RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter asiaticus str. psy62] (161 letters) >gnl|CDD|178788 PRK00006, fabZ, (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed. Length = 147 Score = 228 bits (584), Expect = 5e-61 Identities = 69/141 (48%), Positives = 92/141 (65%), Gaps = 1/141 (0%) Query: 12 DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71 DI E+++ LPHRYPFLLVD+V+ ++ +S + IKNVT NEP F GHFPG PVMPGVLI+E Sbjct: 8 DIEEILKLLPHRYPFLLVDRVLELEPGKSIVAIKNVTINEPFFQGHFPGYPVMPGVLIIE 67 Query: 72 GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKFQC 131 MAQ AG + Y IDKARF++PV PGD+L V ++ R +WKF+ Sbjct: 68 AMAQAAGVLALKSEENKGKL-VYFAGIDKARFKRPVVPGDQLILEVELLKQRRGIWKFKG 126 Query: 132 CAKVENTVVAEAEICAMVMHE 152 A V+ +VAEAE+ + + Sbjct: 127 VATVDGKLVAEAELMFAIRDK 147 >gnl|CDD|130811 TIGR01750, fabZ, beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ. This enzyme, FabZ, shows overlapping substrate specificity with FabA with regard to chain length in fatty acid biosynthesis. FabZ works preferentially on shorter chains and is often designated (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase, although its actual specificity is broader. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains. Length = 140 Score = 192 bits (491), Expect = 2e-50 Identities = 66/140 (47%), Positives = 89/140 (63%), Gaps = 2/140 (1%) Query: 12 DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71 DI E+M LPHRYPFLLVD+++ + + + IKNVT NEP F GHFP +P+MPGVLI+E Sbjct: 1 DIQEIMELLPHRYPFLLVDRILELDPGKRIVAIKNVTINEPFFQGHFPEKPIMPGVLIVE 60 Query: 72 GMAQTAGAICAIHNGFDQYAP--PYLMSIDKARFRKPVFPGDRLEYHVNKVRNRVDLWKF 129 +AQ G + + G + Y IDKA+FR+PV PGD+L H ++ R + KF Sbjct: 61 ALAQAGGVLAILSLGGEIGKGKLVYFAGIDKAKFRRPVVPGDQLILHAEFLKKRRKIGKF 120 Query: 130 QCCAKVENTVVAEAEICAMV 149 + A V+ VVAEAEI + Sbjct: 121 KGEATVDGKVVAEAEITFAI 140 >gnl|CDD|183883 PRK13188, PRK13188, bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed. Length = 464 Score = 167 bits (426), Expect = 1e-42 Identities = 67/146 (45%), Positives = 88/146 (60%), Gaps = 6/146 (4%) Query: 12 DIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPGRPVMPGVLILE 71 DI +M+ LPHRYPFLLVDK++ + D +GIKNVT NEP F GHFPG PVMPGVL +E Sbjct: 322 DINRIMKILPHRYPFLLVDKIIELG-DTKIVGIKNVTMNEPFFQGHFPGNPVMPGVLQIE 380 Query: 72 GMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVN---KVRNRVDLWK 128 MAQT G + + Y M IDK +FR+ V PGD L + V +R + + Sbjct: 381 AMAQTGGILVLNTVPDPENYSTYFMKIDKVKFRQKVVPGDTLIFKVELLSPIRRGIC--Q 438 Query: 129 FQCCAKVENTVVAEAEICAMVMHEKK 154 Q A V +V EAE+ A ++ +K+ Sbjct: 439 MQGKAYVNGKLVCEAELMAQIVKKKE 464 >gnl|CDD|149192 pfam07977, FabA, FabA-like domain. This enzyme domain has a HotDog fold. Length = 133 Score = 135 bits (341), Expect = 7e-33 Identities = 54/134 (40%), Positives = 68/134 (50%), Gaps = 10/134 (7%) Query: 20 LPHRYPFLLVDKVVNIQRDE-----SAIGIKNVTFNEPHFMGHFPGRPVMPGVLILEGMA 74 LPHRYPFL++D+V I + + KNVT NE F GHFPG PVMPGVL LE MA Sbjct: 1 LPHRYPFLMIDRVTEIDPEGGKFKGYIVAEKNVTPNEWFFQGHFPGDPVMPGVLGLEAMA 60 Query: 75 QTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGD---RLEYHVNKVRN-RVDLWKFQ 130 Q G G + ID+ +FR V PGD R E + ++ R + Sbjct: 61 QLGGFYLLWLGGGEGKGRARF-GIDEVKFRGQVTPGDKQLRYEVEIKRIGPRRGVIGIAD 119 Query: 131 CCAKVENTVVAEAE 144 A V+ +V EAE Sbjct: 120 GRALVDGKLVYEAE 133 >gnl|CDD|179953 PRK05174, PRK05174, 3-hydroxydecanoyl-(acyl carrier protein) dehydratase; Validated. Length = 172 Score = 38.3 bits (90), Expect = 9e-04 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 6/60 (10%) Query: 25 PFLLVDKVVNIQRDESAIG---IK---NVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAG 78 P L++D++ I G I ++ + F HF G PVMPG L L+ M Q G Sbjct: 33 PMLMMDRITEISETGGEFGKGYIVAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVG 92 >gnl|CDD|130810 TIGR01749, fabA, beta-hydroxyacyl-[acyl carrier protein] dehydratase FabA. This enzyme, FabA, shows overlapping substrate specificity with FabZ with regard to chain length in fatty acid biosynthesis. It is commonly designated 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.60) as if it were specific for that chain length, but its specificity is broader; it is active even in the initiation of fatty acid biosynthesis. This enzyme can also isomerize trans-2-decenoyl-ACP to cis-3-decenoyl-ACP to bypass reduction by FabI and instead allow biosynthesis of unsaturated fatty acids. FabA cannot elongate unsaturated fatty acids. Length = 169 Score = 35.2 bits (81), Expect = 0.008 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 8/61 (13%) Query: 25 PFLLVDKVVNIQRDESAIGIKNVTFNE----P---HFMGHFPGRPVMPGVLILEGMAQTA 77 P L++D++V I G K E P F HF G PVMPG L L+ M Q Sbjct: 30 PMLMIDRIVEISETGGKFG-KGYVEAELDIRPDLWFFGCHFIGDPVMPGCLGLDAMWQLV 88 Query: 78 G 78 G Sbjct: 89 G 89 >gnl|CDD|181636 PRK09070, PRK09070, hypothetical protein; Validated. Length = 447 Score = 28.9 bits (65), Expect = 0.58 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 12 DIVELMRFLPHRYPFLL 28 D++ L R P RYP LL Sbjct: 12 DLLALHRLAPERYPALL 28 >gnl|CDD|183724 PRK12754, PRK12754, transketolase; Reviewed. Length = 663 Score = 26.9 bits (59), Expect = 2.8 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 72 GMAQTAGAICAIHNGFDQYAPPYLMSIDKAR 102 GM A I A+H GF Y +LM ++ AR Sbjct: 413 GMTAIANGI-ALHGGFLPYTSTFLMFVEYAR 442 >gnl|CDD|180281 PRK05839, PRK05839, hypothetical protein; Provisional. Length = 374 Score = 26.6 bits (59), Expect = 2.9 Identities = 15/59 (25%), Positives = 23/59 (38%), Gaps = 8/59 (13%) Query: 29 VDKVVNIQRDESAI----GIKNVTFNEPHFMGHFPGRPVM----PGVLILEGMAQTAGA 79 + I+ E+ + G + V FN P F+ P + P I EG A + A Sbjct: 73 FKRRFKIELKENELIPTFGTREVLFNFPQFVLFDKQNPTIAYPNPFYQIYEGAAIASRA 131 >gnl|CDD|178086 PLN02467, PLN02467, betaine aldehyde dehydrogenase. Length = 503 Score = 26.6 bits (59), Expect = 3.2 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 65 PGVL-ILEGMAQTAGAICAIHNGFDQYA 91 PGVL ++ G+ AGA A H G D+ A Sbjct: 208 PGVLNVVTGLGTEAGAPLASHPGVDKIA 235 >gnl|CDD|107069 PHA01756, PHA01756, hypothetical protein. Length = 268 Score = 26.1 bits (57), Expect = 4.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 106 PVFPGDRLEYHVNKVRN 122 P+ PGD LE+HV N Sbjct: 233 PILPGDSLEFHVRNPSN 249 >gnl|CDD|185318 PRK15420, fucU, L-fucose mutarotase; Provisional. Length = 140 Score = 26.0 bits (57), Expect = 4.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Query: 57 HFPGRPVMPGVLILEGMAQTAGAICAIHNGF--DQYAPPYLM 96 HFP + P V+ +G+ + + AI F D YAPP +M Sbjct: 32 HFPAHSMGPQVIRADGL-LVSDLLQAIIPLFELDSYAPPLVM 72 >gnl|CDD|130895 TIGR01836, PHA_synth_III_C, poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit. This model represents the PhaC subunit of a heterodimeric form of polyhydroxyalkanoic acid (PHA) synthase. Excepting the PhaC of Bacillus megaterium (which needs PhaR), all members require PhaE (TIGR01834) for activity and are designated class III. This enzyme builds ester polymers for carbon and energy storage that accumulate in inclusions, and both this enzyme and the depolymerase associate with the inclusions. Class III enzymes polymerize short-chain-length hydroxyalkanoates. Length = 350 Score = 25.9 bits (57), Expect = 5.1 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 11/43 (25%) Query: 11 KDIVELMRFLP-----HRYPFLLVDKVVN------IQRDESAI 42 +D V L R+ P H+ P L+V +VN +Q D S + Sbjct: 45 EDKVVLYRYTPVKDNTHKTPLLIVYALVNRPYMLDLQEDRSLV 87 >gnl|CDD|183723 PRK12753, PRK12753, transketolase; Reviewed. Length = 663 Score = 25.8 bits (57), Expect = 5.6 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 72 GMAQTAGAICAIHNGFDQYAPPYLMSIDKAR 102 GM A I A H GF Y +LM ++ AR Sbjct: 413 GMTAIANGI-AHHGGFVPYTATFLMFVEYAR 442 >gnl|CDD|152362 pfam11927, DUF3445, Protein of unknown function (DUF3445). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 264 to 418 amino acids in length. This protein has a conserved RLP sequence motif. This protein has two completely conserved R residues that may be functionally important. Length = 246 Score = 25.6 bits (57), Expect = 6.1 Identities = 6/23 (26%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Query: 3 SDLACLDAKDIVELMRFLPHRYP 25 ++ A + + ++ +LP RYP Sbjct: 43 AEPAAWELLE--LVLEYLPARYP 63 >gnl|CDD|177996 PLN02368, PLN02368, alanine transaminase. Length = 407 Score = 25.5 bits (56), Expect = 6.7 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 7 CLDAKDIVELMRFLPHRYPFLLVDKV--VNIQRDE 39 CL ++ E+++F LL D+V NI +DE Sbjct: 226 CLSEANLREILKFCYQERLVLLGDEVYQQNIYQDE 260 >gnl|CDD|152107 pfam11671, Apis_Csd, Complementary sex determiner protein. This family of proteins represents the complementary sex determiner in the honeybee. In the honeybee, the mechanism of sex determination depends on the csd gene which produces an SR-type protein. Males are homozygous while females are homozygous for the csd gene. Heterozygosity generates an active protein which initiates female development. Length = 146 Score = 25.1 bits (54), Expect = 8.4 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 8/60 (13%) Query: 52 PHFMGHFPGRPVM--PGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFP 109 P + G+FP RP+M P V + E + + + G PP + + RFR P+ P Sbjct: 87 PVYYGNFPPRPIMVRPWVSMQEQVPRFR------YIGPLTPFPPRFIPPNMYRFRPPLNP 140 >gnl|CDD|147801 pfam05843, Suf, Suppressor of forked protein (Suf). This family consists of several eukaryotic suppressor of forked (Suf) like proteins. The Drosophila melanogaster Suppressor of forked [Su(f)] protein shares homology with the yeast RNA14 protein and the 77-kDa subunit of human cleavage stimulation factor, which are proteins involved in mRNA 3' end formation. This suggests a role for Su(f) in mRNA 3' end formation in Drosophila. The su(f) gene produces three transcripts; two of them are polyadenylated at the end of the transcription unit, and one is a truncated transcript, polyadenylated in intron 4. It is thought that su(f) plays a role in the regulation of poly(A) site utilisation and an important role of the GU-rich sequence for this regulation to occur. Length = 275 Score = 25.0 bits (55), Expect = 9.7 Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Query: 11 KDIVELMRFLPHRY----PFLLVDKVVNIQRD 38 +IV L+ LP+ P +K+V++ R Sbjct: 240 PEIVALLSVLPNAQYFDGPRFDPEKLVDLLRQ 271 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.140 0.438 Gapped Lambda K H 0.267 0.0659 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,678,667 Number of extensions: 163023 Number of successful extensions: 328 Number of sequences better than 10.0: 1 Number of HSP's gapped: 320 Number of HSP's successfully gapped: 24 Length of query: 161 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 75 Effective length of database: 4,136,185 Effective search space: 310213875 Effective search space used: 310213875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.3 bits)