RPSBLAST alignment for GI: 254780768 and conserved domain: COG3494

>gnl|CDD|33297 COG3494, COG3494, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 279
 Score =  248 bits (634), Expect = 1e-66
 Identities = 130/276 (47%), Positives = 181/276 (65%), Gaps = 2/276 (0%)

Query: 3   RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62
           +L +IAG+G LP  VA+ AR +   P I  +  E   + ++FE +E+ +G+   L  +L 
Sbjct: 6   KLGLIAGNGSLPLEVAENARNQGYAPFIIGLRGEADPELKEFEYKEVSIGEVGKLIKLLK 65

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122
              + R+V+AG ++RRPN +DL         + K++  L+ G +A +LKA ID +ES G 
Sbjct: 66  TEGVDRVVLAGGVERRPNFRDLRPDKIGLAVLPKIVEALIRGDDA-LLKAVIDFIESRGF 124

Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182
            V+GAHEIVP LL + G L    P+ +  RDI   +++A AL  LDVGQ AV +GGRVVA
Sbjct: 125 KVIGAHEIVPGLLAETGPLTKKEPDNEDLRDIELGIEAANALGALDVGQGAVVVGGRVVA 184

Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242
           +EG EGTD+ML+R+ D R  GR    + GVLVKM K QQD RADLP+IG  T++N  KAG
Sbjct: 185 VEGAEGTDAMLRRVADLRKAGRA-ERRGGVLVKMAKPQQDERADLPTIGPNTIENAAKAG 243

Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278
           LAGIA+EAG+ L+LE+E   K A++ GIF+ GIDR+
Sbjct: 244 LAGIAIEAGRVLILEREATLKLANKLGIFIVGIDRD 279