RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter asiaticus str. psy62] (161 letters) >gnl|CDD|48033 cd01288, FabZ, FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway.. Length = 131 Score = 175 bits (445), Expect = 5e-45 Identities = 65/131 (49%), Positives = 85/131 (64%) Query: 20 LPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGA 79 LPHRYPFLLVD+V+ ++ +S + IKNVT NEP F GHFPG P+MPGVLI+E +AQ AG Sbjct: 1 LPHRYPFLLVDRVLELEPGKSIVAIKNVTINEPFFQGHFPGNPIMPGVLIIEALAQAAGI 60 Query: 80 ICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTV 139 + + Y IDKARFRKPV PGD+L V ++ R + KF+ A V+ + Sbjct: 61 LGLKSLEDFEGKLVYFAGIDKARFRKPVVPGDQLILEVELLKLRRGIGKFKGKAYVDGKL 120 Query: 140 VAEAEICAMVM 150 VAEAE+ + Sbjct: 121 VAEAELMFAIA 131 >gnl|CDD|31107 COG0764, FabA, 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism]. Length = 147 Score = 156 bits (396), Expect = 3e-39 Identities = 69/141 (48%), Positives = 89/141 (63%), Gaps = 3/141 (2%) Query: 12 DIVELMRFLPHRYPFLLVDKVVNIQRDESAI-GIKNVTFNEPHFMGHFPGRPVMPGVLIL 70 DI E++ LPHRYPFLLVD+V+ I + I IKNVT NEP F GHFPG P+MPGVLIL Sbjct: 5 DIGEILELLPHRYPFLLVDRVLEIDEEGKRIVAIKNVTINEPFFTGHFPGDPIMPGVLIL 64 Query: 71 EGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRV-DLWKF 129 E MAQ AG + G Y + ID A+F++PV PGD+LE V +++R + K Sbjct: 65 EAMAQAAGFLLGWLLGNKGKL-GYFLGIDNAKFKRPVLPGDQLELEVKLLKSRRLGIGKA 123 Query: 130 QCCAKVENTVVAEAEICAMVM 150 + A V+ VVAEAE+ + Sbjct: 124 KGVATVDGKVVAEAELLFAGV 144 >gnl|CDD|48029 cd00493, FabA_FabZ, FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation. The third step of the elongation cycle, the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, is catalyzed by FabA or FabZ. FabA is bifunctional and catalyzes an additional isomerization reaction of trans-2-acyl-ACP to cis-3-acyl-ACP, an essential reaction to unsaturated fatty acid synthesis. FabZ is the primary dehydratase that participates in the elongation cycles of saturated as well as unsaturated fatty acid biosynthesis, whereas FabA is more active in the dehydration of beta-hydroxydecanoyl-ACP. The FabA structure is homodimeric with two independent active sites located at the dimer interface.. Length = 131 Score = 151 bits (382), Expect = 1e-37 Identities = 62/131 (47%), Positives = 75/131 (57%), Gaps = 2/131 (1%) Query: 21 PHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAI 80 PHRYP LLVD+V+ I + KNVT NEP F GHFPG PVMPGVL +E MAQ A A+ Sbjct: 1 PHRYPMLLVDRVLEIDPGGRIVAEKNVTPNEPFFQGHFPGDPVMPGVLGIEAMAQAAAAL 60 Query: 81 CAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENT 138 + P YL + K +FR PV PGD L V ++ R L KF A V+ Sbjct: 61 AGLLGLGKGNPPRLGYLAGVRKVKFRGPVLPGDTLTLEVELLKVRRGLGKFDGRAYVDGK 120 Query: 139 VVAEAEICAMV 149 +VAEAE+ A Sbjct: 121 LVAEAELMAAA 131 >gnl|CDD|48032 cd01287, FabA, FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site. The FabA structure is a homodimer with two independent active sites located at the dimer interface. Each active site is tunnel-shaped and completely inaccessible to solvent. No metal ions or cofactors are required for ligand binding or catalysis.. Length = 150 Score = 47.9 bits (114), Expect = 1e-06 Identities = 25/111 (22%), Positives = 39/111 (35%), Gaps = 13/111 (11%) Query: 25 PFLLVDKVVNIQRDES------AIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAG 78 L++D+V I K++ ++ F HF G PVMPG L LE M Q Sbjct: 7 QLLMLDRVTEIDPGGGTFGLGYLRAEKDIDPDDWFFPCHFHGDPVMPGSLGLEAMIQLLQ 66 Query: 79 AICAIHNGFDQYAPPYLMSID----KARFRKPVFPGD---RLEYHVNKVRN 122 P + ++R + P + E H+ +V Sbjct: 67 FYLIWLGLGTGVDNPRFQGAPGGPGEWKYRGQITPHNKKVTYEVHIKEVGR 117 >gnl|CDD|48035 cd03440, hot_dog, The hotdog fold was initially identified in the E. coli FabA (beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase) structure and subsequently in 4HBT (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A number of other seemingly unrelated proteins also share the hotdog fold. These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism, and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate. This superfamily also includes the PaaI-like protein FapR, a non-catalytic bacterial homolog involved in transcriptional regulation of fatty acid biosynthesis.. Length = 100 Score = 45.2 bits (106), Expect = 1e-05 Identities = 26/102 (25%), Positives = 37/102 (36%), Gaps = 10/102 (9%) Query: 45 KNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFR 104 VT + G + G L+L + AGA A G A + + RF Sbjct: 5 LTVTPEDIDGGGI------VHGGLLLALADEAAGAAAARLGGRGLGAVTLSLDV---RFL 55 Query: 105 KPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVEN-TVVAEAEI 145 +PV PGD L VR + + E+ +VA A Sbjct: 56 RPVRPGDTLTVEAEVVRVGRSSVTVEVEVRNEDGKLVATATA 97 >gnl|CDD|48034 cd01289, FabA_like, Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ). This group appears to lack the conserved active site histidine of FabA and FabZ.. Length = 138 Score = 42.9 bits (101), Expect = 4e-05 Identities = 30/136 (22%), Positives = 53/136 (38%), Gaps = 8/136 (5%) Query: 18 RFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTA 77 +PH P L+D+V++ D+ +I + +P F GR +P + +E MAQ Sbjct: 5 ALIPHDGPMCLLDRVISW--DDDSIHCRATVHPDPLFPLRAHGR--LPAWVGIEYMAQAI 60 Query: 78 GAICAIHNGFDQYAPP--YLMSIDKARFRKPVFP-GDRLEYHVNKV-RNRVDLWKFQCCA 133 A + P +L+ K F G L V ++ + L F+C Sbjct: 61 AAHGGLLARQQGNPPRPGFLLGSRKYEAHVDRFDLGSTLLIVVAELLQGDSGLGVFECTI 120 Query: 134 KVENTVVAEAEICAMV 149 + + V+A + Sbjct: 121 EDQGGVLASGRLNVYQ 136 >gnl|CDD|48043 cd03448, HDE_HSD, HDE_HSD The R-hydratase-like hot dog fold of the 17-beta-hydroxysteriod dehydrogenase (HSD), and Hydratase-Dehydrogenase-Epimerase (HDE) proteins. Other enzymes with this fold include MaoC dehydratase, and the fatty acid synthase beta subunit.. Length = 122 Score = 39.8 bits (93), Expect = 3e-04 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 16/78 (20%) Query: 69 ILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128 IL G+ A A+ F P +I K RF PVFPG+ L R ++WK Sbjct: 46 ILHGLCTYGFAARAVLEAFADGDPARFKAI-KVRFSSPVFPGETL---------RTEMWK 95 Query: 129 ------FQCCAKVENTVV 140 FQ + VV Sbjct: 96 EGNRVIFQTKVVERDVVV 113 >gnl|CDD|48036 cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase]. Catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway. The structure of the monomer includes a five-strand antiparallel beta-sheet wrapped around a central alpha helix, referred to as a hot dog fold. The active site lies within a substrate-binding tunnel formed by the homodimer. Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.. Length = 127 Score = 36.1 bits (83), Expect = 0.004 Identities = 16/65 (24%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Query: 61 RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120 + G I GM T + + + RF PVFPGD L V + Sbjct: 36 KAAGFGGRIAHGM-LTLSLASGLLVQWLPGTDGANLGSQSVRFLAPVFPGDTLRVEVEVL 94 Query: 121 RNRVD 125 R Sbjct: 95 GKRPS 99 >gnl|CDD|34322 COG4706, COG4706, Predicted 3-hydroxylacyl-(acyl carrier protein) dehydratase [Lipid metabolism]. Length = 161 Score = 35.4 bits (81), Expect = 0.007 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Query: 19 FLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAG 78 +LPH P LL+D VV D+SA V+ + F+ G +P +E MAQ G Sbjct: 15 YLPHSGPMLLLDDVVTWD-DDSARCRATVSPSGAPFL-DPDGN--LPAWFGIELMAQAVG 70 Query: 79 AICAIH 84 Sbjct: 71 VHSGWL 76 >gnl|CDD|48037 cd03442, BFIT_BACH, Brown fat-inducible thioesterase (BFIT). Brain acyl-CoA hydrolase (BACH). These enzymes deacylate long-chain fatty acids by hydrolyzing acyl-CoA thioesters to free fatty acids and CoA-SH. Eukaryotic members of this family are expressed in brain, testis, and brown adipose tissues. The archeal and eukaryotic members of this family have two tandem copies of the conserved hot dog fold, while most bacterial members have only one copy.. Length = 123 Score = 33.3 bits (76), Expect = 0.036 Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Query: 69 ILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEY--HVNKVRN 122 +LE M + AG H G S+D+ F KPV GD +E V Sbjct: 30 LLEWMDELAGIAAYRHAG----GRVVTASVDRIDFLKPVRVGDVVELSARVVYTGR 81 >gnl|CDD|48046 cd03451, FkbR2, FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes. FkbR2 has sequence similarity to (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. The function of FkbR2 is unknown.. Length = 146 Score = 32.8 bits (75), Expect = 0.044 Identities = 24/115 (20%), Positives = 42/115 (36%), Gaps = 21/115 (18%) Query: 47 VTFNEPHFMGHFPGRPVMPGVLILE---GMAQTAGAICAIHNGFDQYAPPYLMSIDKARF 103 + F+ + GR ++ + L G++ ++ A+ N + D+ RF Sbjct: 39 LHFDAAYAAKTEFGRRLVNSLFTLSLALGLSVNDTSLTAVAN----------LGYDEVRF 88 Query: 104 RKPVFPGDRL--EYHV-----NKVRNRVDLWKFQCCA-KVENTVVAEAEICAMVM 150 PVF GD L E V +K R + + + V E A+V Sbjct: 89 PAPVFHGDTLYAESEVLSKRESKSRPDAGIVTVRTVGYNQDGEPVLSFERTALVP 143 >gnl|CDD|145944 pfam03061, 4HBT, Thioesterase superfamily. This family contains a wide variety of enzymes, principally thioesterases. This family includes 4HBT (EC 3.1.2.23) which catalyses the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3. This family includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and palmitate, they also catalyse the hydrolysis of other long chain fatty acyl-CoA thioesters. Length = 79 Score = 32.6 bits (75), Expect = 0.045 Identities = 10/54 (18%), Positives = 15/54 (27%), Gaps = 4/54 (7%) Query: 73 MAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYH--VNKVRNRV 124 +A A A G + F +P GD L V ++ Sbjct: 12 LADEAAGAAARSLGGSGQVVV--VVELNIDFLRPARLGDVLTVEARVVRLGRTS 63 >gnl|CDD|144971 pfam01575, MaoC_dehydratas, MaoC like domain. The maoC gene is part of a operon with maoA which is involved in the synthesis of monoamine oxidase. The MaoC protein is found to share similarity with a wide variety of enzymes; estradiol 17 beta-dehydrogenase 4, peroxisomal hydratase-dehydrogenase-epimerase, fatty acid synthase beta subunit. Several bacterial proteins that are composed solely of this domain have (R)-specific enoyl-CoA hydratase activity. This domain is also present in the NodN nodulation protein N. Length = 123 Score = 31.9 bits (73), Expect = 0.075 Identities = 12/26 (46%), Positives = 12/26 (46%) Query: 98 IDKARFRKPVFPGDRLEYHVNKVRNR 123 RF PVFPGD L V V R Sbjct: 80 GWSVRFTGPVFPGDTLRTEVEVVGKR 105 >gnl|CDD|32213 COG2030, MaoC, Acyl dehydratase [Lipid metabolism]. Length = 159 Score = 32.0 bits (72), Expect = 0.086 Identities = 19/58 (32%), Positives = 25/58 (43%) Query: 66 GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNR 123 G I GM A A+ + + + D+ RF KPVFPGD L V + R Sbjct: 66 GGPIAHGMLTLALAMGLVVAALGDPSVGANLGGDEVRFVKPVFPGDTLRARVEVLDKR 123 >gnl|CDD|48049 cd03454, YdeM, YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function. YdeM has sequence similarity to the hot-dog fold of (R)-specific enoyl-CoA hydratase. Other enzymes with this fold include the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.. Length = 140 Score = 31.3 bits (71), Expect = 0.13 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 98 IDKARFRKPVFPGDRLEYHV 117 ID+ R+ +PV PGD L V Sbjct: 80 IDELRWPRPVRPGDTLSVEV 99 >gnl|CDD|36420 KOG1206, KOG1206, KOG1206, Peroxisomal multifunctional beta-oxidation protein and related enzymes [Lipid transport and metabolism]. Length = 272 Score = 30.4 bits (68), Expect = 0.26 Identities = 21/74 (28%), Positives = 27/74 (36%), Gaps = 14/74 (18%) Query: 69 ILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWK 128 IL G+ + + Q+ P + K RF PV PGD L V +WK Sbjct: 193 ILHGLCTLGFSARIV---GAQFPPAVYKAQ-KVRFSSPVGPGDTL---------LVLVWK 239 Query: 129 FQCCAKVENTVVAE 142 Q T V E Sbjct: 240 -QGLRITFQTYVVE 252 >gnl|CDD|100096 cd05803, PGM_like4, This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes. This domain belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.. Length = 445 Score = 29.6 bits (67), Expect = 0.45 Identities = 15/76 (19%), Positives = 28/76 (36%), Gaps = 8/76 (10%) Query: 59 PGRPVMPG-VLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPG--DRLE- 114 GR + G L+L+ +A + + I + P Y +S K +LE Sbjct: 337 YGRDSLVGIALVLQLLAASGKPLSEIVDEL----PQYYISKTKVTIAGEALERLLKKLEA 392 Query: 115 YHVNKVRNRVDLWKFQ 130 Y + + +D + Sbjct: 393 YFKDAEASTLDGLRLD 408 >gnl|CDD|37974 KOG2763, KOG2763, KOG2763, Acyl-CoA thioesterase [Lipid transport and metabolism]. Length = 357 Score = 29.2 bits (65), Expect = 0.57 Identities = 17/83 (20%), Positives = 30/83 (36%), Gaps = 6/83 (7%) Query: 66 GVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEY--HVNKVRNR 123 G ++ + A + P S+D F+KPV G L + V N+ Sbjct: 219 GGFLMRKALELAEITAKLFCK----GRPATRSVDDIEFQKPVDVGCVLTFSSFVTYTDNK 274 Query: 124 VDLWKFQCCAKVENTVVAEAEIC 146 + + A V+++ EI Sbjct: 275 SIYVQVKAVASVDSSQGRSREIT 297 >gnl|CDD|48044 cd03449, R_hydratase, (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway. (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit. The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer. A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.. Length = 128 Score = 28.6 bits (64), Expect = 0.88 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 11/56 (19%) Query: 102 RFRKPVFPGDRLEYHV-----NKVRNRVDLWKFQC-CAKVENTVVAEAEICAMVMH 151 RF +PVF GD + V + + RV + C VV E E A+V+ Sbjct: 78 RFLRPVFIGDTVTATVTVTEKREDKKRV---TLETVCTNQNGEVVIEGE--AVVLA 128 >gnl|CDD|48041 cd03446, MaoC_like, MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain. This protein family has a hot-dog fold similar to that of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.. Length = 140 Score = 27.9 bits (62), Expect = 1.2 Identities = 27/116 (23%), Positives = 38/116 (32%), Gaps = 23/116 (19%) Query: 49 FNEPHFMGHFP-----GRPVMPGVLILE---GMAQTAGAICAIHNGFDQYAPPYLMSIDK 100 +N H + G + G+L L G+ Q G F ID Sbjct: 33 WNPIHTDAEYAKKTRFGERIAHGLLTLSIATGLLQRLGVFERTVVAF--------YGIDN 84 Query: 101 ARFRKPVFPGD----RLEYHVNKVRNRVDLWKFQCCAKVEN---TVVAEAEICAMV 149 RF PVF GD E + ++ D +V N VV E+ +V Sbjct: 85 LRFLNPVFIGDTIRAEAEVVEKEEKDGEDAGVVTRRIEVVNQRGEVVQSGEMSLLV 140 >gnl|CDD|112402 pfam03583, LIP, Secretory lipase. These lipases are expressed and secreted during the infection cycle of these pathogens. In particular, C. albicans has a large number of different lipases, possibly reflecting broad lipolytic activity, which may contribute to the persistence and virulence of C. albicans in human tissue. Length = 291 Score = 27.4 bits (61), Expect = 2.2 Identities = 13/45 (28%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Query: 25 PFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPV-MPGVL 68 P +D + GI +V F E GHF V P L Sbjct: 235 PIADIDALYKNWCAW---GIASVEFAEDLSNGHFTEALVGAPAAL 276 >gnl|CDD|100089 cd03087, PGM_like1, This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.. Length = 439 Score = 27.2 bits (61), Expect = 2.4 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Query: 40 SAIGIKNVTFNEPHFMGHFPGRP 62 +G K +T N + G FPGRP Sbjct: 185 RELGCKVITLNA-NPDGFFPGRP 206 >gnl|CDD|145939 pfam03055, RPE65, Retinal pigment epithelial membrane protein. This family represents a retinal pigment epithelial membrane receptor which is abundantly expressed in retinal pigment epithelium, and binds plasma retinal binding protein. The family also includes the sequence related neoxanthin cleavage enzyme in plants and lignostilbene-alpha,beta-dioxygenase in bacteria. Length = 473 Score = 26.4 bits (59), Expect = 3.5 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 3/27 (11%) Query: 3 SDLACLDAKDIVE--LMRF-LPHRYPF 26 S+L LDAKD E + R LPHR P+ Sbjct: 438 SELLILDAKDFTEGPVARVELPHRVPY 464 >gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain. ApaH (also known as symmetrically cleaving Ap4A hydrolase and bis(5'nucleosyl)-tetraphosphatase) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases that hydrolyzes the nucleotide-signaling molecule diadenosine tetraphosphate (Ap(4)A) into two ADP and also hydrolyzes Ap(5)A, Gp(4)G, and other extending compounds. Null mutations in apaH result in high intracellular levels of Ap(4)A which correlate with multiple phenotypes, including a decreased expression of catabolite-repressible genes, a reduction in the expression of flagellar operons, and an increased sensitivity to UV and heat. Ap4A hydrolase is important in responding to heat shock and oxidative stress via regulating the concentration of Ap4A in bacteria. Ap4A hydrolase is also thought to play a role in siderophore production, but the mechanism by which ApaH interacts with siderophore pathways in unknown. The PPP (phosphoprotein phosphatase) family, to which ApaH belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, and PrpA/PrpB. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 257 Score = 26.3 bits (59), Expect = 4.3 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 8 LDAKDIVELMRFLPHRYPFLLVDKVVNI 35 L+A D EL+ +L H+ P L D + I Sbjct: 88 LNAPDRDELLDWLRHQ-PLLHRDPELGI 114 >gnl|CDD|31795 COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism]. Length = 157 Score = 26.0 bits (57), Expect = 4.7 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 9/50 (18%) Query: 77 AGAICAIHNGFDQYAPPY--LMSIDKARFRKPVFPGDRLEY--HVNKVRN 122 A AI A ++A S+D F+KPV GD + V Sbjct: 43 AAAIAAS-----RHAGGRVVTASVDSVDFKKPVRVGDIVCLYARVVYTGR 87 >gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like. Present in this CD are the Arabidopsis betaine aldehyde dehydrogenase (BADH) 1 (chloroplast) and 2 (mitochondria), also known as, aldehyde dehydrogenase family 10 member A8 and aldehyde dehydrogenase family 10 member A9, respectively, and are putative dehydration- and salt-inducible BADHs (EC 1.2.1.8) that catalyze the oxidation of betaine aldehyde to the compatible solute glycine betaine. Length = 456 Score = 25.8 bits (57), Expect = 6.4 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 65 PGVL-ILEGMAQTAGAICAIHNGFDQYA 91 PGVL ++ G AGA A H G D+ + Sbjct: 177 PGVLNVVTGTGDEAGAPLAAHPGIDKIS 204 >gnl|CDD|37195 KOG1984, KOG1984, KOG1984, Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport]. Length = 1007 Score = 25.3 bits (55), Expect = 7.3 Identities = 11/36 (30%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Query: 58 FPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPP 93 +PGRP PG G + A A + PP Sbjct: 96 YPGRPSTPGGPQAGGSQSSFAA--AGPSSGSGTGPP 129 >gnl|CDD|31166 COG0824, FcbC, Predicted thioesterase [General function prediction only]. Length = 137 Score = 25.2 bits (55), Expect = 8.6 Identities = 7/45 (15%), Positives = 12/45 (26%) Query: 101 ARFRKPVFPGDRLEYHVNKVRNRVDLWKFQCCAKVENTVVAEAEI 145 + +P GD L E+ ++A E Sbjct: 64 IDYLRPARLGDVLTVRTRVEELGGKSLTLGYEIVNEDELLATGET 108 >gnl|CDD|39464 KOG4263, KOG4263, KOG4263, Putative receptor CCR1 [Signal transduction mechanisms]. Length = 299 Score = 25.0 bits (54), Expect = 9.1 Identities = 11/52 (21%), Positives = 20/52 (38%), Gaps = 8/52 (15%) Query: 16 LMRFLPHRYPFLLVDKVVNIQRDESAIGI--------KNVTFNEPHFMGHFP 59 L R L HR +L + +++ ++T+ F+G FP Sbjct: 4 LSRILLHRSNSVLNSPTFLVAVRQTSANPPPYTPTKEGSLTYKYEQFLGKFP 55 >gnl|CDD|39490 KOG4289, KOG4289, KOG4289, Cadherin EGF LAG seven-pass G-type receptor [Signal transduction mechanisms]. Length = 2531 Score = 25.0 bits (54), Expect = 9.6 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 32 VVNIQRDESAIGIKNVTFNE--PHFMGHFPGRPVMPGVLILEGMA 74 V N+Q D +GI NV+F+ G FP + + +L ++ Sbjct: 1126 VFNVQNDTDVVGILNVSFSALGRGVRGWFPSEDLQEQIYLLTAIS 1170 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.140 0.438 Gapped Lambda K H 0.267 0.0692 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,028,742 Number of extensions: 103405 Number of successful extensions: 289 Number of sequences better than 10.0: 1 Number of HSP's gapped: 284 Number of HSP's successfully gapped: 34 Length of query: 161 Length of database: 6,263,737 Length adjustment: 86 Effective length of query: 75 Effective length of database: 4,405,363 Effective search space: 330402225 Effective search space used: 330402225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.3 bits)