BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter asiaticus str. psy62] (161 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780770|ref|YP_003065183.1| (3R)-hydroxymyristoyl-ACP dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 161 Score = 337 bits (865), Expect = 5e-95, Method: Compositional matrix adjust. Identities = 161/161 (100%), Positives = 161/161 (100%) Query: 1 MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60 MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG Sbjct: 1 MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG 60 Query: 61 RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120 RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV Sbjct: 61 RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV 120 Query: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG Sbjct: 121 RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG 161 >gi|254780460|ref|YP_003064873.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 172 Score = 33.1 bits (74), Expect = 0.003, Method: Compositional matrix adjust. Identities = 29/102 (28%), Positives = 43/102 (42%), Gaps = 7/102 (6%) Query: 46 NVTFNEPHFMGHFPGRPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRK 105 ++T N F HF PVMPG L L+ + Q G + +S+ +FR Sbjct: 60 DITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGW---LGELGKGRAVSVSNIKFRG 116 Query: 106 PVFPGDRL-EYHVN---KVRNRVDLWKFQCCAKVENTVVAEA 143 V P +L EY ++ +R RV L KV + +A Sbjct: 117 MVTPDCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQA 158 >gi|254780948|ref|YP_003065361.1| DNA repair protein RecO [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 25.4 bits (54), Expect = 0.47, Method: Compositional matrix adjust. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 3 SDLACLDAKDIVELMRFLPHRYPFLLVDKVVNI 35 S L + IV L RFLP R P L + ++NI Sbjct: 84 SSLFLYGLQSIVPLFRFLPEREPCLELYDMLNI 116 >gi|254780222|ref|YP_003064635.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 686 Score = 22.3 bits (46), Expect = 4.1, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 40 SAIGIKNVTFNEPHFMGH 57 SA+GI +V EP F G Sbjct: 365 SAVGILSVFIREPEFAGQ 382 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.140 0.438 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,144 Number of Sequences: 1233 Number of extensions: 4210 Number of successful extensions: 13 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 6 length of query: 161 length of database: 328,796 effective HSP length: 67 effective length of query: 94 effective length of database: 246,185 effective search space: 23141390 effective search space used: 23141390 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 35 (18.1 bits)