>cd03440 hot_dog The hotdog fold was initially identified in the E. coli FabA (beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase) structure and subsequently in 4HBT (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A number of other seemingly unrelated proteins also share the hotdog fold. These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism, and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate. This superfamily also includes the PaaI-like protein FapR, a non-catalytic bacterial homolog involved in transcriptional regulation of fatty acid biosynthesis.

Probab=98.21 E-value=3.4e-05 Score=51.47 Aligned_cols=85 Identities=29% Similarity=0.353 Sum_probs=70.3 Q ss_pred CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEEEECCEEEEEEEEEEEECCEEEEEEEEEEC-CE Q ss_conf 99502256699998634634544329977630267752364136002212888999999997207779999999999-99 Q gi|254780770|r 60 GRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVE-NT 138 (161) Q Consensus 60 ~~PvmPGvLliE~maQ~~~~l~~~~~~~~~~~~~~l~~i~~~kF~~~V~PGd~L~i~~~i~~~~~~~~~~~~~~~v~-~~ 138 (161) T Consensus 14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~-~~f~~~~~~g~~i~~~~~~~~~~~~~~~~~~~~~~~~~~ 90 (100) T cd03440 14 GGGIVHGGLLLALADEAAGAAAARLGG--RGLGAVTLSLD-VRFLRPVRPGDTLTVEAEVVRVGRSSVTVEVEVRNEDGK 90 (100) T ss_pred CCCCEEHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEEEE-EEEEECCCCCCEEEEEEEEEECCCEEEEEEEEEEECCCC T ss_conf 898590799999999999999998568--99359999999-998005879909999999998897199999999989897 Q ss_pred EEEEEEEEE Q ss_conf 999899999 Q gi|254780770|r 139 VVAEAEICA 147 (161) Q Consensus 139 ~va~a~l~~ 147 (161) T Consensus 91 ~~~~~~~~~ 99 (100) T cd03440 91 LVATATATF 99 (100) T ss_pred EEEEEEEEE T ss_conf 999999998

HHsearch alignment for GI: 254780770 and conserved domain: cd03440