>TIGR00051 TIGR00051 conserved hypothetical protein; InterPro: IPR006684 4-hydroxybenzoyl-CoA thioesterase (3.1.2.23 from EC) is an enzyme from Pseudomonas CBS-3, a soil-dwelling microbe that survives on 4-chlorobenzoate as its sole carbon source. This enzyme catalyzes the last of the three steps in the pathway from 4-chlorobenzoate to hydroxybenzoate, the cleavage of the thioester bond of 4-hydroxybenzoyl-CoA to form hydroxybenzoate. 4-hydroxybenzoyl-CoA + H_2O = 4-hydroxybenzoate + CoA 4-hydroxybenzoyl-CoA thioesterase is a protein of 141 amino-acid residues that assemble as an homotetramer. An aspartate in the N-terminal domain is thought to participate in the catalytic mechanism. This enzyme is evolutionary related to a number of uncharacterised proteins.; GO: 0016787 hydrolase activity.

Probab=90.51 E-value=1.4 Score=23.71 Aligned_cols=65 Identities=17% Similarity=0.050 Sum_probs=51.0 Q ss_pred EEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEECCEEEEEEEEEEE--EECCCCCC Q ss_conf 267752364136002212888999999997207779999999999999998999999--84452002 Q gi|254780770|r 92 PPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEICAM--VMHEKKEK 156 (161) Q Consensus 92 ~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~~~~va~a~l~~~--i~~~~~e~ 156 (161) T Consensus 50 ~~~vV~~~~~~Y~~Pa~ldd~L~i~t~~~~l~g~~~~f~q~i~~~~~~l~~~~~~~~fvC~d~~~~K 116 (121) T TIGR00051 50 VAFVVVKINIEYKKPARLDDVLEIRTQIEELNGFSVVFSQEIFREDEALLKAATKIHFVCVDLKKFK 116 (121) T ss_pred EEEEEEEEEEEEECCCCCCCEEEEEEEEEECCCEEEEEEEEEECCCHHEECCCEEEEEEEEECCCCC T ss_conf 0489985564210365348578998888750564789999998061110014553799997524375

HHsearch alignment for GI: 254780770 and conserved domain: TIGR00051