HHsearch alignment for GI: 254780771 and conserved domain: COG2171

>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism].
Probab=99.56  E-value=5.8e-15  Score=99.95  Aligned_cols=122  Identities=26%  Similarity=0.395  Sum_probs=83.9

Q ss_pred             CCCCCCEEHHHCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEE-EEEECCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             3442000011001123203311221000000023321002332202331002-442010000023213445433556665
Q gi|254780771|r  131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSD  209 (347)
Q Consensus       131 I~~~v~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~-iIG~~~~I~~~~vIG~~GFgf~~~~~~  209 (347)
T Consensus       105 ~~~g~RI~p~a~VR~ga~i~~gtvvM~~sfVNigA~~~~gtMVd~~as~G~~a~VGkn~higgGa~I~GV----L-ep--  177 (271)
T COG2171         105 VPEGVRIVPGAIVRLGAYIAKGTVVMPESFVNIGAGTGEGTMVDGRASVGSCAQVGKNSHIGGGASIGGV----L-EP--  177 (271)
T ss_pred             CCCCEEECCCCEEEECCEECCCCEECCCCEEEECCCCCCCEEEEEEEEEECCEEECCCCCCCCCCEEEEE----E-CC--
T ss_conf             5576363676477605287799387555668777602752589615655131797998452786367677----3-48--


Q ss_pred             CCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCEECCCCEEEECC
Q ss_conf             31104443200002444454444332222221111122211123444465035771886555650363656972973068
Q gi|254780771|r  210 IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQC  289 (347)
Q Consensus       210 ~~~~~~~G~v~Ig~~v~IG~n~tIdrg~~~~t~Ig~~~~id~~v~i~hn~~iG~~~~~~~~~~~~g~~~ig~~~~ig~~~  289 (347)
T Consensus       178 ----~~a~----------------------------------------------------------Pv~IgdncliGAns  195 (271)
T COG2171         178 ----LQAN----------------------------------------------------------PVIIGDNCLIGANS  195 (271)
T ss_pred             ----CCCC----------------------------------------------------------CEEECCCCEECCCC
T ss_conf             ----8878----------------------------------------------------------86987761862453


Q ss_pred             EEECCEEECCCCEECCCCEEEEEECCCCEEEE
Q ss_conf             78378598888898625326000079878998
Q gi|254780771|r  290 GIAGYLKIGDNVQIASKSGVLKDIPAGQQYGG  321 (347)
Q Consensus       290 ~i~~~v~ig~~~~i~a~s~v~~~v~~~~~~~G  321 (347)
T Consensus       196 ~~veGV~vGdg~VV~aGv~I~~~tki~~~~~g  227 (271)
T COG2171         196 EVVEGVIVGDGCVVAAGVFITQDTKIYDRVAG  227 (271)
T ss_pred             CEEEEEEECCCCEEECCEEEECCCCEEEEECC
T ss_conf             34861696789688545089379514774346