RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62] (281 letters) >gnl|CDD|33297 COG3494, COG3494, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 279 Score = 248 bits (634), Expect = 1e-66 Identities = 130/276 (47%), Positives = 181/276 (65%), Gaps = 2/276 (0%) Query: 3 RLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSILH 62 +L +IAG+G LP VA+ AR + P I + E + ++FE +E+ +G+ L +L Sbjct: 6 KLGLIAGNGSLPLEVAENARNQGYAPFIIGLRGEADPELKEFEYKEVSIGEVGKLIKLLK 65 Query: 63 QYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESYGV 122 + R+V+AG ++RRPN +DL + K++ L+ G +A +LKA ID +ES G Sbjct: 66 TEGVDRVVLAGGVERRPNFRDLRPDKIGLAVLPKIVEALIRGDDA-LLKAVIDFIESRGF 124 Query: 123 SVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVA 182 V+GAHEIVP LL + G L P+ + RDI +++A AL LDVGQ AV +GGRVVA Sbjct: 125 KVIGAHEIVPGLLAETGPLTKKEPDNEDLRDIELGIEAANALGALDVGQGAVVVGGRVVA 184 Query: 183 LEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIKAG 242 +EG EGTD+ML+R+ D R GR + GVLVKM K QQD RADLP+IG T++N KAG Sbjct: 185 VEGAEGTDAMLRRVADLRKAGRA-ERRGGVLVKMAKPQQDERADLPTIGPNTIENAAKAG 243 Query: 243 LAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278 LAGIA+EAG+ L+LE+E K A++ GIF+ GIDR+ Sbjct: 244 LAGIAIEAGRVLILEREATLKLANKLGIFIVGIDRD 279 >gnl|CDD|31086 COG0743, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism]. Length = 385 Score = 33.3 bits (76), Expect = 0.085 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 3/91 (3%) Query: 190 DSMLQRIVDCRNNGRILAGKSGV--LVKMCKSQQDMRADLPSIGAKTVQNVIKAGLAGIA 247 +S + + D +L G+ G+ L + M A + + G IKAG IA Sbjct: 59 ESAAKELEDLLPGTEVLVGEEGLCELAAEDDADVVMNAIVGAAGLLPTLAAIKAG-KTIA 117 Query: 248 LEAGKSLVLEKELVKKHADEAGIFVCGIDRE 278 L +SLV ELV A E+G + +D E Sbjct: 118 LANKESLVTAGELVMDAAKESGAQLLPVDSE 148 >gnl|CDD|37590 KOG2379, KOG2379, KOG2379, Endonuclease MUS81 [Replication, recombination and repair]. Length = 501 Score = 31.9 bits (72), Expect = 0.18 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 9/71 (12%) Query: 26 DEPVIASVLNECSFD--WQDFEC----RELPLGDFCVLRSILHQYNIGRIVVAGAIDRRP 79 D I S+L F ++ R L +GDF + H+Y+ +V+ ++R+ Sbjct: 235 DTREIKSLLRRLFFGEYFELEGVKHEVRSLEVGDFLWVAR--HKYDGTELVLDFIVERK- 291 Query: 80 NVQDLCFSIKD 90 + DL SI+D Sbjct: 292 RLDDLVSSIRD 302 >gnl|CDD|32596 COG2604, COG2604, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 594 Score = 30.6 bits (69), Expect = 0.44 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Query: 226 DLPSIGAKTVQNVIKAGLAGIALEAGKSLVLEKELVKKHADEAGIFVCG 274 +L S + I AG SL + L+KK+ D+A IF Sbjct: 215 ELLSKRKNISEPAIIVS-------AGPSLEKQLPLLKKYQDKATIFCAD 256 >gnl|CDD|144106 pfam00388, PI-PLC-X, Phosphatidylinositol-specific phospholipase C, X domain. This associates with pfam00387 to form a single structural unit. Length = 144 Score = 30.1 bits (69), Expect = 0.70 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 17 VAKAARLKNDEPVIASVLNECSFDWQD 43 + + A + + PVI S+ N CS + Q Sbjct: 76 IKEYAFVTSPYPVILSLENHCSPEQQA 102 >gnl|CDD|176536 cd08594, PI-PLCc_eta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta. This family corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding motif, a potential interaction site for other signaling proteins. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are two PI-PLC-eta isozymes (1-2), both neuron-specific enzymes. They function as calcium sensors that are activated by small increases in intracellular calcium concentrations. The PI-PLC-eta isozymes are also activated through GPCR stimulation. Aside from the PI-PLC-eta isozymes identified in mammals, their eukaryotic homologs are also present in this family. Length = 227 Score = 29.4 bits (66), Expect = 1.3 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Query: 17 VAKAARLKNDEPVIASVLNECSFDWQDFECRELP--LGDFCVLRSIL 61 + K A +KN+ PVI S+ N CS Q + L LGD L S++ Sbjct: 79 INKYAFIKNEYPVILSIENHCSVQQQKKMAQYLKEILGDKLDLSSVI 125 >gnl|CDD|32789 COG2969, SspB, Stringent starvation protein B [General function prediction only]. Length = 155 Score = 28.8 bits (64), Expect = 1.7 Identities = 14/51 (27%), Positives = 23/51 (45%) Query: 129 EIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGR 179 ++ P L+V V G VP V+ + + A+ L++G VS R Sbjct: 24 QLTPHLVVDVTLPGVKVPMEYVRDGQIVLNIAPRAVGNLELGNDWVSFNAR 74 >gnl|CDD|145731 pfam02732, ERCC4, ERCC4 domain. This domain is a family of nucleases. The family includes EME1 which is an essential component of a Holliday junction resolvase. EME1 interacts with MUS81 to form a DNA structure-specific endonuclease. Length = 109 Score = 28.2 bits (63), Expect = 2.7 Identities = 19/88 (21%), Positives = 35/88 (39%), Gaps = 20/88 (22%) Query: 45 ECRELPLGDF-----------CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLR 93 E LP+GD+ + R + N+ ++V R + DL S+KD R Sbjct: 31 EPCTLPVGDYLWSARNKSYKAELRRQLQLDENVLIVIV-----ERKELADLINSLKDG-R 84 Query: 94 ISKMIWQLVSGGNAAILKASIDLLESYG 121 + + + +L + K + L+E Sbjct: 85 LFEQLQRL---ARVSAYKKPVLLVEGDR 109 >gnl|CDD|36325 KOG1109, KOG1109, KOG1109, Vacuole membrane protein VMP1 [General function prediction only]. Length = 440 Score = 28.0 bits (62), Expect = 3.1 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 13/41 (31%) Query: 12 MLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLG 52 + PY++A+AARL EP D E E G Sbjct: 224 LPPYFMARAARLSGVEP-------------DDEEYTEFEEG 251 >gnl|CDD|37914 KOG2703, KOG2703, KOG2703, C4-type Zn-finger protein [General function prediction only]. Length = 460 Score = 27.6 bits (61), Expect = 3.6 Identities = 12/38 (31%), Positives = 23/38 (60%) Query: 149 DVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGI 186 D+ RD+L + + ++ ELD+ ++GGR +EG+ Sbjct: 322 DLSRDVLKSETCSLSIPELDLELGGGTLGGRFTTIEGL 359 >gnl|CDD|177091 CHL00192, syfB, phenylalanyl-tRNA synthetase beta chain; Provisional. Length = 704 Score = 27.7 bits (62), Expect = 3.9 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Query: 81 VQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120 ++DL F IK S+ ISK I +L+ +L+ SI L + Y Sbjct: 616 IRDLSFIIKKSISISK-IKELIYQNGDNLLE-SITLFDYY 653 >gnl|CDD|176568 cd08631, PI-PLCc_delta4, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta4. This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-delta4 isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-delta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, and a C-terminal C2 domain. This CD corresponds to the catalytic domain which is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are three PI-PLC-delta isozymes (1,3 and 4). Unlike PI-PLC-delta 1 and 3, a putative nuclear export sequence (NES) located in the EF-hand domain, which may be responsible transporting PI-PLC-delta1 and 3 from the cell nucleus, is not present in PI-PLC-delta4. Experiments show PI-PLC-delta4 is required for the acrosome reaction in fertilization. Length = 258 Score = 27.6 bits (61), Expect = 3.9 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query: 17 VAKAARLKNDEPVIASVLNECSFDWQDFECRELP--LGD 53 VA+ A +D PVI S+ N C + Q + L LG+ Sbjct: 79 VAQYAFQVSDYPVILSLENHCGVEQQQTMAQHLTEILGE 117 >gnl|CDD|176569 cd08632, PI-PLCc_eta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta1. This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-eta isozyme 1. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which then phosphorylates other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PI-PLC-eta represents a class of neuron-speific PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal tail that terminates with a PDZ-binding motif, a potential interaction site for other signaling proteins. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. PI-PLC-eta1 is a neuron-specific enzyme and expressed in only nerve tissues such as the brain and spinal cord. It may perform a fundamental role in the brain. Length = 253 Score = 26.9 bits (59), Expect = 6.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Query: 17 VAKAARLKNDEPVIASVLNECSFDWQ 42 + K A +KN+ PVI S+ N CS Q Sbjct: 79 INKYAFVKNEFPVILSIENHCSIQQQ 104 >gnl|CDD|176294 cd01218, PH_phafin2, Phafin2 Pleckstrin Homology (PH) domain. Phafin2 Pleckstrin Homology (PH) domain. Phafin contains a PH domain and a FYVE domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinsases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 104 Score = 26.8 bits (59), Expect = 7.0 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Query: 203 GRILAGKSGVLVKMCKSQQDMR 224 GR+L G+ GVL KMC+ + R Sbjct: 1 GRVLVGE-GVLTKMCRKKPKQR 21 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.394 Gapped Lambda K H 0.267 0.0850 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,204,003 Number of extensions: 164746 Number of successful extensions: 418 Number of sequences better than 10.0: 1 Number of HSP's gapped: 416 Number of HSP's successfully gapped: 23 Length of query: 281 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 188 Effective length of database: 4,254,100 Effective search space: 799770800 Effective search space used: 799770800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.5 bits)