|gb|EDY79885.1| hypothetical protein OA307_4995 [Octadecabacter antarcticus 307]
          Length = 266

 Score =  229 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 77/269 (28%), Positives = 114/269 (42%), Gaps = 9/269 (3%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQY 64
            +IAG G LP  +A   R +    +I  +    S    DF              + L   
Sbjct: 4   ALIAGLGGLPTALAATLRAQGRTVIICEMRGFVSEVDGDFHRIAFSFETLGTFLAALKTA 63

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            +  + +AGA+ +RP V         +L +   +   ++ G+   L A + L E  G +V
Sbjct: 64  GVTDVCMAGAV-QRPKVDPSLID-GATLPLVPRLMAAMAKGDNGTLSAIVALFEEQGFAV 121

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           VGAH+I PELL   G      P  +    I AA  +   + +LD GQ+ +     V+A E
Sbjct: 122 VGAHDIAPELLPMSGVHTQVAP-PNFTTGIAAAQVALADMGQLDQGQAVLLRRSHVIARE 180

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
              GT +ML  +    N      G    L K  K  Q+MR D+P IG  T     +AGLA
Sbjct: 181 DDRGTAAMLDDLQTRGN------GAGVTLFKAPKPNQNMRVDMPLIGPDTALQAAEAGLA 234

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVC 273
           GI +  G  +VL+   V    D   +F+ 
Sbjct: 235 GIVITHGGVMVLDLPEVISILDAHAMFLW 263


>gi|146278178|ref|YP_001168337.1| hypothetical protein Rsph17025_2142 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556419|gb|ABP71032.1| protein of unknown function DUF1009 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 273

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 94/274 (34%), Positives = 140/274 (51%), Gaps = 8/274 (2%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ-DFECRELPLGDFCVLRSILHQ 63
            IIAG+G LP ++A A R   + P++A++        + D   R   L  F      L  
Sbjct: 7   AIIAGAGALPRHLAWALRAAGEVPLVAALEGFAPEGLEADITFRVERLVPF---LRELET 63

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+V AGA+ RRP +    F    +  + ++I  +   G+ A L+A I + E  G +
Sbjct: 64  AGVSRLVFAGAV-RRPRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIAIFEEEGFA 121

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVG  +I P+L+ +  +L    P     RD+  A    EA+  +DVGQ AV   G  +A+
Sbjct: 122 VVGVSDIAPDLVPEAATLCG-APREGDVRDVARAAAIVEAIGRVDVGQGAVVAQGLCLAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV     AGL
Sbjct: 181 EALPGTDAMLDWVAATAGRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARAAAAGL 239

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AGIA EAG  ++L++E   + A+EAG+F+   + 
Sbjct: 240 AGIAWEAGGVILLDREATVRAAEEAGLFLWAREP 273


>gi|325295063|ref|YP_004281577.1| hypothetical protein Dester_0878 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065511|gb|ADY73518.1| protein of unknown function DUF1009 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 264

 Score =  228 bits (583), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 72/275 (26%), Positives = 128/275 (46%), Gaps = 14/275 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLRSI 60
           ++ ++AG G LP    K+A+ K+   +  S+    S + + +  + + +           
Sbjct: 2   KVGLLAGKGELPLEFLKSAKEKDIRTITFSLEGITSPEVERYSDKVIWIKPFKLGKFLRT 61

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           L +  I  I + G ++ +  +          L+    I  L       I+K  I  +E+ 
Sbjct: 62  LKKEEIREIAILGKVEHKNAIS----LSGFDLKALTFIASLRDRKPETIIKGIISEIENI 117

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GV V+   + +  L  + G +        +K D    MK A+ ++ LD+GQ+ V     V
Sbjct: 118 GVRVIEPTKYLLHLFQEPGIICG-ELTDKLKEDAEFGMKIAKEIASLDIGQTVVVKDKTV 176

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +A+EGIEGTD  ++R       G  LAGK  ++ K  +  QDMR D+P++GAKT++ + K
Sbjct: 177 IAVEGIEGTDKCIER-------GAELAGKGFIVCKAARKNQDMRVDVPTVGAKTIELIGK 229

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
                +  EA K+ +L KE   + + + GI V  +
Sbjct: 230 LKGRALIFEANKTFLLNKEEAVRLSRKYGITVIAV 264


>gi|163731904|ref|ZP_02139351.1| hypothetical protein RLO149_21409 [Roseobacter litoralis Och 149]
 gi|161395358|gb|EDQ19680.1| hypothetical protein RLO149_21409 [Roseobacter litoralis Och 149]
          Length = 263

 Score =  228 bits (582), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 83/271 (30%), Positives = 130/271 (47%), Gaps = 13/271 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L ++ G G LP  VA A   ++ +P+I  +                 L       + L +
Sbjct: 2   LALVTGRGGLPARVAAA---QSTQPLICVLDGFAPEGLT--ADITFRLEHLGSFMAQLRE 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +   GAI+R P   D       +L +   + Q +  G+ A L+A + L E  G  
Sbjct: 57  RGVTAVCFCGAIERPPF--DPAALDGATLPLVPTLMQAMGAGDDAALRAVMALFEQQGFE 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           +  AH + P++L   G L    P+  ++ DI  A    +ALS +DVGQ  V   G+V  +
Sbjct: 115 IAAAHVLAPDILAPEGVLSDAQPDAAMQADIARADAVLQALSPVDVGQGCVVGQGQVWGI 174

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  +           G   VLVK  K+ QD+RADLP+IG  TVQ   +AGL
Sbjct: 175 ETIGGTDHLLTSLPTGVR------GARAVLVKAPKTGQDVRADLPTIGPDTVQAAAEAGL 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           AG+ ++AG+ ++LE +     A++AG+ +  
Sbjct: 229 AGLIIQAGQVILLEPDATIAGANKAGLVLWS 259


>gi|163782369|ref|ZP_02177367.1| hypothetical protein HG1285_06265 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882402|gb|EDP75908.1| hypothetical protein HG1285_06265 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 261

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 73/272 (26%), Positives = 128/272 (47%), Gaps = 14/272 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +IAG G LP    + A  + +E  +  V         D     LP+G    L  +  +
Sbjct: 3   IGLIAGKGRLPEVFREEAVKRGEEVFVVGVKGITDIKTDDL----LPVGKVGKLIKLFRK 58

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+V+ G  + R     +   ++  L+   ++ +      A+++KA + +LE  G  
Sbjct: 59  KGVDRVVMLGKFEHRLIYTSI---LQFDLKAFSVLRKAKDRRPASVVKAFMKVLEEEGFE 115

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
            +     + ELL + G++G   P+ +V  D L     A+ ++ELD+GQ+ V     VVA+
Sbjct: 116 FIDPRPYLEELLAEEGTMGRREPSEEVMEDGLFGFIIAKEVAELDIGQTIVVKDKAVVAV 175

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E +EGT   + R       G         +VK+ +  QD R D+P++G +T++ +  A  
Sbjct: 176 EAMEGTQETILRGGRLGGKGVR-------VVKVARKNQDFRIDVPTVGVETLEALKTAKA 228

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
             + LEAGK  V++KE   + AD   I V G+
Sbjct: 229 DALFLEAGKVYVVDKEKFLRGADRLNISVVGL 260


>gi|288818397|ref|YP_003432745.1| hypothetical protein HTH_1086 [Hydrogenobacter thermophilus TK-6]
 gi|288787797|dbj|BAI69544.1| conserved hypothetical protein [Hydrogenobacter thermophilus TK-6]
 gi|308751989|gb|ADO45472.1| protein of unknown function DUF1009 [Hydrogenobacter thermophilus
           TK-6]
          Length = 260

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 77/273 (28%), Positives = 121/273 (44%), Gaps = 14/273 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           ++ +IAG G LP    K A  K  E     V    +     F    LPLG    L  +L 
Sbjct: 2   KVCLIAGWGELPAIFQKEASKKGIEVFTVGVKGITT----AFADEYLPLGHVGKLIKLLE 57

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           +  I +IV+ G  + R            +L    ++ +        I+ + I  LE  G 
Sbjct: 58  REGIKKIVMLGKFEHRLIFSHFFTFDSIAL---SILRKAKDKRPQTIITSFIQELEKRGF 114

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
             +     +  +L + G +G   P+ +   D L     A+ ++ LD+GQ+ V     VV+
Sbjct: 115 EFIDPKPYLESILAKSGKIGFLEPSPEAMEDGLWGFSIAKEIASLDIGQTIVVKNKSVVS 174

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E +EGT   ++R           AGK+  ++K+ +  QD R D+P+IG  TVQ V K  
Sbjct: 175 VEAMEGTQEAIERAGKL-------AGKNCRVIKVARRSQDFRIDVPTIGPLTVQAVKKIK 227

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
              I LEAGK  +L+ E     A E+GI + G+
Sbjct: 228 GDAIFLEAGKIYMLDMEKTISLAKESGIALYGL 260


>gi|282856199|ref|ZP_06265482.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
 gi|282585958|gb|EFB91243.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
          Length = 274

 Score =  225 bits (575), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 127/275 (46%), Gaps = 15/275 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG---DFCVLRSI 60
           L ++AG G LP  + KA   K   P    +L E    + +       +       ++ + 
Sbjct: 6   LALVAGEGALPLEILKAMIKKKAPPPKVYLLAENDAPYLEEGIAVQKIANPMAIAMILAK 65

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           +    I R+++AG + ++                  ++  +    + ++L   +  +E +
Sbjct: 66  MRLMGIRRLMMAGGVPKKNIYSAEKLDRGA----KSILSSVQDRNDHSLLAGIVKYIEKF 121

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G+ V+   E++PELL   G +   VP+ +  +D    +     L  L  GQS V     V
Sbjct: 122 GIQVMSYEEVIPELLAPEGHIAGPVPDAEQLQDCEYGLSILRVLLPLSFGQSVVVSNRAV 181

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VA+E +EGTD  ++R      +G        +L+K  ++ QD R DLP +G +T++N+  
Sbjct: 182 VAVEAMEGTDEAVRRAASLSAHG--------ILLKGMRADQDRRYDLPVVGVQTLRNMAD 233

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGI 275
           +GL G+ +EAG  L+LEK+   + A+   I V G+
Sbjct: 234 SGLTGLFIEAGSVLLLEKDAFLQEAERLEISVTGV 268


>gi|114569943|ref|YP_756623.1| hypothetical protein Mmar10_1393 [Maricaulis maris MCS10]
 gi|114340405|gb|ABI65685.1| protein of unknown function DUF1009 [Maricaulis maris MCS10]
          Length = 280

 Score =  224 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 81/272 (29%), Positives = 131/272 (48%), Gaps = 5/272 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAG G LP  + +A         +  +      D+   +   L +G+   +   L 
Sbjct: 8   KLGLIAGGGDLPLEILRA--QAGKPVFVVVLKGFADRDYGGADSVSLSVGEIGGIIKALR 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
                 I  AG +  RP+++ L    +  + + + +      G+ A+++  +D  E  G 
Sbjct: 66  GAGCDAICFAGYVT-RPDLKSLKMDARGLIMVPRAL-AAGRKGDDAVIRVVVDEFERAGF 123

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +VVGA  ++ +  +  G LG        + D   AM  A  +  LD+GQ AV  GG V+A
Sbjct: 124 AVVGADSLLGQDGLPAGCLGDAAAVEAHRDDAGKAMMVAAEIGRLDIGQGAVVAGGVVLA 183

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKS-GVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           +E  EGT++ML+R+       R  A +  GVL K  K  Q+ R DLP+IG  TV+    A
Sbjct: 184 VEAQEGTNAMLERVAGLPAPIRGDASRRLGVLAKRPKPIQERRVDLPTIGVGTVERCAAA 243

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           GLAGI LEA  +L++++  V+      G+FV 
Sbjct: 244 GLAGIVLEADGALIVDRAGVEGALKRHGLFVL 275


>gi|309390187|gb|ADO78067.1| protein of unknown function DUF1009 [Halanaerobium praevalens DSM
           2228]
          Length = 276

 Score =  224 bits (573), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 67/259 (25%), Positives = 129/259 (49%), Gaps = 14/259 (5%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC--RELPLGDFCVLR 58
           M +  +IAG G LP   A+ A+   ++ ++  +  E + ++ D +C    + L     + 
Sbjct: 1   MSKKALIAGWGKLPRIWAEKAQAAAEDFIVIRIAEEITAEFSDLDCSSYTVNLTQLGKIL 60

Query: 59  SILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLE 118
            IL +  I  ++  G I +      L    +   ++ K++ QL +  +  IL A    + 
Sbjct: 61  EILAEEKIEEVIWLGKIQK----AHLFADFRPDQKLQKLLEQLPNLNDDTILMALALEII 116

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGG 178
           + G++++    ++ + L + G L   V   ++K D++ A ++A  L   D+GQ+A+   G
Sbjct: 117 NIGINILPQTYLLADQLAKAGVLAGEV-KAELKSDLIFAFETAINLGRFDIGQTAIVKNG 175

Query: 179 RVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNV 238
            V+ALE IEGTD  +QR            G   V+ K  K +QD+R D+P++G KT++ +
Sbjct: 176 AVLALEAIEGTDQAIQRAAKY-------GGPGLVMAKCSKKEQDLRFDIPTVGLKTLEQL 228

Query: 239 IKAGLAGIALEAGKSLVLE 257
             A    + +EA ++ +L+
Sbjct: 229 AAAEARALIVEADQTFILD 247


>gi|84516081|ref|ZP_01003441.1| hypothetical protein SKA53_04083 [Loktanella vestfoldensis SKA53]
 gi|84509777|gb|EAQ06234.1| hypothetical protein SKA53_04083 [Loktanella vestfoldensis SKA53]
          Length = 292

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 80/293 (27%), Positives = 130/293 (44%), Gaps = 32/293 (10%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP  +        + P++ ++         D   R   LG F    + L  
Sbjct: 2   LALIAGTGDLPPAL---LVRLPERPLVCALQGFAPQITPDITFRLEHLGSF---LADLAA 55

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + RI +AGA+ +RP +          L +   +   ++ G+   L+  I +LE+ G +
Sbjct: 56  RGVTRICMAGAV-KRPAIDPAQIDAAT-LPLVAGLQAALAKGDDGTLRGVIAILENAGFA 113

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV AH++ P+LL   G L   V    ++ D +   ++  A+ + D+GQ+ +   G V+A 
Sbjct: 114 VVAAHDLAPDLLPAAGVLAGRV-TPQLRLDAVLGEQTIAAMGQADIGQACLVRLGHVIAR 172

Query: 184 EGIEGTDSMLQRIVDCRN-----------------------NGRILAGKSGVLVKMCKSQ 220
           E   GTD+M+ R     +                       +G  +  +  VL K  K  
Sbjct: 173 EDQAGTDAMIARFAPAGDPLWGSVDLVGDLLGTAAEWLSGADGVPVDARGAVLFKAPKPA 232

Query: 221 QDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           QD RADLP IG  T +  + AGL+ I +EAG  +VL+   V    D AG+   
Sbjct: 233 QDRRADLPVIGPDTARGAVAAGLSAIVVEAGGVIVLDLPQVIATLDRAGVCFW 285


>gi|220921521|ref|YP_002496822.1| hypothetical protein Mnod_1527 [Methylobacterium nodulans ORS 2060]
 gi|219946127|gb|ACL56519.1| protein of unknown function DUF1009 [Methylobacterium nodulans ORS
           2060]
          Length = 281

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 89/278 (32%), Positives = 138/278 (49%), Gaps = 4/278 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
            + I+AG+G LP  VA A         I ++        +      + L D     + L 
Sbjct: 5   TVAIVAGAGRLPLLVAAALEAAGRPFRILAIRGFADPATRRRAHATVDLLDVRGALARLD 64

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
            +    + +AGA+  RP+   L  ++   LR    +  L  GG+  +L+  + LLE +G 
Sbjct: 65  AWAPSGVTLAGAVA-RPSPAALLNTLA-VLRNRDELRSLAQGGDDHLLRGVLALLEEHGH 122

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G HE+ P+L+ + G LG   P+   +  +        +LS  DVGQ+AV    RV+A
Sbjct: 123 RILGVHELAPDLMAKPGPLGAGRPDAAAETSVATGRALLASLSAHDVGQAAVVANRRVLA 182

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +EG EGTD ML R          L       VLVK+ KS QD+R DLP+IG +TV+    
Sbjct: 183 IEGPEGTDRMLARARSLARRPFGLGRPPTGLVLVKLAKSGQDLRVDLPAIGPRTVRAAAA 242

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AG +GIA+ AG +L+L++      AD  G+F+ G++  
Sbjct: 243 AGCSGIAVGAGDTLILDRAETAALADRLGLFLLGLEAS 280


>gi|254452404|ref|ZP_05065841.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198266810|gb|EDY91080.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 266

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 78/271 (28%), Positives = 120/271 (44%), Gaps = 9/271 (3%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
            L +IAG G LP  +  A ++     ++  +    S    DF              + L 
Sbjct: 2   TLALIAGLGGLPTALVAALQVPKRAVIVCEMHGFVSEVTGDFHRITFRFETLGTFLADLK 61

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              +  + +AGAI +RP V          + +   +   ++ G+   L A + L E  G 
Sbjct: 62  TAGVTEVCMAGAI-QRPKVDPSLIDAAT-MPLVPRLMAAMAKGDDGTLSAVVALFEEQGF 119

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
           +VVGAH I P+LL   G      P  D+   I AA  + + + ++D+GQ+ +  G  V+A
Sbjct: 120 AVVGAHAIAPDLLPMAGVHTQVAP-PDLTAGIAAAQVALDDMGQIDLGQAMLLRGSDVIA 178

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
            E + GT +MLQ +    N      G    L K  K  Q+MR D+P IG +T      AG
Sbjct: 179 REDVRGTAAMLQDVKTHGN------GAGVTLFKAPKPNQNMRVDMPLIGPETALQAADAG 232

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           LAGI +  G  LVL+   V    D  G+++ 
Sbjct: 233 LAGIVIPQGSVLVLDLPQVVATLDTHGLYLW 263


>gi|240141527|ref|YP_002966007.1| hypothetical protein MexAM1_META1p5126 [Methylobacterium extorquens
           AM1]
 gi|240011504|gb|ACS42730.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 282

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 98/277 (35%), Positives = 146/277 (52%), Gaps = 5/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L ++AG+G LP  VA +         + +V        +      + L D      IL
Sbjct: 6   RPLALVAGAGHLPELVAASLDRARRPFRVLAVRGFTERAMRRRADAVVDLLDIPGTLRIL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++    +V AG +  RP+   L      ++R   ++  L +GG+  +L+A + LLE  G
Sbjct: 66  KEWAPAAVVPAGGVT-RPSPAALLN-AAHAVRNRDILKSL-AGGDDRLLRAVLSLLEENG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+G HE+ P+LL ++G LG   P+ D    I +      AL   DVGQ+AV  G RV+
Sbjct: 123 HRVLGVHEVAPDLLGRLGRLGRVEPDSDATLSIASGRAMLGALGPFDVGQAAVVAGERVI 182

Query: 182 ALEGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           A+EG EGTD ML R         GR    K  VLVK+ K  QD+R DLP+IG +TV+   
Sbjct: 183 AVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVRRAA 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AG AGIA+ AG +LV+++E     AD AG+F+ G++
Sbjct: 243 EAGCAGIAIGAGHTLVIDREATVAAADAAGLFLIGVE 279


>gi|163854073|ref|YP_001642116.1| hypothetical protein Mext_4677 [Methylobacterium extorquens PA1]
 gi|163665678|gb|ABY33045.1| protein of unknown function DUF1009 [Methylobacterium extorquens
           PA1]
          Length = 282

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 99/277 (35%), Positives = 146/277 (52%), Gaps = 5/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L ++AG+G LP  VA +         + +V        +      + L D      IL
Sbjct: 6   RPLALVAGAGHLPELVAASLDRAQRPFRVLAVRGFTERAMRRRADAVVDLLDIPGTLRIL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++    +V AG +  RP+   L      ++R   ++  L +GG+  +L+A + LLE  G
Sbjct: 66  REWAPAAVVPAGGVT-RPSPAALLN-AAHAVRNRDILKSL-AGGDDRLLRAVLSLLEENG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+G HE+ P+LL ++G LG   P+ D    I +      ALS  DVGQ+AV  G RV+
Sbjct: 123 HRVLGVHEVAPDLLGRLGRLGRVEPDSDATLSIASGRAMLGALSPFDVGQAAVVAGERVI 182

Query: 182 ALEGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           A+EG EGTD ML R         GR    K  VLVK+ K  QD+R DLP+IG +TV+   
Sbjct: 183 AVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVRRAA 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AG AGIA+ AG +LV++ E     AD AG+F+ G++
Sbjct: 243 EAGCAGIAIGAGHTLVIDGEATVAAADAAGLFLIGVE 279


>gi|294102482|ref|YP_003554340.1| protein of unknown function DUF1009 [Aminobacterium colombiense DSM
           12261]
 gi|293617462|gb|ADE57616.1| protein of unknown function DUF1009 [Aminobacterium colombiense DSM
           12261]
          Length = 270

 Score =  220 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 77/284 (27%), Positives = 127/284 (44%), Gaps = 17/284 (5%)

Query: 1   MKR-LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVL 57
           MKR L IIAG G LP  +      +   P + S+  +       F  +   +   D   +
Sbjct: 1   MKRTLAIIAGEGCLPEIICARLFKEGMPPYVFSMGADIE-RLAPFARQIWTVATPDLEWI 59

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
              +  + +  +++AG + +    Q     +     + K      +  + A+L   +  +
Sbjct: 60  LGQMLSHKVETMILAGQVPKSLMYQRENLDV-----LLKQSLDAENNDDHALLSRIVRTI 114

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G+ V G  +I+ +LL   G +     +    +D+         L  L  GQS V   
Sbjct: 115 EKTGIKVAGYRQILSDLLTPEGQVSARGLSDQEAKDVAYGCSILFHLLPLSFGQSIVIHS 174

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G VVA+E +EGTD+MLQR     +         G ++KM ++ QD R D+P +G  T+  
Sbjct: 175 GAVVAVEAMEGTDAMLQRAGTLVH--------GGSVIKMMRADQDERFDIPVVGTHTLHM 226

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           + KAG   +ALEAG++L+LEKE   + A    I V G+    +I
Sbjct: 227 MEKAGQTCLALEAGRTLMLEKEAFLELAARLNIAVVGVPPCLSI 270


>gi|218533018|ref|YP_002423834.1| hypothetical protein Mchl_5142 [Methylobacterium chloromethanicum
           CM4]
 gi|218525321|gb|ACK85906.1| protein of unknown function DUF1009 [Methylobacterium
           chloromethanicum CM4]
          Length = 282

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 99/277 (35%), Positives = 145/277 (52%), Gaps = 5/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L ++AG+G LP  VA +         + +V        +      + L D      IL
Sbjct: 6   RPLALVAGAGHLPELVAASLDRARRPFRVLAVRGFTERAMRRRADAVVDLLDIPGTLRIL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++    +V AG +  RP+   L      ++R   ++  L +GG+  +L+A + LLE  G
Sbjct: 66  KEWAPAAVVPAGGVT-RPSPAALLN-AAHAVRNRDILKSL-AGGDDRLLRAVLSLLEENG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+G HE+ P+LL ++G LG   P+ D    I        ALS  DVGQ+AV  G RV+
Sbjct: 123 HRVLGVHEVAPDLLGRLGRLGRVDPDSDATLSIATGRAMLGALSPFDVGQAAVVAGERVI 182

Query: 182 ALEGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           A+EG EGTD ML R         GR    K  VLVK+ K  QD+R DLP+IG +TV+   
Sbjct: 183 AVEGPEGTDRMLARARALNRKPFGRGTPAKGTVLVKLPKLGQDLRIDLPAIGPRTVRRAA 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AG AGIA+ AG +LV++ E     AD AG+F+ G++
Sbjct: 243 EAGCAGIAIGAGHTLVIDGEATVAAADAAGLFLIGVE 279


>gi|254564044|ref|YP_003071139.1| hypothetical protein METDI5730 [Methylobacterium extorquens DM4]
 gi|254271322|emb|CAX27334.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 282

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 96/277 (34%), Positives = 142/277 (51%), Gaps = 5/277 (1%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L ++AG+G LP  VA +         + +V        +      + L D      IL
Sbjct: 6   RPLALVAGAGHLPELVAASLDRARRPFRVLAVRGFTERAMRRRADAVVDLLDIPGTLRIL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++    +V AG + R         +   ++R   ++  L +GG+  +L+A + LLE  G
Sbjct: 66  KEWAPAAVVPAGGVTRPS--PAAILNAAHAVRNRDILKSL-AGGDDRLLRAVLSLLEENG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             V+G HE+ P+LL ++G LG   P+ D    I        ALS  DVGQ+AV  G RV+
Sbjct: 123 HRVLGVHEVAPDLLGRLGRLGRVEPDSDATLSIATGRAMLGALSPFDVGQAAVVAGERVI 182

Query: 182 ALEGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           A+EG EGTD ML R         G     K  VLVK+ K  QD+R DLP+IG +TV+   
Sbjct: 183 AVEGPEGTDRMLARARALNRKPFGHGTPAKGSVLVKLPKLGQDLRIDLPAIGPRTVRRAA 242

Query: 240 KAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           +AG AGIA+ AG +LV++ E     AD AG+F+ G++
Sbjct: 243 EAGCAGIAIGAGHTLVIDGEATVAAADAAGLFLIGVE 279


>gi|182415681|ref|YP_001820747.1| hypothetical protein Oter_3873 [Opitutus terrae PB90-1]
 gi|177842895|gb|ACB77147.1| protein of unknown function DUF1009 [Opitutus terrae PB90-1]
          Length = 281

 Score =  219 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 73/279 (26%), Positives = 128/279 (45%), Gaps = 16/279 (5%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW----QDFECRELPLGDFCVL 57
           + L +IAG G+ P  VA AAR       + +   E   +      D + R L +G    +
Sbjct: 15  RPLALIAGQGLYPQLVAAAARHAGVPLKLIAFDEETRPELIASFADADRRTLLVGQLGKM 74

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
             +L +++ G  ++AG I  R   + L       L+  +++  L       I  A    +
Sbjct: 75  LKMLREFDAGYALMAGQISPRRLFRGLH----PDLKAVRLLASLKRRNAETIFGAIAAEI 130

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G++++ A   + + L   G +         +  +   +  A   + LD+GQ  V   
Sbjct: 131 EGLGITLLDARSFLDDQLATAGCMTGRS-FPIDRDYVEHGVHIARECARLDIGQGCVVRK 189

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G V+A+E  EGTD ML+R    + +       + + VK  K+ QD R D+P  G +T++ 
Sbjct: 190 GTVLAVEAYEGTDEMLRRAGAFKTD-------AALFVKTVKAGQDYRFDVPCFGQRTLET 242

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           + +AG+A  ALEAG+ ++L++  V   A   GI + G +
Sbjct: 243 MREAGIAAAALEAGRVIMLDRPAVLAQARTWGINLLGFE 281


>gi|195953384|ref|YP_002121674.1| protein of unknown function DUF1009 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932996|gb|ACG57696.1| protein of unknown function DUF1009 [Hydrogenobaculum sp. Y04AAS1]
          Length = 261

 Score =  219 bits (559), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 78/275 (28%), Positives = 133/275 (48%), Gaps = 16/275 (5%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           ++ +IAG+G LP    K A    DE     V +  +           P+G    L   L 
Sbjct: 2   KIGLIAGAGELPEIFRKNALKNGDEVFTIGVNDITTIK----SDITFPIGKLSKLVEFLK 57

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
           + N+ +IV+ G  + + ++    + IK       ++  L     ++I+KA I  +E  G+
Sbjct: 58  EKNVEQIVMLGKFEHKLSLDPRDYDIKA----ISILASLKDRKPSSIVKAFIKFMEEEGL 113

Query: 123 SVVGAHEIVPELLVQV-GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV 181
             +     + ELL++  G L     +++V  DI    K A+ ++++D+GQ+ V     VV
Sbjct: 114 KFLDPKPYLSELLIEKRGLLNDVELDKNVVEDIEFGAKIAKNIADMDIGQTVVVKQKAVV 173

Query: 182 ALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKA 241
           A+E +EGTD  + R  D       +AGK  V++K  ++ QD R D+P++G  T+  + + 
Sbjct: 174 AVEAMEGTDKTILRAFD-------IAGKGIVVIKSARTNQDFRIDVPTVGIDTLNTLKET 226

Query: 242 GLAGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
               IA++ GK  VLEKE   K A+  GI V   +
Sbjct: 227 KAKAIAIQKGKVYVLEKEKFIKMANRFGIGVYAYE 261


>gi|89054940|ref|YP_510391.1| hypothetical protein Jann_2449 [Jannaschia sp. CCS1]
 gi|88864489|gb|ABD55366.1| hypothetical protein Jann_2449 [Jannaschia sp. CCS1]
          Length = 255

 Score =  218 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 76/270 (28%), Positives = 129/270 (47%), Gaps = 19/270 (7%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQY 64
            I+AG+G LP  + +A   +     +            D   R         L   L + 
Sbjct: 3   AILAGTGALPGLLLQADEAR-----VVGFKGVPVGVPVDIPAR---FEQLGTLFETLRKE 54

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            +  + +AGA+  RP +  + F    + +   ++   +  G+ A+L+  + ++E  G +V
Sbjct: 55  GVTEVCLAGAMS-RPTLDPVAFDPLTASK-MPVLMSAMGQGDDALLRTIVGVIEDAGFTV 112

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
           V AHEI  +L+ + G L   +  +D   D   A    +AL  LDVGQ AV+  G+V+ +E
Sbjct: 113 VAAHEIRDDLVAEAGVLAGKIKGKD---DATRARAVLDALGPLDVGQGAVAARGQVIGVE 169

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            ++GTD+ML  +           G  GVL K  K  QD+R D+P+IG  T++N  +AGL+
Sbjct: 170 TLQGTDAMLAFVEQTA------PGSGGVLAKRPKPGQDLRVDMPAIGPDTIRNAARAGLS 223

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           GI +  G  L+L++  +     E G+ +  
Sbjct: 224 GIEIAPGNVLLLDRPAILAACAETGLNLWA 253


>gi|126729716|ref|ZP_01745529.1| hypothetical protein SSE37_04560 [Sagittula stellata E-37]
 gi|126709835|gb|EBA08888.1| hypothetical protein SSE37_04560 [Sagittula stellata E-37]
          Length = 258

 Score =  218 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 85/274 (31%), Positives = 125/274 (45%), Gaps = 19/274 (6%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG+G LP  VA A        V+ ++   C  D      R   L     L   L +
Sbjct: 2   LALIAGTGALPGAVAAA---HGGTVVVCAL-EHCPPDLP--VDRTFRLETLGTLLRWLRR 55

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + + G++ R P    L      +  +   + + +  G+   L+  I L E  G  
Sbjct: 56  QGVTEVCLCGSVTRPPV--SLARVDLWTWPLVPRVLRALRRGDDGALRIFIALFEESGFR 113

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV AHE  P LL  VG+ G                  ++  +  D+GQ+ V   G V+  
Sbjct: 114 VVAAHEAAPALLPPVGAWGDVPAGVVEL--ARLGDTVSDRQAAEDLGQACVLRDGNVLQR 171

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           EG+EGTD+ML ++ D          + GVL K  K  QD RADLP IG +T++    AGL
Sbjct: 172 EGVEGTDAMLAKLGD---------AEGGVLYKAPKPGQDRRADLPVIGPETLRRAAAAGL 222

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AGI +EA   +VLE+ LV+    E G+F+   +R
Sbjct: 223 AGIVIEAQGVMVLEQPLVRTLIAETGLFLWVRER 256


>gi|163747142|ref|ZP_02154498.1| hypothetical protein OIHEL45_12300 [Oceanibulbus indolifex HEL-45]
 gi|161379703|gb|EDQ04116.1| hypothetical protein OIHEL45_12300 [Oceanibulbus indolifex HEL-45]
          Length = 266

 Score =  218 bits (557), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 77/275 (28%), Positives = 127/275 (46%), Gaps = 13/275 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  VA A   + + P++           +        L     + + L  
Sbjct: 3   LALIAGRGGLPARVAAA---QAEPPLVCVYEGSAPDGLK--ADLTFRLETLGSILAHLLG 57

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             I  + + GAID RP +      ++ +  +     Q ++ G+   L+    + E +G+ 
Sbjct: 58  VGIREVCLCGAID-RPTLDPAKLDMRTA-PLVPQFKQALAAGDNGALEVIKTIFEDHGLR 115

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VVGA E+VP+LL   G L   +P+  ++RD          L+ LD+GQ+ V    +V  +
Sbjct: 116 VVGADELVPDLLSDSGVLSRELPDEQMRRDAARGAAVLGGLAALDIGQACVIGREQVYGV 175

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E I GTD +L  + +     R       VL K  K+ Q    DLP+IG  T++    AGL
Sbjct: 176 ETIGGTDHLLATLPEAVGAAR------AVLCKGPKAGQIREIDLPTIGPDTLRAAHAAGL 229

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           AG+ + AG  ++LE++     ADE G+ +   + +
Sbjct: 230 AGVVVTAGGVMLLERDTCVALADELGLVLWVREED 264


>gi|255264780|ref|ZP_05344122.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255107115|gb|EET49789.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 301

 Score =  218 bits (556), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 82/300 (27%), Positives = 127/300 (42%), Gaps = 32/300 (10%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L + AG G LP  V  A        V+  +         + +  +  L     L + L  
Sbjct: 2   LALFAGQGSLPGLVMDAMVRAGTPVVLCEMEQFPVKGLGETKRLQYRLEGLGPLLAALEA 61

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  +  AGAI  RP+V DL      S  + + +      G+ A+L+  +++ E  G  
Sbjct: 62  EGVTDVCFAGAIS-RPDV-DLTKVDAVSAPLVQRLVGAFGQGDDALLREVLEIFEDRGFV 119

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V  AHE+ P LL + G L    P    + D   A+    A+   DVGQ+ V  GG+V+A+
Sbjct: 120 VRAAHELAPMLLPEAGVLTRVQPIETHENDADKAVAVVAAMGVADVGQACVVSGGQVLAI 179

Query: 184 EGIEGTDSMLQRIVDCRNNGRILA------------------------------GKSGVL 213
           E I GT  ML+ ++  + +                                    K G+L
Sbjct: 180 EAIPGTAWMLRSLIVPKEDAPSGPIGWAFDMVAVTVSDWAEWLSGINGQRDPALPKGGIL 239

Query: 214 VKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
            K  K  QD R DLP+IG +TV    +AGL GI +EAG  +V++     K ++  G+F+ 
Sbjct: 240 FKAPKPDQDRRIDLPTIGPETVMLAAEAGLDGIVIEAGGVMVIDAPQCVKISNGVGLFLW 299


>gi|159044052|ref|YP_001532846.1| hypothetical protein Dshi_1503 [Dinoroseobacter shibae DFL 12]
 gi|157911812|gb|ABV93245.1| conserved hypothetical protein DUF1009 [Dinoroseobacter shibae DFL
           12]
          Length = 265

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 81/273 (29%), Positives = 132/273 (48%), Gaps = 9/273 (3%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           L +IAG G LP  +A +         + ++      D          +     +   + +
Sbjct: 2   LALIAGQGGLPLALAASLGAAGTPYRVYALEGFA-PDLPQVT--VFRVEALGRVVRDMRK 58

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             I  +  AGA+ R     ++      SL +   + +++  G+  +L+  I + E  G+ 
Sbjct: 59  AGITEVCFAGAMQRPKV--EMGKLHPLSLPLVPRLMKVIGDGDDRLLREVIAIFEEAGLR 116

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+GAH+I P LL   G+LG   P+  ++ +     +       LD+GQ  V  GG  +A+
Sbjct: 117 VLGAHDIAPGLLAPKGALGDVAPSETLRAEAARGAEILRVTGPLDIGQGCVVAGGLCLAI 176

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD+ML+ +   R +     G  GVLVK  K  QD+R D+P+IG  TV     AGL
Sbjct: 177 ETLPGTDAMLRFVAQTRPD----PGPGGVLVKRAKPGQDLRIDMPAIGPDTVAAAQAAGL 232

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGID 276
           AGI L+AG  L+L+++  +  AD AGI + G+ 
Sbjct: 233 AGIVLQAGHILILDRDATRTAADAAGIAIWGVT 265


>gi|262277269|ref|ZP_06055062.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224372|gb|EEY74831.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 262

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 75/269 (27%), Positives = 140/269 (52%), Gaps = 11/269 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + I AG+G  P  +  + +  N + ++ ++  +   D       ++ LG+F  +  +L  
Sbjct: 2   IAIFAGTGDYPKEIIYSLKKNNKKFIVLNITEKKIKD-----SFKINLGEFGKILKLLKD 56

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
           Y I  ++ AG + +RPN++++ F +K    +  +I    S G+  IL  +  +L    + 
Sbjct: 57  YEIREVIFAGYV-KRPNLRNMKFDMKAISYMPHLIKAFKS-GDGNILNLAKKILNQNKIK 114

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           VV +H+    LL++  ++    PN+   +D     K  + LS+ D  Q  V   G +VA+
Sbjct: 115 VVESHKYSKNLLLKK-TVTQKKPNKIDLQDAKKGKKILDNLSKFDNAQGVVIDEGYIVAI 173

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E  EGTDSML+R+    N  +    KSGVL+K  K  Q+++ DLP+IG KTV+  +++ L
Sbjct: 174 EAAEGTDSMLKRV---INLNKNKNKKSGVLIKFPKKNQNLKYDLPTIGLKTVKLCMQSKL 230

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
            GI L+  +++ L ++     +++   F+
Sbjct: 231 NGIFLKKNQNIFLNQKKSIILSNKNNFFI 259


>gi|291532177|emb|CBL05290.1| Uncharacterized protein conserved in bacteria [Megamonas
           hypermegale ART12/1]
          Length = 196

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 55/205 (26%), Positives = 101/205 (49%), Gaps = 9/205 (4%)

Query: 71  VAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEI 130
           + G + +               R+  ++  L    +  ++ A +  L   G++      +
Sbjct: 1   MIGKVTKEILFSG--QHELPDARMIALLSSLKDRSDDTMMLAFVAELAKEGITTFDQTML 58

Query: 131 VPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTD 190
           +  ++ + G L    P      D+    K A+AL  LD+GQ+ V     V+ALE IEGTD
Sbjct: 59  LKMIMPKKGVLTKRQPTERENLDMEFGFKMAKALGGLDIGQTVVVKDKAVMALEAIEGTD 118

Query: 191 SMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEA 250
           + + R       G  LA  + V+ K+ K  QD R D+P++G KT++++I+   +G+ +EA
Sbjct: 119 ACILR-------GGKLACGNAVVAKVAKPAQDNRFDMPAVGVKTIESMIEVKASGLVIEA 171

Query: 251 GKSLVLEKELVKKHADEAGIFVCGI 275
           G++L++++E V   ADE  I +  +
Sbjct: 172 GRTLIVDREKVLSLADENAITIVAM 196


>gi|170738984|ref|YP_001767639.1| hypothetical protein M446_0644 [Methylobacterium sp. 4-46]
 gi|168193258|gb|ACA15205.1| protein of unknown function DUF1009 [Methylobacterium sp. 4-46]
          Length = 280

 Score =  212 bits (540), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 86/277 (31%), Positives = 134/277 (48%), Gaps = 4/277 (1%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
            + I+AG+G LP  VA A         I ++        +      + L D     + L 
Sbjct: 5   TVAIVAGAGRLPLLVASALDAAGRPFRILAIRGFADPATRRRAHATVDLLDVRGALARLD 64

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
            +    + +AGA+ R         +   +LR    +  L  GG+  +L+  + LLE +G 
Sbjct: 65  AWRPSGVTLAGAVSRPS--PAALLNTLAALRNRDELRSLAQGGDDHLLRGVLALLEEHGH 122

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            ++G HE+ P L+   G LG   P+   +  +        +L+  DVGQ+A   G RV+A
Sbjct: 123 RILGVHELAPGLMAPPGPLGARRPDAAAEISVATGRALLASLAAHDVGQAAAVAGRRVLA 182

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           +EG EGTD ML R+         L       VLVK+ KS QD+R DLP++G +TV+    
Sbjct: 183 VEGPEGTDRMLARVRGLARRPLGLGRPPAGLVLVKLAKSGQDLRVDLPAVGPRTVRAAAA 242

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AG AGIA+ AG +L+L++      AD  G+F+ G++ 
Sbjct: 243 AGCAGIAVGAGDTLILDRGETAALADALGLFLIGLEA 279


>gi|126462141|ref|YP_001043255.1| hypothetical protein Rsph17029_1373 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103805|gb|ABN76483.1| protein of unknown function DUF1009 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 273

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 94/280 (33%), Positives = 138/280 (49%), Gaps = 10/280 (3%)

Query: 1   MKR--LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVL 57
           M R    IIAGSG LP ++A+A R   +  ++A++          D   R   L  F   
Sbjct: 1   MTRATTAIIAGSGDLPRHLAEALRSAGEALLVAALEGFPPEGLAPDITFRVERLVPF--- 57

Query: 58  RSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
              L +  + R+V AGA+  RP +    F    +  + ++I  +   G+ A L+A I + 
Sbjct: 58  LRALEEAGVSRLVFAGAVS-RPRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIF 115

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG 177
           E  G SV G  EI P+L+   G L    P+   +RD   A    EA+  +DVGQ AV   
Sbjct: 116 EEEGFSVAGVAEIAPDLVPDAGILCG-TPSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQ 174

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQN 237
           G  +A+E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV  
Sbjct: 175 GLCLAVEALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVAR 233

Query: 238 VIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
              AGLAG+  EAG  ++L++    + A+EAG+F+   + 
Sbjct: 234 AAAAGLAGLVWEAGGVILLDRAEAVRAAEEAGLFLWAREP 273


>gi|221639131|ref|YP_002525393.1| hypothetical protein RSKD131_1032 [Rhodobacter sphaeroides KD131]
 gi|221159912|gb|ACM00892.1| Hypothetical Protein RSKD131_1032 [Rhodobacter sphaeroides KD131]
          Length = 273

 Score =  208 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 92/274 (33%), Positives = 136/274 (49%), Gaps = 8/274 (2%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQ 63
            IIAGSG LP ++A+A R   +  ++A++          D   R   L  F      L  
Sbjct: 7   AIIAGSGALPRHLAEALRSAGEALLVAALEGFSPEGLAPDITFRVERLVPF---LRALEA 63

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
            ++ R+V AGA+  RP +    F    +  + ++I  +   G+ A L+A I + E  G S
Sbjct: 64  ESVTRLVFAGAVS-RPRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIFEEEGFS 121

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V G  EI P+L+   G L    P+   +RD   A    EA+  +DVGQ AV   G  +A+
Sbjct: 122 VAGVAEIAPDLVPDAGILCG-APSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQGLCLAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV     AGL
Sbjct: 181 EALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARAAAAGL 239

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AG+  EAG  ++L++    + A+EAG+F+   + 
Sbjct: 240 AGLVWEAGGVILLDRAEAVRAAEEAGLFLWAREP 273


>gi|332558145|ref|ZP_08412467.1| hypothetical protein RSWS8N_03800 [Rhodobacter sphaeroides WS8N]
 gi|332275857|gb|EGJ21172.1| hypothetical protein RSWS8N_03800 [Rhodobacter sphaeroides WS8N]
          Length = 273

 Score =  208 bits (531), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 88/273 (32%), Positives = 134/273 (49%), Gaps = 6/273 (2%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQY 64
            IIAGSG LP ++A+A R   + P++A++                 +         L + 
Sbjct: 7   AIIAGSGALPRHLAEALRSAGEAPLVAALEGFPPEGLA--PDIIFRVERLVPFLRALEEA 64

Query: 65  NIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSV 124
            + R+V AGA+  RP +    F    +  + ++I  +   G+ A L+A I + E  G SV
Sbjct: 65  GVSRLVFAGAVS-RPRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIFEEEGFSV 122

Query: 125 VGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALE 184
            G  +I P+L+   G L    P+   +RD   A    EA+  +DVGQ AV   G  +A+E
Sbjct: 123 AGVAKIAPDLVPGAGILCG-TPSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQGLCLAVE 181

Query: 185 GIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLA 244
            + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV     AGLA
Sbjct: 182 ALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARAAAAGLA 240

Query: 245 GIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           G+  EAG  ++L++    + A+EAG+F+   + 
Sbjct: 241 GLVWEAGGVILLDRAEAVRAAEEAGLFLWAREP 273


>gi|77463267|ref|YP_352771.1| hypothetical protein RSP_2715 [Rhodobacter sphaeroides 2.4.1]
 gi|77387685|gb|ABA78870.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 273

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 93/274 (33%), Positives = 137/274 (50%), Gaps = 8/274 (2%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDW-QDFECRELPLGDFCVLRSILHQ 63
            IIAGSG LP ++A+A R   + P++A++          D   R   L  F      L +
Sbjct: 7   AIIAGSGALPRHLAEALRSAGEAPLVAALEGFPPEGLAPDITFRVERLVPF---LRALEE 63

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             + R+V AGA+  RP +    F    +  + ++I  +   G+ A L+A I + E  G S
Sbjct: 64  ARVARLVFAGAVS-RPRLDPSLFDPLTAQMVPRLIGAM-QAGDDATLRAVIGIFEEEGFS 121

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V G  EI P+L+   G L    P+   +RD   A    EA+  +DVGQ AV   G  +A+
Sbjct: 122 VAGVAEIAPDLVPDAGILWG-APSEGDRRDAARAAAIVEAVGRVDVGQGAVVAQGLCLAV 180

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E + GTD+ML  +          AG  GVL K  K  QD R DLP++G  TV     AGL
Sbjct: 181 EALPGTDAMLDWVAATARRPDP-AGARGVLYKAPKPGQDRRIDLPTLGPATVARAAAAGL 239

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVCGIDR 277
           AG+  EAG  ++L++    + A+EAG+F+   + 
Sbjct: 240 AGLVWEAGGVILLDRAEAVRAAEEAGLFLWAREP 273


>gi|260575876|ref|ZP_05843871.1| protein of unknown function DUF1009 [Rhodobacter sp. SW2]
 gi|259021802|gb|EEW25103.1| protein of unknown function DUF1009 [Rhodobacter sp. SW2]
          Length = 268

 Score =  201 bits (513), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 86/272 (31%), Positives = 134/272 (49%), Gaps = 9/272 (3%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+     A      ++ P++AS+        +        L     L   L 
Sbjct: 4   RLAIIAGRGL---LPAALVAALDEAPLVASLDGFLPEGLE--PDLVFRLERLVPLLRHLE 58

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V AGA+ +RP +    F    +  + +++  +  GG+ A L+A + + E  G 
Sbjct: 59  DSGVTRVVFAGAV-QRPRLDPALFDAATAQMVPRLLGAM-QGGDDAALRAVVGVFEEAGF 116

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GA +I P L+   G +    P    +RD   A +   AL  +DVGQ AV   G  +A
Sbjct: 117 QVLGAADIAPALVPGAGVICG-QPTPADERDAARAAQIVAALGAVDVGQGAVVAQGLCLA 175

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +E + GTD+ML+ +          A K G+L K  K  QD+R DLP++G +TVQ    AG
Sbjct: 176 VESLPGTDAMLEFVAATAQRPNPAAAK-GLLYKAPKPGQDLRIDLPTLGVQTVQKAAAAG 234

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274
           LAGI  +AG  +VL+   ++  A+ AG+F+  
Sbjct: 235 LAGIVWQAGGVIVLQPAAMQAAAEAAGLFLWA 266


>gi|254455326|ref|ZP_05068755.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082328|gb|EDZ59754.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 261

 Score =  200 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 61/231 (26%), Positives = 119/231 (51%), Gaps = 11/231 (4%)

Query: 42  QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQL 101
           +D     + +G F  + +++ + N  +++ AG I + P    L   +K    +  +I + 
Sbjct: 39  KDVNSHRISIGKFGNIINLIKEKNSNKVLFAGKIAK-PKFSSLRLDLKGIYYMPSVI-KA 96

Query: 102 VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSA 161
              G+AAI+K+ I +L++ G+ V+ +     EL ++ G+     PN +    I   +   
Sbjct: 97  SKLGDAAIIKSIIKILDNEGIKVISSIYFNKELALKAGNYSKLKPNINELNSIKKGVVYF 156

Query: 162 EALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQ 221
           + L  LD  Q+ +     ++A EG +GT  ML ++             +G+L+K+ K +Q
Sbjct: 157 KKLKSLDHVQAIIVKNNSILATEGKQGTKKMLSKLNK---------NSNGILIKLPKPKQ 207

Query: 222 DMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFV 272
           D+R DLP+IG  T+++  K GL GI L++ +++ L+K+     A++  IF+
Sbjct: 208 DLRMDLPTIGINTLKDCKKFGLKGIVLKSKQNIFLDKDKCINFANKNKIFI 258


>gi|319789883|ref|YP_004151516.1| protein of unknown function DUF1009 [Thermovibrio ammonificans
           HB-1]
 gi|317114385|gb|ADU96875.1| protein of unknown function DUF1009 [Thermovibrio ammonificans
           HB-1]
          Length = 256

 Score =  197 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 69/256 (26%), Positives = 124/256 (48%), Gaps = 13/256 (5%)

Query: 8   AGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG--DFCVLRSILHQYN 65
           AG+G LP    K+AR + +  +  ++    + + ++     + +           + +  
Sbjct: 2   AGAGKLPVEFLKSARERGEAVITFALEGITNPEVEELSDEVVWIKPFKLGKFFKEVERRR 61

Query: 66  IGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVV 125
             +  + G ++ +  V          L+    + +L       I+   I+ LE  GV V 
Sbjct: 62  PAKFFLLGKVEHKAAVD----LKGLDLKAISFLMKLKDRKPQTIIIGIIEELEKRGVKVA 117

Query: 126 GAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEG 185
                +  LL+  G +    P+ +V  D+   M+ A+ ++ LD+GQ+ V     V+A+EG
Sbjct: 118 NPESYLKRLLLTKGEIIGKPPSEEVLEDLKFGMEIAKEIASLDIGQTVVVKNKTVIAVEG 177

Query: 186 IEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAG 245
           IEGTD  ++R       G  LAGK  V+ K  + +QDMR D+P++G KTV+ +   G  G
Sbjct: 178 IEGTDECIKR-------GAALAGKGFVVCKAARREQDMRVDVPTVGIKTVKLIETLGGKG 230

Query: 246 IALEAGKSLVLEKELV 261
           +A+EAGK+ +L++E V
Sbjct: 231 LAVEAGKTYLLDRERV 246


>gi|71083615|ref|YP_266334.1| hypothetical protein SAR11_0918 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062728|gb|AAZ21731.1| Protein of unknown function (DUF1009) [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 261

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 67/269 (24%), Positives = 119/269 (44%), Gaps = 12/269 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +  G       V K  +  N    I        F   D     + +G F  +  ++ +
Sbjct: 2   IGLFLGDTDFSEAVLKNIKKLNKRYFIIDFSKNNKFK-NDINSNRISIGKFGKIIDLIKE 60

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
               +++ AG I + P    L   +K  +     I +    G+AAI+KA I +L++  + 
Sbjct: 61  KKSKKVLFAGKIAK-PKFSTLRLDLKG-IYYMPSILKAAKLGDAAIIKAIIKILDNEKIK 118

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+ +    PEL V+ G+      NR     I   +     L  LD  Q+ +     ++A+
Sbjct: 119 VLSSVFFNPELTVKRGNYTKLKANRKDINSIKMGITYFNKLKSLDHVQAIIVKDNTILAI 178

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E  +GT          +   ++     G+L+K+ K +QD+R DLP+IG +T+++  K GL
Sbjct: 179 EDQQGT---------KKMLSKLKKKSEGILIKLPKKKQDLRMDLPTIGLQTLKDCKKYGL 229

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
            GI L + K++ L+K      A++  IFV
Sbjct: 230 KGIVLRSKKNIFLDKAKCIAFANKNKIFV 258


>gi|91761964|ref|ZP_01263929.1| hypothetical protein PU1002_01826 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91717766|gb|EAS84416.1| hypothetical protein PU1002_01826 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 261

 Score =  192 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 66/269 (24%), Positives = 121/269 (44%), Gaps = 12/269 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +  G       V K  +  N    I        F   D     + +G F  + +++ +
Sbjct: 2   IGLFLGDTDFSEAVLKNIKKLNKRYFIIDFSKNNKFK-NDINSNRISIGKFGKIINLIKE 60

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
               +++ AG I + P    L   +K  +     I +    G+AAI+KA I +L++  + 
Sbjct: 61  KKSKKVLFAGKIAK-PKFSTLRLDLKG-IYYMPSILKAAKLGDAAIIKAIIKILDNEKIK 118

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V+ +    PEL V+ G+      N+     I   +     L  LD  Q+ +     ++A+
Sbjct: 119 VLSSVFFNPELTVKRGNYTKLKANKSDINSIKMGITYFNKLKSLDHVQAIIVKNDTIIAI 178

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E  +GT          +   ++     G+L+K+ K +QD+R DLP+IG +T+++  K GL
Sbjct: 179 EDHQGT---------KKMLSKLKKKSEGILIKLPKKKQDLRMDLPTIGLQTLKDCKKYGL 229

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFV 272
            GI L++ K++ L+K      A++  IFV
Sbjct: 230 KGIVLKSKKNIFLDKAKSIAFANKNKIFV 258


>gi|218662215|ref|ZP_03518145.1| hypothetical protein RetlI_23447 [Rhizobium etli IE4771]
          Length = 165

 Score =  191 bits (487), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 100/159 (62%), Positives = 118/159 (74%)

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G  VVGAHEI P+LL  VG LG  VP  + +RD   A ++AE L  LDVGQ AVSIGGRV
Sbjct: 1   GRRVVGAHEIAPDLLAAVGPLGAVVPGEEDRRDTNRAAEAAETLGRLDVGQGAVSIGGRV 60

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEG+EGTD ML R+   R  GRI   + GVLVK+CK QQD+RADLP+IG  TV N +K
Sbjct: 61  VALEGLEGTDDMLDRVAGLRAAGRISPRRRGVLVKLCKPQQDIRADLPAIGVSTVLNAVK 120

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREF 279
           AGLAGIA+EAG+SLVL++  V + ADEAG+FVCGIDR  
Sbjct: 121 AGLAGIAVEAGRSLVLDRAAVIRAADEAGLFVCGIDRGL 159


>gi|254443489|ref|ZP_05056965.1| conserved hypothetical protein [Verrucomicrobiae bacterium DG1235]
 gi|198257797|gb|EDY82105.1| conserved hypothetical protein [Verrucomicrobiae bacterium DG1235]
          Length = 278

 Score =  187 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 57/258 (22%), Positives = 112/258 (43%), Gaps = 16/258 (6%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFD----WQDFECRELPLGDFCVLRS 59
           + +IAG G+ P  VA+ A     +  + +   E + +    +   +   + +G       
Sbjct: 15  VGLIAGRGVYPRLVAEKALAAGIDLRLIAFEGEAAAETIDLFPADKRAIINVGKVGTWLK 74

Query: 60  ILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLES 119
            L +++    + AG +      +DL   +K +  + K+  +        I  A  D L +
Sbjct: 75  ALRKFDCRYTIAAGQVKPGKLFRDLKPDVKAAALLLKLKRKNA----HTIFGAIADELAA 130

Query: 120 YGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179
            G + + A   + + +   G +       +    I   ++ A+ ++ LDVGQ  V   G 
Sbjct: 131 NGQTALDARSFLDDQMATPGHMTKAYEKIEDTY-IQHGIEIAQEMARLDVGQGVVVRKGT 189

Query: 180 VVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVI 239
           V+A+E  EGTD ML+R    + +         + VK  K +QD R D+P  G +T++ + 
Sbjct: 190 VLAVEAFEGTDPMLKRAGTFKTD-------QLIFVKTVKREQDYRFDVPVFGLRTLEIMA 242

Query: 240 KAGLAGIALEAGKSLVLE 257
           +  +    L+AG  +++E
Sbjct: 243 EQNIRTAVLKAGDVIMVE 260


>gi|294677173|ref|YP_003577788.1| hypothetical protein RCAP_rcc01636 [Rhodobacter capsulatus SB 1003]
 gi|294475993|gb|ADE85381.1| protein of unknown function DUF1009 [Rhodobacter capsulatus SB
           1003]
          Length = 247

 Score =  172 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 77/248 (31%), Positives = 122/248 (49%), Gaps = 9/248 (3%)

Query: 27  EPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCF 86
           E ++ ++  + +        R   L  F      L    I R+  AGA+ +RP ++   F
Sbjct: 6   EMLVCALEGQPAPGGSVLPFRIERLVPF---LDALADRGIRRVCFAGAM-QRPKLEPELF 61

Query: 87  SIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVP 146
             + +  + +++  + + G+ A L+A I L E +   V+GA EI P L+   G L   V 
Sbjct: 62  DARTAALVPRLLGAMRA-GDDATLRAVIALFEDWDFEVIGADEIAPALVPGDGLLCGSVG 120

Query: 147 NRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRIL 206
           ++D   D   A +   AL  +DVG+     G   + +E + GTD++L  +   R  G + 
Sbjct: 121 DQDQL-DAARAAEIVAALGAVDVGRGGGPPGLC-LGVEALPGTDALLDFVAAHR--GLVP 176

Query: 207 AGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHAD 266
             K+GV  K  K  QD R DLP++G +TV  V  AGL GI  EAG  L+L++      A+
Sbjct: 177 MPKAGVFFKAPKPGQDRRIDLPALGPQTVARVAAAGLCGIVFEAGGVLLLDRAATIAAAE 236

Query: 267 EAGIFVCG 274
            AGIF+ G
Sbjct: 237 AAGIFLWG 244


>gi|310816022|ref|YP_003963986.1| hypothetical protein EIO_1560 [Ketogulonicigenium vulgare Y25]
 gi|308754757|gb|ADO42686.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 261

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 79/270 (29%), Positives = 123/270 (45%), Gaps = 12/270 (4%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILHQ 63
           + +I G+G LP  +A A +  +   ++  +      D  D       +     L + L  
Sbjct: 2   IALIGGTGALPPALAAALQAADRPFLLCEMAGFPFDDMADLPRHTFRVEQIGTLLADLRA 61

Query: 64  YNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVS 123
             +  + +AGAI RRP           +  I   +   ++ G+ A+L+A + + E  G  
Sbjct: 62  KGVTEVCLAGAI-RRPAFDPAAIDAATA-PILARLAPAMAQGDDALLRAVVGVFEGAGFI 119

Query: 124 VVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVAL 183
           V GAH++ P LL + G LG      D   D   A    +AL+  DVGQ+ V   G+V+A+
Sbjct: 120 VRGAHDLAPALLPKAGVLGRVQLRPD--GDATRAAAVHDALAASDVGQALVVRRGQVLAI 177

Query: 184 EGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGL 243
           E   GTD ML  +               +  K  K+ QD+R DLP +G  TV    KAG+
Sbjct: 178 EASFGTDFMLDTM--------EGRAGGALFYKAPKAGQDLRIDLPVVGPDTVARAAKAGI 229

Query: 244 AGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           A IA+ AG  ++L++      AD AGI + 
Sbjct: 230 ACIAIAAGGVMILDQTATIAAADAAGISLW 259


>gi|218680512|ref|ZP_03528409.1| hypothetical protein RetlC8_17140 [Rhizobium etli CIAT 894]
          Length = 142

 Score =  167 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 81/136 (59%), Positives = 100/136 (73%)

Query: 144 CVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNG 203
             P  + +RDI  A ++AE L  LD+GQ AVSIGGRVVALEG+EGTD ML+R+   R  G
Sbjct: 1   VAPGEEDRRDIARAAEAAETLGRLDIGQGAVSIGGRVVALEGLEGTDEMLERVAGLRAAG 60

Query: 204 RILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKK 263
           RI   + G LVK+CK QQD+RADLP+IG  T+ N  +AGL GIA+EAG+SLVL++  V K
Sbjct: 61  RISPRRRGALVKLCKPQQDIRADLPAIGVSTILNAKRAGLGGIAVEAGRSLVLDRAAVIK 120

Query: 264 HADEAGIFVCGIDREF 279
            ADEAG+FVCGIDR  
Sbjct: 121 VADEAGLFVCGIDRGL 136


>gi|330814020|ref|YP_004358259.1| hypothetical protein SAR11G3_01045 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487115|gb|AEA81520.1| hypothetical protein SAR11G3_01045 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 184

 Score =  165 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 56/183 (30%), Positives = 89/183 (48%), Gaps = 4/183 (2%)

Query: 95  SKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDI 154
            K+I  L   G++  L   I+ L+   + VV   + +PELL     +     ++   RDI
Sbjct: 5   PKIILSLK-KGDSHALDFVINYLKLINMKVVSCTKYLPELLA-ENFVNKFKLSKQDSRDI 62

Query: 155 LAAMKSAEAL-SELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVL 213
                    +  + DVGQS +   G V+ +E  EGTD M+ +              SGVL
Sbjct: 63  EKGKAILNHVNKKYDVGQSIIVNKGLVIGIEAAEGTDEMILKSSSIMKKINKKM-PSGVL 121

Query: 214 VKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +K+ K  QD+R DLP+IG  T++N IK GL GIAL+  +++ L++        +   F+ 
Sbjct: 122 IKVPKKIQDLRVDLPTIGYDTIRNCIKIGLRGIALKKNQNIFLDQTKSSDLIKKNNFFIT 181

Query: 274 GID 276
            I+
Sbjct: 182 VIN 184


>gi|170785432|gb|ACB37712.1| phosphatidate cytidyltransferase [Candidatus Liberibacter
           asiaticus]
          Length = 122

 Score =  135 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 115/116 (99%), Positives = 115/116 (99%)

Query: 86  FSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCV 145
           FSIKDSLRISKMIWQLVSGGNAAILKASID LESYGVSVVGAHEIVPELLVQVGSLGTCV
Sbjct: 7   FSIKDSLRISKMIWQLVSGGNAAILKASIDFLESYGVSVVGAHEIVPELLVQVGSLGTCV 66

Query: 146 PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN 201
           PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN
Sbjct: 67  PNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN 122


>gi|87308230|ref|ZP_01090371.1| hypothetical protein DSM3645_11706 [Blastopirellula marina DSM
           3645]
 gi|87288787|gb|EAQ80680.1| hypothetical protein DSM3645_11706 [Blastopirellula marina DSM
           3645]
          Length = 178

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 47/148 (31%), Gaps = 7/148 (4%)

Query: 5   LIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDF--ECRELPLGDFCVLRSILH 62
            ++AG G LP  +A A +          +         +       + LG         H
Sbjct: 13  GVLAGWGQLPIEMATALQRHGYAVHALLIKGHADPILAEISATHEWVGLGQIGKCVRFFH 72

Query: 63  QYNIGRIVVAGAIDRRPNVQ-----DLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLL 117
           ++ +    + G + +   +      +       +  I+  I       +  IL       
Sbjct: 73  RHQVTTATMVGKVHKVRILDRGALWNHFPDWYGARVIAPFILGKKDRKDDTILSGICRAF 132

Query: 118 ESYGVSVVGAHEIVPELLVQVGSLGTCV 145
            + G+  V A +  P+LLV+ G L    
Sbjct: 133 SNKGIEFVPATDYAPDLLVKFGQLAGKP 160


>gi|170785431|gb|ACB37711.1| lipid A biosynthesis
           acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
           O-acyltransferase [Candidatus Liberibacter asiaticus]
          Length = 363

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL
Sbjct: 277 KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 336

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCF 86
           HQYNIGRIVVAGAIDRRPNVQDLCF
Sbjct: 337 HQYNIGRIVVAGAIDRRPNVQDLCF 361


>gi|218515875|ref|ZP_03512715.1| hypothetical protein Retl8_20421 [Rhizobium etli 8C-3]
          Length = 106

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 63/96 (65%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L  +L+
Sbjct: 11  RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAIIGIGDFAALDGLLN 70

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMI 98
           +Y IGR+V++G++ RRP  +++  +++  +++   I
Sbjct: 71  RYGIGRVVMSGSVRRRPEWREVRPTLRILMKVPAAI 106


>gi|255624344|ref|XP_002540464.1| conserved hypothetical protein [Ricinus communis]
 gi|223495547|gb|EEF21920.1| conserved hypothetical protein [Ricinus communis]
          Length = 88

 Score = 96.3 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 52/87 (59%), Gaps = 1/87 (1%)

Query: 192 MLQRIVDCRNNGRILA-GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEA 250
           ML+R+ D     R       GVL K  K  Q+ + DLP+IG  T+Q   +AGLAG+  EA
Sbjct: 1   MLRRVADLPQAIRGCPEAPKGVLAKAPKPIQETKVDLPTIGVATIQRAARAGLAGVVGEA 60

Query: 251 GKSLVLEKELVKKHADEAGIFVCGIDR 277
           G+ L+++++ V   AD+ G+FV G++ 
Sbjct: 61  GRLLIVDRDQVIACADDLGLFVYGVEP 87


>gi|329850629|ref|ZP_08265474.1| hypothetical protein ABI_35380 [Asticcacaulis biprosthecum C19]
 gi|328840944|gb|EGF90515.1| hypothetical protein ABI_35380 [Asticcacaulis biprosthecum C19]
          Length = 346

 Score = 94.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 43/71 (60%)

Query: 204 RILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKK 263
             +A + GVL K+ K  QD+R D+P+IG  T+++   +GL+GI   AG  LV++K     
Sbjct: 273 GSIAHRKGVLAKLAKPIQDLRLDMPTIGVSTIEDAAASGLSGIVARAGHLLVVDKTATHA 332

Query: 264 HADEAGIFVCG 274
            A E G+F+ G
Sbjct: 333 RAAELGVFLYG 343


>gi|23011424|ref|ZP_00051785.1| hypothetical protein Magn03006056 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 201

 Score = 94.8 bits (235), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 8/171 (4%)

Query: 2   KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
           + L ++AG+G LP  VA +         + +V        +      + L D      IL
Sbjct: 6   RPLALVAGTGRLPELVAASLDAARRPFRVLAVRGFTERAMRRRADAVVDLLDIPGTLRIL 65

Query: 62  HQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
            ++    ++ AG +  RP+   L  +   ++R   ++  L +GG+  +L+A + LLE  G
Sbjct: 66  KEWAPAAVIPAGGVA-RPSPAALL-NAAHAVRNRDLLKSL-AGGDDRLLRAVLSLLEENG 122

Query: 122 VSVVGAHEIVPELLVQVGSLGTCVPNRD---VKRDILAAMKSAEALSELDV 169
             V+G HE+ P+LL +VG   +          + D       +   +  DV
Sbjct: 123 HRVLGVHEVAPDLLGRVG--TSRPAGTRCRGSRLDRHRGGPCSARSAPFDV 171


>gi|18252653|gb|AAL66378.1|AF461795_6 unknown [Bartonella henselae]
          Length = 93

 Score = 85.5 bits (211), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 39/81 (48%)

Query: 3  RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
          R  IIAG+G+LP  +A+        P +  + +E       +E  EL + +   L  IL 
Sbjct: 13 RTAIIAGNGVLPITIAQELEKNGQNPFLVLLRDEADALLYRYEHCELSIVELARLVKILK 72

Query: 63 QYNIGRIVVAGAIDRRPNVQD 83
             I  IV+AG + RRP ++ 
Sbjct: 73 AAEICNIVLAGGVKRRPLLKQ 93


>gi|295112059|emb|CBL28809.1| hypothetical protein [Synergistetes bacterium SGP1]
          Length = 130

 Score = 80.5 bits (198), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 52/125 (41%), Gaps = 7/125 (5%)

Query: 4   LLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSF-DWQDFECRELPLGDFCVLRSILH 62
           + +IAG G LP  +A+      + P++ +V ++             L           + 
Sbjct: 10  IALIAGEGALPEAIARKLAEAGEAPLVLAVRDDLEALAPFARRLVRLRWPSLGRGVREMR 69

Query: 63  QYNIGRIVVAGAIDRRPN-VQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYG 121
           ++  GR+++AG I +R      L F      R+S+ +       + ++L A +  LE  G
Sbjct: 70  RFGAGRVIMAGWIPKRVIYFLPLLFD-----RLSRSVLAGSLMDDHSLLGAVVRALEREG 124

Query: 122 VSVVG 126
            SV+ 
Sbjct: 125 FSVIP 129


>gi|218678928|ref|ZP_03526825.1| hypothetical protein RetlC8_08599 [Rhizobium etli CIAT 894]
          Length = 68

 Score = 67.8 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 35/55 (63%)

Query: 3  RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVL 57
          RL IIAG G+LP YVA+AAR   + PVI ++ +E    W+ ++   + +GDF  L
Sbjct: 11 RLAIIAGGGLLPSYVAEAARAAGENPVIVALKDESDRRWEGYDHAVVGIGDFAAL 65


>gi|321314379|ref|YP_004206666.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           BSn5]
 gi|320020653|gb|ADV95639.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           BSn5]
          Length = 512

 Score = 49.7 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 PN     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPNEQEWEDLKLAWKVVKHVKSNAI---VLAKDNMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S+    E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAYFPMP----DTVEEAAKAGVTAI-IQPGGSI--RDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|221308489|ref|ZP_03590336.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221312811|ref|ZP_03594616.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221317735|ref|ZP_03599029.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221322013|ref|ZP_03603307.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|255767168|ref|NP_388534.2| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|251757315|sp|P12048|PUR9_BACSU RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|225184795|emb|CAB12472.2| fused phosphoribosylaminoimidazole carboxy formyl
           formyltransferase; inosine-monophosphate cyclohydrolase
           [Bacillus subtilis subsp. subtilis str. 168]
          Length = 512

 Score = 49.7 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 PN     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPNEQEWEDLKLAWKVVKHVKSNAI---VLAKDNMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S+    E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAYFPMP----DTVEEAAKAGVTAI-IQPGGSI--RDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|143373|gb|AAA22683.1| phosphoribosyl aminoimidazole carboxy formyl
           formyltransferase/inosine monophosphate cyclohydrolase
           (PUR-H(J)) [Bacillus subtilis]
          Length = 512

 Score = 49.7 bits (118), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 PN     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPNEQEWEDLKLAWKVVKHVKSNAI---VLAKDNMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S+    E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAYFPMP----DTVEEAAKAGVTAI-IQPGGSI--RDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|52079136|ref|YP_077927.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           licheniformis ATCC 14580]
 gi|52784504|ref|YP_090333.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           licheniformis ATCC 14580]
 gi|319647088|ref|ZP_08001314.1| IMP cyclohydrolase [Bacillus sp. BT1B_CT2]
 gi|52002347|gb|AAU22289.1| phosphoribosylaminoimidazole carboxy formyl formyltransferase and
           inosine-monophosphate cyclohydrolase [Bacillus
           licheniformis ATCC 14580]
 gi|52347006|gb|AAU39640.1| PurH [Bacillus licheniformis ATCC 14580]
 gi|317390912|gb|EFV71713.1| IMP cyclohydrolase [Bacillus sp. BT1B_CT2]
          Length = 512

 Score = 49.3 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 43/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P      D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 389 IPTKREPTEQEWADLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|296330109|ref|ZP_06872591.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305673354|ref|YP_003865026.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296152698|gb|EFG93565.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305411598|gb|ADM36717.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 512

 Score = 49.3 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPSEQEWEDLKLAWKVVKHVKSNAI---VLAKDNMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|304439851|ref|ZP_07399745.1| bifunctional purine biosynthesis protein PurH [Peptoniphilus
           duerdenii ATCC BAA-1640]
 gi|304371590|gb|EFM25202.1| bifunctional purine biosynthesis protein PurH [Peptoniphilus
           duerdenii ATCC BAA-1640]
          Length = 505

 Score = 48.9 bits (116), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 37/248 (14%), Positives = 79/248 (31%), Gaps = 54/248 (21%)

Query: 42  QDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISK---MI 98
           + +EC +  +  F  + ++  + ++    +   I     V          L   K    +
Sbjct: 287 KAYECDDESI--FGGIIALNREVDLETAEMLSKIFLEIVVAPSFAKDAYELLAKKKNIRL 344

Query: 99  WQLVSGGNAAILKASIDLLESYGVSVVGAH--EIVPELLVQVGSLGTCVPNRDVKRDILA 156
            ++    +  I  +  ++L   G+ V      ++  + L     +    P  +  +++  
Sbjct: 345 IEMPRINDFEIKMSVKEVL--NGLIVQEYDNVDLDEDKL---EVVTKRKPTEEEMKELRF 399

Query: 157 AMKSAEAL-----------SELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGRI 205
           A  + +A              L +GQ       R  A+E        L+R  D       
Sbjct: 400 AWTAVKASASNSVVVAKNGGTLGIGQG---QTKRSWAVE------EALERAGDKIE--GA 448

Query: 206 LAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHA 265
           +    G   K                  T++ + K G+  I +E G S  ++   V + A
Sbjct: 449 VFASDGFFFK-----------------DTMELLNKYGIKAI-IEPGGS--VKDPEVIEFA 488

Query: 266 DEAGIFVC 273
           D   + V 
Sbjct: 489 DAHDMSVV 496


>gi|311067125|ref|YP_003972048.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           atrophaeus 1942]
 gi|310867642|gb|ADP31117.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           atrophaeus 1942]
          Length = 512

 Score = 48.9 bits (116), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 45/134 (33%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 PN    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPNEQEWKDLKLAWKVVKHVKSNAI---VLAKDNMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|307244083|ref|ZP_07526202.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Peptostreptococcus stomatis DSM 17678]
 gi|306492607|gb|EFM64641.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Peptostreptococcus stomatis DSM 17678]
          Length = 510

 Score = 48.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 49/143 (34%), Gaps = 22/143 (15%)

Query: 134 LLVQVG-SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSM 192
           LL      +    P  D  +D+   MK A+ L    +   A+   G+ +A+ G   T  +
Sbjct: 378 LLADKNEVVTKAQPTADQLKDMEFGMKVAKNLKSNAI---AIVKDGQTLAV-GCGQTSRI 433

Query: 193 LQRIVDCRNNGRILAGKSGVLVK-MCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAG 251
                   NN      +  VL             D        V+   + G+  I ++ G
Sbjct: 434 WALSNAIENNKNEKNFEGAVLASDAFFP-----FD------DCVRLAAEHGIKAI-VQPG 481

Query: 252 KSLVLEKEL-VKKHADEAGIFVC 273
            S+   ++    K  DE GI + 
Sbjct: 482 GSI---RDEDSIKACDELGISMV 501


>gi|147669864|ref|YP_001214682.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Dehalococcoides
           sp. BAV1]
 gi|146270812|gb|ABQ17804.1| phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP
           cyclohydrolase [Dehalococcoides sp. BAV1]
          Length = 513

 Score = 48.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 60/195 (30%), Gaps = 38/195 (19%)

Query: 94  ISKMIWQLVSGGNAAILKASIDLLESY---------------GVSVVGAHEIVPELLVQV 138
             + +  L +  +   L+  I  L  +               G+ V  A E+     VQ 
Sbjct: 333 EPEALEFLKTRKD---LRILIAELPKHNEAETRSLDYRRVKGGLLVQAADELAEN-AVQT 388

Query: 139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD 198
             +    P  +   D+  A ++ + +       + V     V+          M     +
Sbjct: 389 KVVTKREPTPEEMSDLKFAWRAVKHIKS----NAIVLAKNNVLL--------GMGAGQPN 436

Query: 199 CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
              +  I   K+G   K      D     P     +V+    AG+  I ++ G S+    
Sbjct: 437 RVVSVDIAKSKAGEASKGSVMASDAMFPFP----DSVEQAAAAGVTAI-IQPGGSI--RD 489

Query: 259 ELVKKHADEAGIFVC 273
           +     A++  I + 
Sbjct: 490 QESIDAANKHNIAMV 504


>gi|291483090|dbj|BAI84165.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus subtilis
           subsp. natto BEST195]
          Length = 512

 Score = 48.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 PN     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPNEQEWEDLKLAWKVVKHVKSNAI---VLAKDNMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|73749102|ref|YP_308341.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Dehalococcoides
           sp. CBDB1]
 gi|289433078|ref|YP_003462951.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Dehalococcoides sp. GT]
 gi|73660818|emb|CAI83425.1| phosphoribosylaminoimidazolecarboxamide formyltransferase
           [Dehalococcoides sp. CBDB1]
 gi|288946798|gb|ADC74495.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Dehalococcoides sp. GT]
          Length = 513

 Score = 48.5 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/195 (15%), Positives = 60/195 (30%), Gaps = 38/195 (19%)

Query: 94  ISKMIWQLVSGGNAAILKASIDLLESY---------------GVSVVGAHEIVPELLVQV 138
             + +  L +  +   L+  I  L  +               G+ V  A E+     VQ 
Sbjct: 333 EPEALEFLKTRKD---LRILIAELPKHNEAETRSLDYRRVKGGLLVQAADELAEN-AVQT 388

Query: 139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD 198
             +    P  +   D+  A ++ + +       + V     V+          M     +
Sbjct: 389 KVVTKREPTPEEMSDLKFAWRAVKHIKS----NAIVLAKNNVLL--------GMGAGQPN 436

Query: 199 CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
              +  I   K+G   K      D     P     +V+    AG+  I ++ G S+    
Sbjct: 437 RVVSVDIAKSKAGEASKGSVMASDAMFPFP----DSVEQAAAAGVTAI-IQPGGSI--RD 489

Query: 259 ELVKKHADEAGIFVC 273
           +     A++  I + 
Sbjct: 490 QESIDAANKHNIAMV 504


>gi|308172537|ref|YP_003919242.1| bifunctional phosphoribosylaminoimidazole carboxy formyl
           formyltransferase/inosine-monophosphate cyclohydrolase
           [Bacillus amyloliquefaciens DSM 7]
 gi|307605401|emb|CBI41772.1| fused phosphoribosylaminoimidazole carboxy formyl
           formyltransferase; inosine-monophosphate cyclohydrolase
           [Bacillus amyloliquefaciens DSM 7]
          Length = 512

 Score = 48.2 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPSEQEWEDLKLAWKVVKHVKSNAI---VLAKDHMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|291195932|gb|ADD84679.1| PurH [Bacillus amyloliquefaciens]
 gi|328552301|gb|AEB22793.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           amyloliquefaciens TA208]
 gi|328910645|gb|AEB62241.1| Bifunctional purine biosynthesis protein purH [Bacillus
           amyloliquefaciens LL3]
          Length = 512

 Score = 47.8 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPSEQEWEDLKLAWKVVKHVKSNAI---VLAKDHMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|297616795|ref|YP_003701954.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Syntrophothermus lipocalidus DSM 12680]
 gi|297144632|gb|ADI01389.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Syntrophothermus lipocalidus DSM 12680]
          Length = 507

 Score = 47.8 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 54/160 (33%), Gaps = 30/160 (18%)

Query: 119 SYGVSVVGA--HEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSI 176
             G  V  A  HE++P  L     +   VP  +   ++L A K  + +    +    V+ 
Sbjct: 364 EGGFVVQEADRHELLPAELT---VVTDRVPTPEEMENLLFAWKVVKHVKSNAI---VVAK 417

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRILA--GKSGVLVK-MCKSQQDMRADLPSIGAK 233
            G  + +   +     + R+   R          K  VL        +D           
Sbjct: 418 DGLTLGVGAGQ-----MNRVGAARLALEQAGERAKGAVLASDAFFPFKD----------- 461

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           TV+   + G+  I ++ G S+    +   +  +  GI + 
Sbjct: 462 TVELAAQYGITAI-IQPGGSI--RDQESIEECNRHGIAMV 498


>gi|154685149|ref|YP_001420310.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           amyloliquefaciens FZB42]
 gi|154351000|gb|ABS73079.1| PurH [Bacillus amyloliquefaciens FZB42]
          Length = 512

 Score = 47.0 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+     D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 389 IPTKREPSDQEWEDLKLAWKVVKHVKSNAI---VLAKDHMTVGVGAGQ-----MNRVGSA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+   KAG+  I ++ G S  +  E
Sbjct: 441 KIAIEQAGEK----AKGSALGSDAFFPMP----DTVEEAAKAGVTAI-IQPGGS--VRDE 489

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 490 DSIKKADEYGIAMV 503


>gi|17230585|ref|NP_487133.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Nostoc sp. PCC
           7120]
 gi|32171693|sp|Q8YSJ2|PUR9_ANASP RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|17132187|dbj|BAB74792.1| bifunctional purine biosynthesis protein [Nostoc sp. PCC 7120]
          Length = 506

 Score = 46.6 bits (110), Expect = 0.004,   Method: Composition-based stats.
 Identities = 36/181 (19%), Positives = 65/181 (35%), Gaps = 37/181 (20%)

Query: 102 VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSA 161
           +S G   ++K         G  V  A +I  +   Q   +    P  D   ++L A K  
Sbjct: 351 LSTGPKTLVKQIAG-----GFLVQAADDIAAD-TSQWQVVTERQPTPDELAELLFAWKVC 404

Query: 162 EALSELDVGQSAVSIGGRVVALEG-----IEGTDSMLQRIVDCRNNGRILAGKSGVLVKM 216
           + +    +    V+     + +       I  T   L++  D +  G ILA         
Sbjct: 405 KHVKSNAI---VVTSDRTTLGVGAGQMNRIGSTKIALEQAGD-KAKGAILASDGF----- 455

Query: 217 CKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI--FVCG 274
                    D       TV+    AG++ I ++ G SL  +++   K A+E G+   + G
Sbjct: 456 ------FPFD------DTVRTAAAAGISAI-VQPGGSL-RDQD-SVKAANELGLLMVLTG 500

Query: 275 I 275
           +
Sbjct: 501 V 501


>gi|260892227|ref|YP_003238324.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Ammonifex degensii KC4]
 gi|260864368|gb|ACX51474.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Ammonifex degensii KC4]
          Length = 511

 Score = 46.2 bits (109), Expect = 0.005,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 48/136 (35%), Gaps = 23/136 (16%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P  +   +++ A K  + +    +    VS   +V+ +   +     + R+   
Sbjct: 388 VVTKRQPTPEEMEELIFAFKVVKHVKSNAI---VVSKNRQVLGVGAGQ-----MNRVGAA 439

Query: 200 RNNGRILA--GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           R +        +  VL        D     P     TV+   +AG+  I ++ G S  + 
Sbjct: 440 RISLEQAGDRARGAVLAS------DAFFPFP----DTVELAARAGITAI-IQPGGS--VR 486

Query: 258 KELVKKHADEAGIFVC 273
            E   K ADE  I + 
Sbjct: 487 DEESIKVADEHNIAMV 502


>gi|75910022|ref|YP_324318.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Anabaena
           variabilis ATCC 29413]
 gi|123608546|sp|Q3M6G3|PUR9_ANAVT RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|75703747|gb|ABA23423.1| IMP cyclohydrolase [Anabaena variabilis ATCC 29413]
          Length = 506

 Score = 45.8 bits (108), Expect = 0.007,   Method: Composition-based stats.
 Identities = 37/181 (20%), Positives = 67/181 (37%), Gaps = 37/181 (20%)

Query: 102 VSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSA 161
           +S G   ++K         G  V  A +I  +  +Q   +    P  D   ++L A K  
Sbjct: 351 LSTGPKTLVKQIAG-----GFLVQAADDIAAD-TIQWQVVTERQPTADELAELLFAWKVC 404

Query: 162 EALSELDVGQSAVSIGGRVVALEG-----IEGTDSMLQRIVDCRNNGRILAGKSGVLVKM 216
           + +    +    V+     + +       I  T   L++  D +  G ILA         
Sbjct: 405 KHVKSNAI---VVTSDRTTLGVGAGQMNRIGSTKIALEQAGD-KAKGAILASDGF----- 455

Query: 217 CKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGI--FVCG 274
                    D       TV+    AG++ I ++ G SL  +++ V K A+E G+   + G
Sbjct: 456 ------FPFD------DTVRTAAAAGISAI-VQPGGSL-RDQDSV-KAANELGLLMVLTG 500

Query: 275 I 275
           +
Sbjct: 501 V 501


>gi|57242741|ref|ZP_00370678.1| purH bifunctional enzyme Cj0953c [Campylobacter upsaliensis RM3195]
 gi|57016670|gb|EAL53454.1| purH bifunctional enzyme Cj0953c [Campylobacter upsaliensis RM3195]
          Length = 510

 Score = 45.8 bits (108), Expect = 0.007,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 60/157 (38%), Gaps = 24/157 (15%)

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G     + EI    L++   +     +++  +D+  A+K A      +V   A    G +
Sbjct: 365 GFVYQNSDEIRENELLKAKCVSKKCASKEELKDLEIALKVAALTKSNNV---AYVKNGAL 421

Query: 181 VALEGIEGT---DSMLQRIVDCRNNGRILAGKSGVLV-KMCKSQQDMRADLPSIGAKTVQ 236
           VA+ G+  T   D+    I      G  L  +  VL  +     +D           ++ 
Sbjct: 422 VAI-GMGMTSRIDAAKAAIRKAEEMGLDL--RGCVLASEAFFPFRD-----------SID 467

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
              K G+  I ++ G S+  +   V K ADE GI + 
Sbjct: 468 EAAKVGVKAI-VQPGGSIRDD--EVIKAADEYGIALY 501


>gi|57233807|ref|YP_182125.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Dehalococcoides
           ethenogenes 195]
 gi|57224255|gb|AAW39312.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Dehalococcoides ethenogenes 195]
          Length = 513

 Score = 45.8 bits (108), Expect = 0.007,   Method: Composition-based stats.
 Identities = 29/195 (14%), Positives = 61/195 (31%), Gaps = 38/195 (19%)

Query: 94  ISKMIWQLVSGGNAAILKASIDLLESY---------------GVSVVGAHEIVPELLVQV 138
             + +  L +  +   L+  I  L  +               G+ V  A E+  E L Q 
Sbjct: 333 EPEALEFLKTRKD---LRILIAELPKHAENKAASLDYRRVKGGLLVQAADELAEEAL-QT 388

Query: 139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD 198
                  P  +   D+  A ++ + +    +    ++    ++          M     +
Sbjct: 389 KVATNRAPTAEEMADLKFAWRAVKHIKSNAI---VLAKNKVLLG---------MGAGQPN 436

Query: 199 CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
              +  I   K+G   K      D     P     +V+    AG+  I ++ G S+    
Sbjct: 437 RVVSVDIAKSKAGEASKGSVMASDAMFPFP----DSVEQAAAAGVTAI-IQPGGSI--RD 489

Query: 259 ELVKKHADEAGIFVC 273
           +     A++  I + 
Sbjct: 490 QESIDAANKYNIAMV 504


>gi|270308581|ref|YP_003330639.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Dehalococcoides sp. VS]
 gi|270154473|gb|ACZ62311.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Dehalococcoides sp. VS]
          Length = 513

 Score = 45.5 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/195 (13%), Positives = 60/195 (30%), Gaps = 20/195 (10%)

Query: 79  PNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQV 138
           P           + +  +++   +   N     +        G+ V  A E+  + L Q 
Sbjct: 330 PEYALEALEFLKTRKDLRILIADLPKHNDTATFSLDYRRVKGGLLVQAADELAEDAL-QT 388

Query: 139 GSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVD 198
                  P  +   D+  A ++ + +    +    ++    ++          M     +
Sbjct: 389 KVATKRAPTAEEMEDLKFAWRAVKHIKSNAI---VLAKNKVLLG---------MGAGQPN 436

Query: 199 CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
              +  I   K+G   K      D     P     +V+    AG+  I ++ G S+    
Sbjct: 437 RVVSVDIAKSKAGEASKGSVMASDAMFPFP----DSVEQAAAAGVTAI-IQPGGSI--RD 489

Query: 259 ELVKKHADEAGIFVC 273
           +     A++  I + 
Sbjct: 490 QESIDAANKYNIAMV 504


>gi|152974118|ref|YP_001373635.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           subsp. cytotoxis NVH 391-98]
 gi|189038203|sp|A7GKI2|PUR9_BACCN RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|152022870|gb|ABS20640.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cytotoxicus NVH 391-98]
          Length = 511

 Score = 45.5 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 45/139 (32%), Gaps = 29/139 (20%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIE----GTDSMLQR 195
                 P      D+  A K  + +    +    ++     + +   +    G+  +   
Sbjct: 388 IPTKREPTEQEWNDLKLAWKVVKHVKSNAI---VLAKDNMTIGVGAGQMNRVGSAKIAIS 444

Query: 196 IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLV 255
               +  G  LA              D    +P     TV+   KAG+  I ++ G S+ 
Sbjct: 445 QAGSKAQGSALAS-------------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI- 485

Query: 256 LEKEL-VKKHADEAGIFVC 273
             ++    K ADE GI + 
Sbjct: 486 --RDEDSIKKADEYGITMV 502


>gi|291532178|emb|CBL05291.1| hypothetical protein MHY_00590 [Megamonas hypermegale ART12/1]
          Length = 48

 Score = 45.5 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 22/42 (52%)

Query: 1  MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQ 42
          MK + +++G G LP  VAKAAR    +     +++    D +
Sbjct: 1  MKSIGLLSGIGRLPVEVAKAARAMGIDVYAVGLVDGVEEDLK 42


>gi|229159439|ref|ZP_04287457.1| IMP cyclohydrolase [Bacillus cereus R309803]
 gi|228624010|gb|EEK80818.1| IMP cyclohydrolase [Bacillus cereus R309803]
          Length = 511

 Score = 45.5 bits (107), Expect = 0.009,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 47/139 (33%), Gaps = 29/139 (20%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIE----GTDSMLQR 195
                 P+    +D+  A K  + +    +    ++     + +   +    G+  +   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQMNRVGSAKIAIT 444

Query: 196 IVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLV 255
               +  G  LA              D    +P     TV+   KAG+  I ++ G S+ 
Sbjct: 445 QASEKAQGSALAS-------------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI- 485

Query: 256 LEKEL-VKKHADEAGIFVC 273
             ++    K ADE GI + 
Sbjct: 486 --RDEDSIKMADEYGIAMV 502


>gi|295401720|ref|ZP_06811686.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312112472|ref|YP_003990788.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus sp. Y4.1MC1]
 gi|294976207|gb|EFG51819.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311217573|gb|ADP76177.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus sp. Y4.1MC1]
          Length = 512

 Score = 45.1 bits (106), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P       +  A K  + +    +    ++  G  + +   +     + R+   
Sbjct: 389 VVTKREPTEQEWESLQFAWKVVKHVKSNAI---VLAKDGMTIGVGAGQ-----MNRVGAA 440

Query: 200 RNNGRILA--GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +          K  VL        D    +      TV+   KAG+  I ++ G S+   
Sbjct: 441 KIAIEQAGEKAKGAVLAS------DAFFPM----DDTVEAAAKAGITAI-IQPGGSI--- 486

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K ADE GI + 
Sbjct: 487 RDADSIKKADEYGIAMV 503


>gi|228989457|ref|ZP_04149443.1| IMP cyclohydrolase [Bacillus pseudomycoides DSM 12442]
 gi|229003281|ref|ZP_04161111.1| IMP cyclohydrolase [Bacillus mycoides Rock1-4]
 gi|228757899|gb|EEM07114.1| IMP cyclohydrolase [Bacillus mycoides Rock1-4]
 gi|228770278|gb|EEM18856.1| IMP cyclohydrolase [Bacillus pseudomycoides DSM 12442]
          Length = 511

 Score = 45.1 bits (106), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P      D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 VPTKREPTEQEWADLKLAWKVVKHVKSNAI---VLAKDNMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +      A K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAADKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K ADE GI + 
Sbjct: 486 RDEDSIKKADEFGITMV 502


>gi|228995652|ref|ZP_04155315.1| IMP cyclohydrolase [Bacillus mycoides Rock3-17]
 gi|228764029|gb|EEM12913.1| IMP cyclohydrolase [Bacillus mycoides Rock3-17]
          Length = 511

 Score = 44.7 bits (105), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P      D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 VPTKREPTEQEWADLKLAWKVVKHVKSNAI---VLAKDNMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +      A K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAADKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K ADE GI + 
Sbjct: 486 RDEDSIKKADEFGITMV 502


>gi|328874585|gb|EGG22950.1| AICAR transformylase / IMP cyclohydrolase [Dictyostelium
           fasciculatum]
          Length = 535

 Score = 44.7 bits (105), Expect = 0.014,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 50/131 (38%), Gaps = 19/131 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P ++   D+L A + ++ +    +    VS   ++VA+    G  + +Q +  C
Sbjct: 412 VVTKIAPTKEQMADLLFAWRVSKHVKSNAI---VVSKDQQIVAIGA--GQPNRIQSLNIC 466

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           R  G      S +         D           ++    +AG+  I ++ G S+    +
Sbjct: 467 RRVGGDKVAGSVLASDAFFPFAD-----------SIDAAQEAGIGCI-VQPGGSI--RDQ 512

Query: 260 LVKKHADEAGI 270
            V   AD+ GI
Sbjct: 513 EVIDAADKFGI 523


>gi|260889195|ref|ZP_05900458.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Leptotrichia hofstadii F0254]
 gi|260861255|gb|EEX75755.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Leptotrichia hofstadii F0254]
          Length = 318

 Score = 44.7 bits (105), Expect = 0.014,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 44/137 (32%), Gaps = 22/137 (16%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P     +D+   MK  + +    +    V   G    + G   T+ +       
Sbjct: 192 VVTKKQPTEQELKDMELGMKVVKHVKSNAI---VVVKDGAATGV-GTGQTNRIWATQHAL 247

Query: 200 -RNNGRILAGKSGVLVK-MCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
               G + + +  VL        +D            V    K G+  + ++ G S+   
Sbjct: 248 EHAKGDLDSLEGAVLASDAFFPFRDC-----------VDEAAKYGIKAL-VQPGGSI--- 292

Query: 258 KE-LVKKHADEAGIFVC 273
           ++    + ADE G+ + 
Sbjct: 293 RDKESIEAADEHGMTMV 309


>gi|239825834|ref|YP_002948458.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Geobacillus sp.
           WCH70]
 gi|239806127|gb|ACS23192.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus sp. WCH70]
          Length = 512

 Score = 44.7 bits (105), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/141 (16%), Positives = 47/141 (33%), Gaps = 25/141 (17%)

Query: 136 VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQR 195
            ++  +    P       +  A K  + +    +    ++  G  + +   +     + R
Sbjct: 385 AEIKVVTKREPTEQEWEALRFAWKVVKHVKSNAI---VLAKDGMTIGIGAGQ-----MNR 436

Query: 196 IVDCRNNGRILA--GKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKS 253
           +   +          K  VL        D    +      TV+   KAG+  I ++ G S
Sbjct: 437 VGAAKIAIEQAGEKAKGAVLAS------DAFFPM----DDTVEAAAKAGITAI-IQPGGS 485

Query: 254 LVLEKEL-VKKHADEAGIFVC 273
           +   ++    K ADE GI + 
Sbjct: 486 I---RDADSIKKADEYGIAMV 503


>gi|315638677|ref|ZP_07893851.1| bifunctional purine biosynthesis protein PurH [Campylobacter
           upsaliensis JV21]
 gi|315481301|gb|EFU71931.1| bifunctional purine biosynthesis protein PurH [Campylobacter
           upsaliensis JV21]
          Length = 510

 Score = 44.7 bits (105), Expect = 0.015,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 61/157 (38%), Gaps = 24/157 (15%)

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           G     + EI  + L++   +     ++D  +D+  A++ A      +V   A    G +
Sbjct: 365 GFVYQNSDEIREDELLKAKCVSEKCASKDELKDLEIALRVAALTKSNNV---AYVKNGAL 421

Query: 181 VALEGIEGT---DSMLQRIVDCRNNGRILAGKSGVLV-KMCKSQQDMRADLPSIGAKTVQ 236
           VA+ G+  T   D+    I      G  L  +  VL  +     +D           ++ 
Sbjct: 422 VAI-GMGMTSRIDAAKAAIRKACEMGLDL--RGCVLASEAFFPFRD-----------SID 467

Query: 237 NVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
              K G+  I ++ G S+  +   V K ADE GI + 
Sbjct: 468 EAAKVGVKAI-VQPGGSIRDD--EVIKAADEYGIALY 501


>gi|229028136|ref|ZP_04184279.1| IMP cyclohydrolase [Bacillus cereus AH1271]
 gi|228733187|gb|EEL84026.1| IMP cyclohydrolase [Bacillus cereus AH1271]
          Length = 511

 Score = 44.7 bits (105), Expect = 0.016,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 46/137 (33%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEAAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K ADE GI + 
Sbjct: 486 RDEDSIKMADEYGIAMV 502


>gi|78484784|ref|YP_390709.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Thiomicrospira crunogena XCL-2]
 gi|123555930|sp|Q31II8|PUR9_THICR RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|78363070|gb|ABB41035.1| phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP
           cyclohydrolase [Thiomicrospira crunogena XCL-2]
          Length = 520

 Score = 44.3 bits (104), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/136 (15%), Positives = 44/136 (32%), Gaps = 20/136 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P+     D+  A K A+ +    +        G  + +   +     + R+   
Sbjct: 394 VVTKRAPSEKEMADLQFAWKVAKYVKSNAI---VYVKDGMTIGVGAGQ-----MSRVYSA 445

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGA--KTVQNVIKAGLAGIALEAGKSLVLE 257
           +  G   A +   +         M +D  +       +    +AG+    +  G S+   
Sbjct: 446 KIAGIKAADEGLEV-----PGSVMASD--AFFPFRDGIDAAAEAGITA-VIHPGGSM--R 495

Query: 258 KELVKKHADEAGIFVC 273
            + V   ADE GI + 
Sbjct: 496 DQEVIDAADEHGIAMV 511


>gi|312144562|ref|YP_003996008.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Halanaerobium sp. 'sapolanicus']
 gi|311905213|gb|ADQ15654.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Halanaerobium sp. 'sapolanicus']
          Length = 525

 Score = 44.3 bits (104), Expect = 0.019,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 50/136 (36%), Gaps = 23/136 (16%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P  +  +D+L + K  + +    +    ++    VV +   +     + R+   
Sbjct: 402 VVTKKAPTEEEIKDLLFSWKVVKHVKSNAI---VMAKEQMVVGVGAGQ-----MSRVDSM 453

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
              GR   G+   GV+        D     P      V+   + G+  I ++ G S+  +
Sbjct: 454 IIAGRKAEGRQRDGVVAS------DAFFPFP----DAVEKAAELGIKAI-IQPGGSIRDD 502

Query: 258 KELVKKHADEAGIFVC 273
           K  V +  D+ GI + 
Sbjct: 503 K--VIEACDKLGIAMV 516


>gi|311029272|ref|ZP_07707362.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus sp.
           m3-13]
          Length = 509

 Score = 43.9 bits (103), Expect = 0.022,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 47/134 (35%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P      D+  A K  + +    +    ++  G+ V +   +     + R+   
Sbjct: 386 IPTKREPTEQEWADLKLAWKVVKHVKSNAI---VLAKEGQTVGVGAGQ-----MNRVGAA 437

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +      AG+  V         D    +      TV+   KAG+  I ++ G S+  + E
Sbjct: 438 KIAI-EQAGEKAV---GSALGSDAFFPM----NDTVEAAAKAGVTAI-IQPGGSI--KDE 486

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 487 DSIKKADEYGITMV 500


>gi|261418595|ref|YP_003252277.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Geobacillus sp.
           Y412MC61]
 gi|319765410|ref|YP_004130911.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus sp. Y412MC52]
 gi|261375052|gb|ACX77795.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus sp. Y412MC61]
 gi|317110276|gb|ADU92768.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Geobacillus sp. Y412MC52]
          Length = 512

 Score = 43.5 bits (102), Expect = 0.033,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 68/199 (34%), Gaps = 31/199 (15%)

Query: 79  PNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHEI-VPELLVQ 137
           P+  D   +I    +  +++  L   G        + +  + G+ V  A    + +   +
Sbjct: 332 PSFSDEALAILTKKKNIRLL-TLDFTGPDVKENMLVSV--NGGLLVQEADTFTLED--AE 386

Query: 138 VGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIV 197
              +    P    +  +  A K  + +    +    ++  G  V +    GT  M  R+ 
Sbjct: 387 WNVVTKREPTEAEREQLRFAWKVVKHVKSNAI---VLAKNGMTVGV----GTGQM-NRVG 438

Query: 198 DCRNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLV 255
             +        +    VL        D    +      TV+   KAG+  I ++ G S+ 
Sbjct: 439 AAKIAIEQAGEQAVGAVLAS------DAFFPM----DDTVEAAAKAGITAI-IQPGGSI- 486

Query: 256 LEKEL-VKKHADEAGIFVC 273
             ++    + ADE GI + 
Sbjct: 487 --RDADSIRKADEYGIAMV 503


>gi|220933041|ref|YP_002509949.1| IMP cyclohydrolase;phosphoribosylaminoimidazolecarboxamide
           formyltransferase [Halothermothrix orenii H 168]
 gi|219994351|gb|ACL70954.1| IMP cyclohydrolase;phosphoribosylaminoimidazolecarboxamide
           formyltransferase [Halothermothrix orenii H 168]
          Length = 535

 Score = 43.5 bits (102), Expect = 0.034,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 48/136 (35%), Gaps = 23/136 (16%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P     RD+L A K  + +    +    ++    VV +   +     + R+   
Sbjct: 412 IVTEVKPTEGQLRDLLFAWKVVKHVKSNAI---VMAKDEMVVGVGAGQ-----MSRVDAM 463

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
              GR   G+   GV+        D     P      ++     G+  I ++ G S+  +
Sbjct: 464 IIAGRKSEGRQEGGVVAS------DAFFPFP----DAIEEAAARGIKAI-IQPGGSIRDD 512

Query: 258 KELVKKHADEAGIFVC 273
           +  V + A++  I + 
Sbjct: 513 Q--VIEAANDHKIAMV 526


>gi|295702468|ref|YP_003595543.1| bifunctional purine biosynthesis protein PurH [Bacillus megaterium
           DSM 319]
 gi|294800127|gb|ADF37193.1| bifunctional purine biosynthesis protein PurH [Bacillus megaterium
           DSM 319]
          Length = 512

 Score = 43.5 bits (102), Expect = 0.037,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 41/134 (30%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P      D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 389 VPTKREPTEKEWADLKLAWKVVKNVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGAA 440

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     +      D    +      TV+   KAG+  I ++ G S+    E
Sbjct: 441 KIAIEQAGEK----AQGSALGSDAFFPM----GDTVEAAAKAGITAI-IQPGGSI--RDE 489

Query: 260 LVKKHADEAGIFVC 273
                ADE GI + 
Sbjct: 490 ESIAKADEYGIAMV 503


>gi|229015678|ref|ZP_04172662.1| IMP cyclohydrolase [Bacillus cereus AH1273]
 gi|229021870|ref|ZP_04178441.1| IMP cyclohydrolase [Bacillus cereus AH1272]
 gi|228739440|gb|EEL89865.1| IMP cyclohydrolase [Bacillus cereus AH1272]
 gi|228745615|gb|EEL95633.1| IMP cyclohydrolase [Bacillus cereus AH1273]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 46/137 (33%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD+ GI + 
Sbjct: 486 RDEDSIKVADKYGITMV 502


>gi|229101103|ref|ZP_04231869.1| IMP cyclohydrolase [Bacillus cereus Rock3-28]
 gi|228682231|gb|EEL36342.1| IMP cyclohydrolase [Bacillus cereus Rock3-28]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 46/137 (33%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD+ GI + 
Sbjct: 486 RDEDSIKVADKYGITMV 502


>gi|319655024|ref|ZP_08009095.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus sp.
           2_A_57_CT2]
 gi|317393291|gb|EFV74058.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus sp.
           2_A_57_CT2]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/142 (16%), Positives = 45/142 (31%), Gaps = 27/142 (19%)

Query: 136 VQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIG-GRVVALEGIEGTDSMLQ 194
            +V       P  +  + +    K  + +       + V       + +   +     + 
Sbjct: 384 AEVKVPTKREPTEEEWKALKLGWKVVKHVKS----NAIVVNDANMTLGVGAGQ-----MN 434

Query: 195 RIVDCRNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGK 252
           R+   +        K    VL        D    +      TV+   KAG+  I ++ G 
Sbjct: 435 RVGSAKIALEQAGEKANGAVLAS------DAFFPM----NDTVETAAKAGITAI-IQPGG 483

Query: 253 SLVLEKEL-VKKHADEAGIFVC 273
           S+   ++    K ADE GI + 
Sbjct: 484 SI---RDEDSIKKADEYGIAMV 502


>gi|229088709|ref|ZP_04220272.1| IMP cyclohydrolase [Bacillus cereus Rock3-44]
 gi|228694605|gb|EEL48018.1| IMP cyclohydrolase [Bacillus cereus Rock3-44]
          Length = 243

 Score = 43.1 bits (101), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 43/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P      D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 120 VPTKREPTEQEWADLKLAWKVVKHVKSNAI---VLAKDNMTIGVGAGQ-----MNRVGSA 171

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     +      D    +P     TV+   KAG+  I ++ G S+    E
Sbjct: 172 KIAITQAGDK----AQGSALASDAFFPMP----DTVEEAAKAGVTAI-IQPGGSI--RDE 220

Query: 260 LVKKHADEAGIFVC 273
              K ADE GI + 
Sbjct: 221 DSIKKADEYGITMV 234


>gi|83590874|ref|YP_430883.1| phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP
           cyclohydrolase [Moorella thermoacetica ATCC 39073]
 gi|123524013|sp|Q2RGU9|PUR9_MOOTA RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|83573788|gb|ABC20340.1| phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP
           cyclohydrolase [Moorella thermoacetica ATCC 39073]
          Length = 513

 Score = 43.1 bits (101), Expect = 0.040,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 45/134 (33%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P      D+L A +  + +    +    V+  G  + +   +     + R+   
Sbjct: 390 VVTARKPEAKEMADLLFAWQVVKHVKSNAI---VVARDGVTLGIGAGQ-----MNRVGAA 441

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           R        +     K      D     P  G  TV+    AG+  I ++ G S+    E
Sbjct: 442 RIALEQAGAR----AKGAVLASDAFF--P-FG-DTVELAAGAGITAI-IQPGGSI--RDE 490

Query: 260 LVKKHADEAGIFVC 273
              + AD AGI + 
Sbjct: 491 ESIRAADAAGIAMV 504


>gi|224418389|ref|ZP_03656395.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Helicobacter
           canadensis MIT 98-5491]
 gi|253827707|ref|ZP_04870592.1| bifunctional purine biosynthesis protein PurH [Helicobacter
           canadensis MIT 98-5491]
 gi|313141920|ref|ZP_07804113.1| bifunctional purine biosynthesis protein PurH [Helicobacter
           canadensis MIT 98-5491]
 gi|253511113|gb|EES89772.1| bifunctional purine biosynthesis protein PurH [Helicobacter
           canadensis MIT 98-5491]
 gi|313130951|gb|EFR48568.1| bifunctional purine biosynthesis protein PurH [Helicobacter
           canadensis MIT 98-5491]
          Length = 510

 Score = 43.1 bits (101), Expect = 0.041,   Method: Composition-based stats.
 Identities = 28/160 (17%), Positives = 56/160 (35%), Gaps = 26/160 (16%)

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV-SIG 177
             G  +  A  + P  +     +      ++  +D+  A K A  +         V    
Sbjct: 363 EGGFVLQEADSVAPSEVKNAKCVSQKQATKEQMKDLEIAYKVASLVKS----NCVVYVKD 418

Query: 178 GRVVALEGIEGT---DSMLQRIVDCRNNGRILAGKSGVLV-KMCKSQQDMRADLPSIGAK 233
             +VA+ G+  T   D+    I      G  L  +  VL  +     +D           
Sbjct: 419 SAMVAV-GMGMTSRVDAAKAAIRKAEEMGIDL--RGCVLASEAFFPFKD----------- 464

Query: 234 TVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           +++   K G++   +E G S+    E V + A++ G+ + 
Sbjct: 465 SIEEAYKVGVSA-VIEPGGSI--RDEEVIECANQKGMALY 501


>gi|293400102|ref|ZP_06644248.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306502|gb|EFE47745.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 510

 Score = 43.1 bits (101), Expect = 0.043,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 46/134 (34%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P  +  + +L A K  + +    +    +      + +   +     + R+   
Sbjct: 387 CVTNRKPTEEEMKQLLFAWKVVKHVKSNAI---VLVKDNMTIGVGAGQ-----MNRVGAA 438

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+  +KAG+  I ++ G S+  + +
Sbjct: 439 KIAVEQAGEK----AKGSVMSSDAFFPMP----DTVEEAVKAGVTAI-IQPGGSI--KDQ 487

Query: 260 LVKKHADEAGIFVC 273
           L     +E GI + 
Sbjct: 488 LSIDVCNEHGIAMV 501


>gi|313900944|ref|ZP_07834434.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Clostridium sp. HGF2]
 gi|312954364|gb|EFR36042.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Clostridium sp. HGF2]
          Length = 510

 Score = 43.1 bits (101), Expect = 0.044,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 45/134 (33%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P  +    +L A K  + +    +    +      + +   +     + R+   
Sbjct: 387 CVTNRKPTEEELEQLLFAWKVVKHVKSNAI---VLVKDNMTIGVGAGQ-----MNRVGAA 438

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        K     K      D    +P     TV+  +KAG+  I ++ G S+  + +
Sbjct: 439 KIAIEQAGEK----AKGSIMSSDAFFPMP----DTVEEAVKAGVTAI-IQPGGSI--KDQ 487

Query: 260 LVKKHADEAGIFVC 273
           L     +E GI + 
Sbjct: 488 LSIDVCNEHGIAMV 501


>gi|149912799|ref|ZP_01901333.1| bifunctional purine biosynthesis protein PurH [Roseobacter sp.
           AzwK-3b]
 gi|149813205|gb|EDM73031.1| bifunctional purine biosynthesis protein PurH [Roseobacter sp.
           AzwK-3b]
          Length = 529

 Score = 43.1 bits (101), Expect = 0.044,   Method: Composition-based stats.
 Identities = 26/146 (17%), Positives = 46/146 (31%), Gaps = 33/146 (22%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P      D+L A + A+ +    +        G  V +   +     + R+  C
Sbjct: 396 VVTKRAPTDREMADMLFAWRVAKHVKSNAI---VYVRDGATVGVGAGQ-----MSRVDSC 447

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLP-SIG-----------AKTVQNVIKAGLAGIA 247
           R   R     +  L            D P + G           A  +    +AG     
Sbjct: 448 RIAARKAEDMAATLG----------LDAPLTQGSVVASDAFFPFADGLLTAAEAGATA-V 496

Query: 248 LEAGKSLVLEKELVKKHADEAGIFVC 273
           ++ G S+  +   V   ADEAG+ + 
Sbjct: 497 IQPGGSMRDD--EVIAAADEAGLAMV 520


>gi|229113955|ref|ZP_04243381.1| IMP cyclohydrolase [Bacillus cereus Rock1-3]
 gi|228669414|gb|EEL24830.1| IMP cyclohydrolase [Bacillus cereus Rock1-3]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.045,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 46/137 (33%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD+ GI + 
Sbjct: 486 RDEDSIKVADKYGITMV 502


>gi|229095002|ref|ZP_04225998.1| IMP cyclohydrolase [Bacillus cereus Rock3-29]
 gi|228688332|gb|EEL42214.1| IMP cyclohydrolase [Bacillus cereus Rock3-29]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.047,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 46/137 (33%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD+ GI + 
Sbjct: 486 RDEDSIKVADKYGITMV 502


>gi|229009782|ref|ZP_04167002.1| IMP cyclohydrolase [Bacillus mycoides DSM 2048]
 gi|228751400|gb|EEM01206.1| IMP cyclohydrolase [Bacillus mycoides DSM 2048]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.048,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKMADAYGITMV 502


>gi|229165264|ref|ZP_04293052.1| IMP cyclohydrolase [Bacillus cereus AH621]
 gi|228618211|gb|EEK75248.1| IMP cyclohydrolase [Bacillus cereus AH621]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.048,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKMADAYGITMV 502


>gi|229131286|ref|ZP_04260188.1| IMP cyclohydrolase [Bacillus cereus BDRD-ST196]
 gi|228652172|gb|EEL08107.1| IMP cyclohydrolase [Bacillus cereus BDRD-ST196]
          Length = 511

 Score = 43.1 bits (101), Expect = 0.049,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKMADAYGITMV 502


>gi|270159115|ref|ZP_06187771.1| purine biosynthesis protein PurH [Legionella longbeachae D-4968]
 gi|289166050|ref|YP_003456188.1| phosphoribosylaminoimidazolecarboxamide formyltransferase and IMP
           cyclohydrolase (bifunctionnal) [Legionella longbeachae
           NSW150]
 gi|269987454|gb|EEZ93709.1| purine biosynthesis protein PurH [Legionella longbeachae D-4968]
 gi|288859223|emb|CBJ13157.1| putative phosphoribosylaminoimidazolecarboxamide formyltransferase
           and IMP cyclohydrolase (bifunctionnal) [Legionella
           longbeachae NSW150]
          Length = 529

 Score = 42.8 bits (100), Expect = 0.053,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 50/135 (37%), Gaps = 18/135 (13%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
           ++   +P+     D++ A   A+ +    +     +     + L G + +  M  RI   
Sbjct: 403 TVTRIMPSEQQMNDLMFAWLVAKHVKSNAI---VYAKDAATIGLGGGQTSRVMSARIGLW 459

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +           V+             +P     TV+   KAG++ I ++ G S+   ++
Sbjct: 460 QATQMGFDPHGAVMASDA-------F-IPF--PDTVEIAAKAGISAI-IQPGGSI---RD 505

Query: 260 L-VKKHADEAGIFVC 273
             V   A+E G+ + 
Sbjct: 506 AHVIACAEEHGVIMV 520


>gi|237752466|ref|ZP_04582946.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375955|gb|EEO26046.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 510

 Score = 42.8 bits (100), Expect = 0.053,   Method: Composition-based stats.
 Identities = 26/167 (15%), Positives = 52/167 (31%), Gaps = 40/167 (23%)

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV-SIG 177
             G  +  +  +    +     +      +   +D+  A K A  +         V    
Sbjct: 363 EGGFVLQDSDYVDSNEVTGAKCVSQRQATQAQMQDLEIAYKLASLVKS----NCVVYVKD 418

Query: 178 GRVVALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADL---------- 227
             +VA+                    R+ A K+ +     +  QDM  DL          
Sbjct: 419 SAMVAV--------------GMGMTSRVDAAKAAI-----RKAQDMGLDLKGCVLASEAF 459

Query: 228 -PSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
            P     +++   K G++   +E G S+  +   V + A+  GI + 
Sbjct: 460 FPF--KDSIEEAHKVGVSA-VIEPGGSIRDD--EVVECANTNGIALY 501


>gi|163938289|ref|YP_001643173.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           weihenstephanensis KBAB4]
 gi|229576637|sp|A9VRF5|PUR9_BACWK RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|163860486|gb|ABY41545.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus weihenstephanensis KBAB4]
          Length = 511

 Score = 42.8 bits (100), Expect = 0.056,   Method: Composition-based stats.
 Identities = 23/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKMADAYGITMV 502


>gi|229171131|ref|ZP_04298725.1| IMP cyclohydrolase [Bacillus cereus MM3]
 gi|228612309|gb|EEK69537.1| IMP cyclohydrolase [Bacillus cereus MM3]
          Length = 511

 Score = 42.8 bits (100), Expect = 0.059,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 46/137 (33%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     V +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLANDNMTVGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   +AG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAARAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD+ GI + 
Sbjct: 486 RDEDSIKVADKYGITMV 502


>gi|225862337|ref|YP_002747715.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus 03BB102]
 gi|254783992|sp|C1EV67|PUR9_BACC3 RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|225790602|gb|ACO30819.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus 03BB102]
          Length = 511

 Score = 42.8 bits (100), Expect = 0.059,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|118476049|ref|YP_893200.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           thuringiensis str. Al Hakam]
 gi|166230853|sp|A0R900|PUR9_BACAH RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|118415274|gb|ABK83693.1| phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP
           cyclohydrolase [Bacillus thuringiensis str. Al Hakam]
          Length = 511

 Score = 42.8 bits (100), Expect = 0.061,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|49479086|ref|YP_034620.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|81397402|sp|Q6HPA0|PUR9_BACHK RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|49330642|gb|AAT61288.1| phosphoribosylaminoimidazole carboxy formyltransferase;
           inosine-monophosphate cyclohydrolase [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 511

 Score = 42.8 bits (100), Expect = 0.061,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|196040175|ref|ZP_03107477.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus NVH0597-99]
 gi|228931789|ref|ZP_04094685.1| IMP cyclohydrolase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
 gi|196029030|gb|EDX67635.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus NVH0597-99]
 gi|228827769|gb|EEM73507.1| IMP cyclohydrolase [Bacillus thuringiensis serovar andalousiensis
           BGSC 4AW1]
          Length = 511

 Score = 42.8 bits (100), Expect = 0.063,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|301052010|ref|YP_003790221.1| bifunctionalphosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           CI]
 gi|300374179|gb|ADK03083.1| bifunctionalphosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           biovar anthracis str. CI]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.065,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|258514877|ref|YP_003191099.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778582|gb|ACV62476.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 272

 Score = 42.4 bits (99), Expect = 0.065,   Method: Composition-based stats.
 Identities = 26/109 (23%), Positives = 43/109 (39%), Gaps = 4/109 (3%)

Query: 70  VVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGVSVVGAHE 129
           V+AG +           S   +L IS +++   +  +AAI     D+LES G  V+ A  
Sbjct: 66  VIAGRVPNVLLKYLNSISGNGALAISIVVYGNRNYDDAAI--ELKDILESNGFKVIAAGA 123

Query: 130 IVPELLVQVGSLGTCVPNRDVKRDI-LAAMKSAEALSELDVGQSAVSIG 177
            + E      +L    P+      +   A K    ++  D  Q+ V  G
Sbjct: 124 FIGEHSFSK-TLAQNRPDEKDMAIVSDFAHKIYAKITSEDDIQTVVVKG 171


>gi|254724758|ref|ZP_05186541.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. A1055]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.065,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|242309280|ref|ZP_04808435.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239524321|gb|EEQ64187.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 510

 Score = 42.4 bits (99), Expect = 0.065,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 58/163 (35%), Gaps = 32/163 (19%)

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV-SIG 177
             G  +  + ++  + +     +       +  +D+  A K A  +         V    
Sbjct: 363 EGGFVLQDSDKVQEDEVRNAKCVSNKKATMEQMQDLEIAYKIASLVKS----NCVVYVKN 418

Query: 178 GRVVAL-----EGIEGTDSMLQRIVDCRNN--GRILAGKSGVLVKMCKSQQDMRADLPSI 230
             +VA+       ++ T + L++  +   +  G +LA ++    K               
Sbjct: 419 SAMVAVGMGMTSRVDATKAALRKAEEMGLDLKGSVLASEAFFPFK--------------- 463

Query: 231 GAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
              +++   K G++   +E G S+  +   V + A++ GI + 
Sbjct: 464 --DSIEEAHKVGVSA-VIEPGGSIRDD--EVIECANQNGIALY 501


>gi|324324298|gb|ADY19558.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.068,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|294497103|ref|YP_003560803.1| bifunctional purine biosynthesis protein PurH [Bacillus megaterium
           QM B1551]
 gi|294347040|gb|ADE67369.1| bifunctional purine biosynthesis protein PurH [Bacillus megaterium
           QM B1551]
          Length = 512

 Score = 42.4 bits (99), Expect = 0.070,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 41/132 (31%), Gaps = 19/132 (14%)

Query: 142 GTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRN 201
               P      D+  A K  + +    +    ++     + +   +     + R+   + 
Sbjct: 391 TKREPTEKEWADLKLAWKVVKNVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGAAKI 442

Query: 202 NGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELV 261
                  K     +      D    +      TV+   KAG+  I ++ G S+    E  
Sbjct: 443 AIEQAGEK----AQGSALGSDAFFPM----GDTVEAAAKAGITAI-IQPGGSI--RDEES 491

Query: 262 KKHADEAGIFVC 273
              ADE GI + 
Sbjct: 492 IAKADEYGIAMV 503


>gi|212638087|ref|YP_002314607.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Anoxybacillus
           flavithermus WK1]
 gi|226724565|sp|B7GFU2|PUR9_ANOFW RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|212559567|gb|ACJ32622.1| Inosine-monophosphate cyclohydrolase [Anoxybacillus flavithermus
           WK1]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.071,   Method: Composition-based stats.
 Identities = 18/134 (13%), Positives = 46/134 (34%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P  +   ++  A +  + +    +    ++  G  + +   +     + R+   
Sbjct: 388 VVTERKPTEEEWSNLTFAWRVVKHVKSNAI---VLAKNGMTIGVGAGQ-----MNRVGAA 439

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           +        +     K      D    +    + TV+   +AG+  I ++ G S+    E
Sbjct: 440 KIAIEQAGDR----AKGAVLASDAFFPM----SDTVEAAAQAGVTAI-IQPGGSI--RDE 488

Query: 260 LVKKHADEAGIFVC 273
              + A+E GI + 
Sbjct: 489 DSIQKANEYGIAMV 502


>gi|226952635|ref|ZP_03823099.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Acinetobacter sp.
           ATCC 27244]
 gi|226836624|gb|EEH69007.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Acinetobacter sp.
           ATCC 27244]
          Length = 524

 Score = 42.4 bits (99), Expect = 0.073,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 46/135 (34%), Gaps = 18/135 (13%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P      D++ A K A+ +    +     +   + + +   + +     RI   
Sbjct: 398 VVTKRAPTEQEIDDMIFAWKVAKYVKSNAI---VYAKNRQTIGVGAGQMSRVNSARIAAI 454

Query: 200 RNNGRILAGKSGVLVK-MCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
           +     L  +  V+        +D            + N  KAG+  I ++ G S+    
Sbjct: 455 KAEHAGLVVEGAVMASDAFFPFRDG-----------IDNAAKAGIKCI-IQPGGSM--RD 500

Query: 259 ELVKKHADEAGIFVC 273
           E     ADEAGI + 
Sbjct: 501 EETIAAADEAGIAMV 515


>gi|160914858|ref|ZP_02077072.1| hypothetical protein EUBDOL_00866 [Eubacterium dolichum DSM 3991]
 gi|158433398|gb|EDP11687.1| hypothetical protein EUBDOL_00866 [Eubacterium dolichum DSM 3991]
          Length = 510

 Score = 42.4 bits (99), Expect = 0.073,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 44/134 (32%), Gaps = 19/134 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P  +    +L A    + +    +    +      + +   +     + R+   
Sbjct: 387 CVTNRKPTEEELEQLLFAWNVVKHVKSNAI---VLVKDNMTIGVGAGQ-----MNRVGAA 438

Query: 200 RNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKE 259
           R        K     K      D    +P     TV+  +KAG+  I ++ G S+  + +
Sbjct: 439 RIAIEQAQEK----AKGSVMGSDAFFPMP----DTVEEAVKAGVTAI-IQPGGSI--KDQ 487

Query: 260 LVKKHADEAGIFVC 273
           L     +E GI + 
Sbjct: 488 LSIDVCNEYGIAMV 501


>gi|30260471|ref|NP_842848.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. Ames]
 gi|47525561|ref|YP_016910.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49183313|ref|YP_026565.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. Sterne]
 gi|65317723|ref|ZP_00390682.1| COG0138: AICAR transformylase/IMP cyclohydrolase PurH (only IMP
           cyclohydrolase domain in Aful) [Bacillus anthracis str.
           A2012]
 gi|165871402|ref|ZP_02216050.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0488]
 gi|167634170|ref|ZP_02392492.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0442]
 gi|167640087|ref|ZP_02398354.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0193]
 gi|170688343|ref|ZP_02879552.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0465]
 gi|170708736|ref|ZP_02899173.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0389]
 gi|177653649|ref|ZP_02935788.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0174]
 gi|190567405|ref|ZP_03020319.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis Tsiankovskii-I]
 gi|190567526|ref|ZP_03020439.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis Tsiankovskii-I]
 gi|218901488|ref|YP_002449322.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus AH820]
 gi|227812963|ref|YP_002812972.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. CDC 684]
 gi|228925543|ref|ZP_04088632.1| IMP cyclohydrolase [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|229119945|ref|ZP_04249200.1| IMP cyclohydrolase [Bacillus cereus 95/8201]
 gi|229603564|ref|YP_002864916.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0248]
 gi|254686682|ref|ZP_05150540.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. CNEVA-9066]
 gi|254739093|ref|ZP_05196795.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. Western North America USA6153]
 gi|254742285|ref|ZP_05199971.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. Kruger B]
 gi|254756061|ref|ZP_05208090.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. Vollum]
 gi|254761878|ref|ZP_05213727.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus anthracis
           str. Australia 94]
 gi|81584380|sp|Q81ZG8|PUR9_BACAN RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|226724566|sp|B7JM89|PUR9_BACC0 RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|254783990|sp|C3PBN4|PUR9_BACAA RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|254783991|sp|C3L536|PUR9_BACAC RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|30253839|gb|AAP24334.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. Ames]
 gi|47500709|gb|AAT29385.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177240|gb|AAT52616.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. Sterne]
 gi|164712886|gb|EDR18415.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0488]
 gi|167511898|gb|EDR87277.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0193]
 gi|167530484|gb|EDR93199.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0442]
 gi|170126315|gb|EDS95205.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0389]
 gi|170667675|gb|EDT18429.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0465]
 gi|172081229|gb|EDT66304.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0174]
 gi|190561313|gb|EDV15285.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis Tsiankovskii-I]
 gi|190561532|gb|EDV15503.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis Tsiankovskii-I]
 gi|218537842|gb|ACK90240.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus AH820]
 gi|227005907|gb|ACP15650.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. CDC 684]
 gi|228663411|gb|EEL18996.1| IMP cyclohydrolase [Bacillus cereus 95/8201]
 gi|228834021|gb|EEM79569.1| IMP cyclohydrolase [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|229267972|gb|ACQ49609.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus anthracis str. A0248]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.075,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|300118918|ref|ZP_07056629.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           SJ1]
 gi|298723534|gb|EFI64265.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           SJ1]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.075,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDNMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     T++   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTLEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|196034688|ref|ZP_03102096.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus W]
 gi|228944095|ref|ZP_04106474.1| IMP cyclohydrolase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|195992731|gb|EDX56691.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus W]
 gi|228815484|gb|EEM61726.1| IMP cyclohydrolase [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
          Length = 511

 Score = 42.4 bits (99), Expect = 0.082,   Method: Composition-based stats.
 Identities = 22/137 (16%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     TV+   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTVEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|289422216|ref|ZP_06424072.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Peptostreptococcus anaerobius 653-L]
 gi|289157366|gb|EFD05975.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Peptostreptococcus anaerobius 653-L]
          Length = 509

 Score = 42.4 bits (99), Expect = 0.084,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 47/136 (34%), Gaps = 22/136 (16%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P+ D  RD+   MK  + L    +    +   G+ +A  G   T   +  + + 
Sbjct: 385 VVTKIAPSEDQLRDMDFGMKVVKNLKSNAI---VIVKDGQTLA-SGCGQTSR-IWALSNA 439

Query: 200 RNNGRILAGKSGVLVK-MCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
             N +    +  VL             D        V+   + G+  I ++ G S+   +
Sbjct: 440 LVNNKDKNFEGAVLASDAFFP-----FD------DCVRLAAEYGIKAI-VQPGGSI---R 484

Query: 259 EL-VKKHADEAGIFVC 273
           +    K  DE G+ + 
Sbjct: 485 DEDSIKACDELGLSMV 500


>gi|217957857|ref|YP_002336401.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           AH187]
 gi|229137123|ref|ZP_04265742.1| IMP cyclohydrolase [Bacillus cereus BDRD-ST26]
 gi|226724569|sp|B7HS36|PUR9_BACC7 RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|217066640|gb|ACJ80890.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus AH187]
 gi|228646295|gb|EEL02510.1| IMP cyclohydrolase [Bacillus cereus BDRD-ST26]
          Length = 511

 Score = 42.0 bits (98), Expect = 0.086,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     T++   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTLEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|260596106|ref|YP_003208677.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Cronobacter
           turicensis z3032]
 gi|260215283|emb|CBA27211.1| Bifunctional purine biosynthesis protein purH [Cronobacter
           turicensis z3032]
          Length = 529

 Score = 42.0 bits (98), Expect = 0.087,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 47/142 (33%), Gaps = 19/142 (13%)

Query: 135 LVQVG---SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDS 191
           +V  G    +    P     RD L   K A+ +    +     +     + +   +    
Sbjct: 395 MVTEGDLRVVTKRQPTEQELRDALFCWKVAKFVKSNAI---VYARDNMTIGIGAGQ---- 447

Query: 192 MLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAG 251
            + R+   +  G I AG  G+ VK      D     P      +      G+    ++ G
Sbjct: 448 -MSRVYSAKIAG-IKAGDEGLEVKGSAMASDAFF--PF--RDGIDAAAAVGITC-VIQPG 500

Query: 252 KSLVLEKELVKKHADEAGIFVC 273
            S+  +   V   ADE GI + 
Sbjct: 501 GSIRDD--EVIAAADEHGIAMI 520


>gi|229188555|ref|ZP_04315594.1| IMP cyclohydrolase [Bacillus cereus ATCC 10876]
 gi|228594744|gb|EEK52524.1| IMP cyclohydrolase [Bacillus cereus ATCC 10876]
          Length = 511

 Score = 42.0 bits (98), Expect = 0.087,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     T++   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKTQGSALAS------DAFFPMP----DTLEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|42779408|ref|NP_976655.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           ATCC 10987]
 gi|81411248|sp|Q73EN1|PUR9_BACC1 RecName: Full=Bifunctional purine biosynthesis protein purH;
           Includes: RecName:
           Full=Phosphoribosylaminoimidazolecarboxamide
           formyltransferase; AltName: Full=AICAR transformylase;
           Includes: RecName: Full=IMP cyclohydrolase; AltName:
           Full=ATIC; AltName: Full=IMP synthase; AltName:
           Full=Inosinicase
 gi|42735324|gb|AAS39263.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus ATCC 10987]
          Length = 511

 Score = 42.0 bits (98), Expect = 0.087,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     T++   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTLEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|294649948|ref|ZP_06727340.1| bifunctional purine biosynthesis protein PurH [Acinetobacter
           haemolyticus ATCC 19194]
 gi|292824177|gb|EFF82988.1| bifunctional purine biosynthesis protein PurH [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 524

 Score = 42.0 bits (98), Expect = 0.089,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 46/135 (34%), Gaps = 18/135 (13%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P      D++ A K A+ +    +     +   + + +   + +     RI   
Sbjct: 398 VVTKRAPTEQEIDDMIFAWKVAKYVKSNAI---VYAKNRQTIGVGAGQMSRVNSARIAAI 454

Query: 200 RNNGRILAGKSGVLVK-MCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
           +     L  +  V+        +D            + N  KAG+  I ++ G S+    
Sbjct: 455 KAEHAGLVVEGAVMASDAFFPFRDG-----------IDNAAKAGIKCI-IQPGGSM--RD 500

Query: 259 ELVKKHADEAGIFVC 273
           E     ADEAGI + 
Sbjct: 501 EETIAAADEAGIAMV 515


>gi|298372126|ref|ZP_06982116.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275030|gb|EFI16581.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacteroidetes oral taxon 274 str. F0058]
          Length = 509

 Score = 42.0 bits (98), Expect = 0.092,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 46/133 (34%), Gaps = 19/133 (14%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
            +    P+ D  RD+   +K  + +    +    V   G  + + G   T+ +    +  
Sbjct: 384 CVTDTRPSADELRDLNFGLKIVKHIKSNAI---CVVRDGATLGI-GAGQTNRIGSAEIAL 439

Query: 200 RNNGRILAGKSGVLVK-MCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
           R      A ++ VL             D        V+   K G+  I ++ G S+    
Sbjct: 440 RQAHSKGATQNLVLASDAFFP-----FD------DCVELASKMGVTAI-VQPGGSI--HD 485

Query: 259 ELVKKHADEAGIF 271
           +   + A+E GI 
Sbjct: 486 DDSVRKANEKGIS 498


>gi|237750956|ref|ZP_04581436.1| bifunctional purine biosynthesis protein PurH [Helicobacter bilis
           ATCC 43879]
 gi|229373401|gb|EEO23792.1| bifunctional purine biosynthesis protein PurH [Helicobacter bilis
           ATCC 43879]
          Length = 515

 Score = 42.0 bits (98), Expect = 0.093,   Method: Composition-based stats.
 Identities = 27/159 (16%), Positives = 52/159 (32%), Gaps = 24/159 (15%)

Query: 119 SYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAV--SI 176
             G     +  I P  +     +      +    D+  A K A          + V    
Sbjct: 368 EGGFVYQNSDFITPNEVRDSKCVSKAKATQAQMLDLEIAYKIASLTKS-----NCVTYVK 422

Query: 177 GGRVVALEGIEGTDSMLQRIVDCRNNGRI-LAGKSGVLV-KMCKSQQDMRADLPSIGAKT 234
            G +VA+ G+  T  +       +  G + L  K  VL  +     +D           +
Sbjct: 423 DGSLVAI-GMGMTSRVDASHAAIKKAGEMGLDLKGCVLASEAFFPFKD-----------S 470

Query: 235 VQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVC 273
           ++     G++   +E G S+  +   V + AD+  I + 
Sbjct: 471 IELAASVGVSA-VIEPGGSIRDD--EVIQEADKHNIALY 506


>gi|206968181|ref|ZP_03229137.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus AH1134]
 gi|206737101|gb|EDZ54248.1| phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP
           cyclohydrolase [Bacillus cereus AH1134]
          Length = 511

 Score = 42.0 bits (98), Expect = 0.093,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 45/137 (32%), Gaps = 25/137 (18%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDC 199
                 P+    +D+  A K  + +    +    ++     + +   +     + R+   
Sbjct: 388 IPTKREPSEQEWKDLKLAWKVVKHVKSNAI---VLAKDDMTIGVGAGQ-----MNRVGSA 439

Query: 200 RNNGRILAGK--SGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLE 257
           +        K     L        D    +P     T++   KAG+  I ++ G S+   
Sbjct: 440 KIAITQAGEKAQGSALAS------DAFFPMP----DTLEEAAKAGITAI-IQPGGSI--- 485

Query: 258 KEL-VKKHADEAGIFVC 273
           ++    K AD  GI + 
Sbjct: 486 RDEDSIKVADTYGIAMV 502


>gi|295099340|emb|CBK88429.1| IMP cyclohydrolase /phosphoribosylaminoimidazolecarboxamide
           formyltransferase [Eubacterium cylindroides T2-87]
          Length = 510

 Score = 42.0 bits (98), Expect = 0.094,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 44/135 (32%), Gaps = 21/135 (15%)

Query: 140 SLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQ-RIVD 198
            +    P ++    +L   K  + +    +    +      + +    G   M +     
Sbjct: 387 CVTNRKPTKEEIEQLLFGWKVVKHVKSNAI---VLVKDNMTIGV----GAGQMNRVGAAK 439

Query: 199 CRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEK 258
                     K  V+        D    +P     TVQ  IKAG+  I ++ G S+  + 
Sbjct: 440 IAIEQAQEKAKGSVMAS------DAFFPMP----DTVQEAIKAGVTAI-IQPGGSI--KD 486

Query: 259 ELVKKHADEAGIFVC 273
           +L     +E GI + 
Sbjct: 487 QLSIDECNEHGIAMV 501


>gi|218231618|ref|YP_002365127.1| bifunctional phosphoribosylaminoimidazolecarboxamide
           formyltransferase/IMP cyclohydrolase [Bacillus cereus
           B4264]
 gi|228950839|ref|ZP_04112963.1| IMP cyclohydrolase [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|229068041|ref|ZP_04201349.1| IMP cyclohydrolase [Bacillus cereus F65185]
 gi|229077