RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780768|ref|YP_003065181.1| hypothetical protein
CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)



>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo
           sapiens) [TaxId: 9606]}
          Length = 205

 Score = 29.6 bits (65), Expect = 0.34
 Identities = 13/102 (12%), Positives = 27/102 (26%), Gaps = 1/102 (0%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           +K++ I   +G         A ++    V   V +      +      + +GD      +
Sbjct: 3   VKKIAIFGATGQTGLTTLAQA-VQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADV 61

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLV 102
                    V+     R         S      ++ M    V
Sbjct: 62  DKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGV 103


>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo
           sapiens) [TaxId: 9606]}
          Length = 147

 Score = 28.7 bits (63), Expect = 0.54
 Identities = 21/124 (16%), Positives = 39/124 (31%), Gaps = 4/124 (3%)

Query: 2   KRLLIIA-GSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           K + +IA G+G+ P      A +K+ +      L   +   +D   R           + 
Sbjct: 19  KSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSAR 78

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQ-LVSGGNAAILKASIDLLES 119
              +             +  V +    I+D L   +     L+ G    I  A +  L+ 
Sbjct: 79  FKLWYTLDRAPEAWDYGQGFVNEE--MIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDH 136

Query: 120 YGVS 123
            G  
Sbjct: 137 VGHP 140


>d1dk0a_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia
           marcescens [TaxId: 615]}
          Length = 173

 Score = 28.2 bits (63), Expect = 0.70
 Identities = 10/29 (34%), Positives = 19/29 (65%)

Query: 96  KMIWQLVSGGNAAILKASIDLLESYGVSV 124
           ++++ L+SG   A+  A   +L+ YG+SV
Sbjct: 133 QVVYGLMSGDTGALETALNGILDDYGLSV 161


>d1ou8a_ b.136.1.1 (A:) Stringent starvation protein B, SspB
           {Haemophilus influenzae [TaxId: 727]}
          Length = 106

 Score = 26.5 bits (59), Expect = 2.8
 Identities = 14/49 (28%), Positives = 18/49 (36%)

Query: 132 PELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           P L+V    LG  VP   VK   +    SA A   L +    +    R 
Sbjct: 23  PYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARF 71


>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose
          epimerase/reductase (GDP-fucose synthetase)
          {Escherichia coli [TaxId: 562]}
          Length = 315

 Score = 26.4 bits (57), Expect = 3.1
 Identities = 10/71 (14%), Positives = 24/71 (33%), Gaps = 12/71 (16%)

Query: 2  KRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSIL 61
          +R+ I    GM+   + +    + D  ++    +E +            L D   +    
Sbjct: 3  QRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELN------------LLDSRAVHDFF 50

Query: 62 HQYNIGRIVVA 72
              I ++ +A
Sbjct: 51 ASERIDQVYLA 61


>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human
           (Homo sapiens) [TaxId: 9606]}
          Length = 388

 Score = 25.8 bits (55), Expect = 3.9
 Identities = 9/52 (17%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 116 LLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSEL 167
           +++ + + ++G        ++++G LG      +V R +  A++   AL   
Sbjct: 336 VIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDR-VTEALR--AALQHC 384


>d1d2na_ c.37.1.20 (A:) Hexamerization domain of
           N-ethylmalemide-sensitive fusion (NSF) protein {Chinese
           hamster (Cricetulus griseus) [TaxId: 10029]}
          Length = 246

 Score = 25.7 bits (55), Expect = 4.5
 Identities = 11/61 (18%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 145 VPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVVALEGIEGTDSMLQRIVDCRNNGR 204
           VPN      +L A++      + +    A  + G+ V + GI+    +++  +      R
Sbjct: 171 VPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWI-GIKKLLMLIEMSLQMDPEYR 229

Query: 205 I 205
           +
Sbjct: 230 V 230


>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240
          (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId:
          3702]}
          Length = 252

 Score = 25.2 bits (53), Expect = 5.7
 Identities = 12/85 (14%), Positives = 30/85 (35%), Gaps = 2/85 (2%)

Query: 1  MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCV--LR 58
          +  +L+   SG     V K  +  +D+ V   ++       +     ++ +GD       
Sbjct: 3  LPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSI 62

Query: 59 SILHQYNIGRIVVAGAIDRRPNVQD 83
          +   Q     +++  A+ +     D
Sbjct: 63 NPAFQGIDALVILTSAVPKMKPGFD 87


>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus
          pneumoniae) [TaxId: 1313]}
          Length = 232

 Score = 25.1 bits (54), Expect = 6.4
 Identities = 5/53 (9%), Positives = 15/53 (28%), Gaps = 7/53 (13%)

Query: 1  MKRLLIIAGS-------GMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFEC 46
          M ++ I AG              ++     +N+  +          +  + + 
Sbjct: 1  MNKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDS 53


>d1wuis1 e.19.1.1 (S:1-267) Nickel-iron hydrogenase, small subunit
           {Desulfovibrio vulgaris [TaxId: 881]}
          Length = 267

 Score = 25.3 bits (55), Expect = 6.9
 Identities = 28/151 (18%), Positives = 50/151 (33%), Gaps = 6/151 (3%)

Query: 23  LKNDEPVIAS-VLNECSFDWQDFECRELPLGDFCVLRSILHQYNIGRIVVAGAIDRRPNV 81
           L+  EP I + +L+  S D+ +             L   ++  +    VV G I    N 
Sbjct: 25  LRAFEPYIDTLILDTLSLDYHETIMAAAGDAAEAALEQAVNSPHGFIAVVEGGIPTAANG 84

Query: 82  QDLCFSIKDSLRISKMI----WQLVSGGNAAILKASIDLLESYGVSVVGAHEIVPELLVQ 137
                +    L I   I      +++ G  A          +      G ++ +  L V+
Sbjct: 85  IYGKVANHTMLDICSRILPKAQAVIAYGTCATFGGVQAAKPNPTG-AKGVNDALKHLGVK 143

Query: 138 VGSLGTCVPNRDVKRDILAAMKSAEALSELD 168
             ++  C PN       +      +A  ELD
Sbjct: 144 AINIAGCPPNPYNLVGTIVYYLKNKAAPELD 174


>d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator
           {Rhodococcus sp. rha1 [TaxId: 101510]}
          Length = 72

 Score = 25.1 bits (55), Expect = 7.1
 Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 3/52 (5%)

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM 158
            AILKAS   +   G+  +  +++     V  G L     +   +  +L A 
Sbjct: 5   DAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKD---RIGLLEAA 53


>d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator
           SCO4850 {Streptomyces coelicolor [TaxId: 1902]}
          Length = 75

 Score = 25.0 bits (55), Expect = 8.1
 Identities = 11/52 (21%), Positives = 18/52 (34%), Gaps = 3/52 (5%)

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM 158
           A IL+ ++ L +  G        I  E  V VG+          K  ++   
Sbjct: 8   ALILETAMRLFQERGYDRTTMRAIAQEAGVSVGNAYYYFAG---KEHLIQGF 56


>d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator
           SCO5951 {Streptomyces coelicolor [TaxId: 1902]}
          Length = 68

 Score = 24.6 bits (54), Expect = 8.7
 Identities = 10/52 (19%), Positives = 18/52 (34%), Gaps = 3/52 (5%)

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM 158
            A+L A+ D L + G   +   EI     V   ++            + A +
Sbjct: 9   EAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWGT---PGGLAADL 57


>d1jt6a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR
           {Staphylococcus aureus [TaxId: 1280]}
          Length = 71

 Score = 24.7 bits (54), Expect = 9.0
 Identities = 10/52 (19%), Positives = 17/52 (32%), Gaps = 3/52 (5%)

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM 158
             IL  + +L    G +     EIV       G+L         K ++   +
Sbjct: 4   DKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKT---KENLFLEI 52


>d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB
           {Streptomyces coelicolor [TaxId: 1902]}
          Length = 71

 Score = 24.6 bits (54), Expect = 9.1
 Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 3/52 (5%)

Query: 107 AAILKASIDLLESYGVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAM 158
           A I+ A+ DL +  G       EIV    V  G+L         K D+  A+
Sbjct: 8   ATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAA---KEDLAHAI 56


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.321    0.138    0.394 

Gapped
Lambda     K      H
   0.267   0.0687    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,004,997
Number of extensions: 45338
Number of successful extensions: 133
Number of sequences better than 10.0: 1
Number of HSP's gapped: 133
Number of HSP's successfully gapped: 30
Length of query: 281
Length of database: 2,407,596
Length adjustment: 84
Effective length of query: 197
Effective length of database: 1,254,276
Effective search space: 247092372
Effective search space used: 247092372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (23.9 bits)