BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780768|ref|YP_003065181.1| hypothetical protein
CLIBASIA_03295 [Candidatus Liberibacter asiaticus str. psy62]
         (281 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780768|ref|YP_003065181.1| hypothetical protein CLIBASIA_03295 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 281

 Score =  563 bits (1452), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 281/281 (100%), Positives = 281/281 (100%)

Query: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60
           MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI
Sbjct: 1   MKRLLIIAGSGMLPYYVAKAARLKNDEPVIASVLNECSFDWQDFECRELPLGDFCVLRSI 60

Query: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120
           LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY
Sbjct: 61  LHQYNIGRIVVAGAIDRRPNVQDLCFSIKDSLRISKMIWQLVSGGNAAILKASIDLLESY 120

Query: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180
           GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV
Sbjct: 121 GVSVVGAHEIVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRV 180

Query: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240
           VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK
Sbjct: 181 VALEGIEGTDSMLQRIVDCRNNGRILAGKSGVLVKMCKSQQDMRADLPSIGAKTVQNVIK 240

Query: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281
           AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI
Sbjct: 241 AGLAGIALEAGKSLVLEKELVKKHADEAGIFVCGIDREFAI 281


>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 539

 Score = 24.6 bits (52), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 4/29 (13%)

Query: 82  QDLCFSI----KDSLRISKMIWQLVSGGN 106
           + +C S     +DSL   K +W+ +SGG+
Sbjct: 378 ETVCLSYVDQSRDSLEAEKTVWEDISGGD 406


>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 798

 Score = 23.9 bits (50), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 9/49 (18%)

Query: 45  ECRELPLGDF--CVLRSILHQYNIGRIVVAGAIDRRPNVQDLCFSIKDS 91
           EC+  P   F   V R++LH  + GR +V GA     N+    FS  DS
Sbjct: 79  ECK--PTSSFQRVVQRAVLHVQSTGRGIVTGA-----NILVALFSEPDS 120


>gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 559

 Score = 23.9 bits (50), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 8/22 (36%), Positives = 15/22 (68%)

Query: 142 GTCVPNRDVKRDILAAMKSAEA 163
           GTC+  + +K++I   MK+A+ 
Sbjct: 205 GTCISEKGIKKNIYDIMKNAKG 226


>537021.9.peg.394_1 
          Length = 142

 Score = 22.7 bits (47), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 42/106 (39%), Gaps = 23/106 (21%)

Query: 63  QYNIGRIVVAGAIDRRPNVQDLCFSI-------KDSLRISKMIWQ---------LVSGGN 106
            YNI     AGAI  + NV  L F         K+   ISK+             +SGG 
Sbjct: 38  TYNINADTFAGAIAEKLNVIRLLFLTDVPGVLDKNRQLISKLSINEARTLIKDGTISGGM 97

Query: 107 AAILKASIDLLESYGVSVVG------AHEIVPELLVQVGSLGTCVP 146
              ++ SI  +E+ GV  V        H I+ E+  + GS    +P
Sbjct: 98  IPKIETSIKAIEN-GVKSVAILDGKKPHSILMEIFTKNGSGTLLIP 142


>gi|254780652|ref|YP_003065065.1| Fructose-bisphosphate aldolase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 339

 Score = 22.3 bits (46), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 130 IVPELLVQVGSLGTCVPNRDVKRDILAAMKSAEALSELDVGQSAVSIGGRVV--ALEGI 186
           ++  L  ++ ++  C     +K +++   KSA  +S+ ++  + + I  RVV  A++GI
Sbjct: 197 VLRTLFNELYTMRVCFEGLVLKSNMILPGKSAPQVSDEEIASNTIKIFKRVVPCAVQGI 255


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.321    0.138    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 165,541
Number of Sequences: 1233
Number of extensions: 6468
Number of successful extensions: 22
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 15
Number of HSP's gapped (non-prelim): 9
length of query: 281
length of database: 328,796
effective HSP length: 73
effective length of query: 208
effective length of database: 238,787
effective search space: 49667696
effective search space used: 49667696
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 38 (19.2 bits)