HHsearch alignment for GI: 254780771 and conserved domain: COG1043

>COG1043 LpxA Acyl-[acyl carrier protein].
Probab=100.00  E-value=0  Score=298.70  Aligned_cols=197  Identities=31%  Similarity=0.456  Sum_probs=173.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEHHHCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             54333100156532334420000110011232033112210000000233210023322023310024420100000232
Q gi|254780771|r  116 EGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVR  195 (347)
Q Consensus       116 ~~~I~~~a~I~~~a~I~~~v~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG~~~~I~~~~v  195 (347)
T Consensus         3 ~~~IHPTAiIe~gA~ig~~V~IGpf~iIg~~V~ig~~t~l~shvvv~G~T~IG~~n~I~~~-----------------A~   65 (260)
T COG1043           3 MAKIHPTAIIEPGAEIGEDVKIGPFCIIGPNVEIGDGTVLKSHVVVEGHTTIGRNNRIFPF-----------------AS   65 (260)
T ss_pred             CCCCCCCEEECCCCCCCCCCEECCEEEECCCCEECCCCEECCCEEEECCCEECCCCEEECC-----------------CC
T ss_conf             5645762152787882899888833798897198899588343799677077789879111-----------------04


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             1344543355666531104443200002444454444332222---2211111222111234444650357718865556
Q gi|254780771|r  196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTI---DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG  272 (347)
Q Consensus       196 IG~~GFgf~~~~~~~~~~~~~G~v~Ig~~v~IG~n~tIdrg~~---~~t~Ig~~~~id~~v~i~hn~~iG~~~~~~~~~~  272 (347)
T Consensus        66 iG~~-----pQdlKykge~T--~l~IG~~n~IRE~vTi~~GT~~g~g~T~IGdnnl~May~HVAHDC~iGn~~ilaNnat  138 (260)
T COG1043          66 IGED-----PQDLKYKGEPT--RLIIGDNNTIREFVTIHRGTVQGGGVTRIGDNNLIMAYAHVAHDCVIGNNCILANNAT  138 (260)
T ss_pred             CCCC-----CCCCCCCCCCE--EEEECCCCEEEEEEEEECCCCCCCEEEEECCCCEEEEEEEEECCCEECCCEEEECCCE
T ss_conf             2898-----75450279842--7998899758668898615447861599778878987310313444567179966866


Q ss_pred             EECCCEECCCCEEEECCEEECCEEECCCCEECCCCEEEEEECCCCEEEEECCHHHHHHHHHHHHHCC
Q ss_conf             5036365697297306878378598888898625326000079878998241758889786786228
Q gi|254780771|r  273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK  339 (347)
Q Consensus       273 ~~g~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~~~v~~~~~~~G~pa~~~~~~~~~~~~~~~  339 (347)
T Consensus       139 LAGHV~igD~aiiGG~saVHQF~rIG~~amiGg~S~v~~DVpPy~~~~Gn~a~l~Gl---N~vGlkR  202 (260)
T COG1043         139 LAGHVEVGDYAIIGGLSAVHQFVRIGAHAMIGGLSAVSQDVPPYVIASGNHARLRGL---NIVGLKR  202 (260)
T ss_pred             EECEEEECCEEEECCCCEEEEEEEECCHHEECCCHHHCCCCCCEEEECCCCCCCCCC---CEEEEEE
T ss_conf             854078877899747523777889740112344101036779838852870442121---3220110