HHsearch alignment for GI: 254780771 and conserved domain: KOG4042

>KOG4042 consensus.
Probab=98.15  E-value=8e-06  Score=50.41  Aligned_cols=45  Identities=16%  Similarity=0.355  Sum_probs=26.0

Q ss_pred             EECCCCEEEECCEEECCEEECCCCEECCCCEEE--EEECCCCEEEEE
Q ss_conf             656972973068783785988888986253260--000798789982
Q gi|254780771|r  278 YIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL--KDIPAGQQYGGM  322 (347)
Q Consensus       278 ~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~--~~v~~~~~~~G~  322 (347)
T Consensus        97 kvGd~NVieskayvg~gv~vssgC~vGA~c~v~~~q~lpent~vYga  143 (190)
T KOG4042          97 KVGDRNVIESKAYVGDGVSVSSGCSVGAKCTVFSHQNLPENTSVYGA  143 (190)
T ss_pred             HHCCCCEEEEEEEECCCCEECCCCEECCCEEEECCCCCCCCCEEECC
T ss_conf             51676547666686499487279654140577110346975168721