HHsearch alignment for GI: 254780771 and conserved domain: KOG4750

>KOG4750 consensus.
Probab=99.75  E-value=7.7e-19  Score=121.00  Aligned_cols=81  Identities=37%  Similarity=0.496  Sum_probs=62.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCEECCCCEEEECCEEECCEEECCCCEECCCCEEEEEECCCCEEEEECCH
Q ss_conf             22211123444465035771886555650363656972973068783785988888986253260000798789982417
Q gi|254780771|r  246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR  325 (347)
Q Consensus       246 ~~~id~~v~i~hn~~iG~~~~~~~~~~~~g~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~~~v~~~~~~~G~pa~  325 (347)
T Consensus       174 TAvvg~~vSilH~Vtlggtg----k~~gdrhP~Igd~vliGaGvtILgnV~IGegavIaAGsvV~kDVP~~~~AvGnPAk  249 (269)
T KOG4750         174 TAVVGDNVSILHPVTLGGTG----KGSGDRHPKIGDNVLIGAGVTILGNVTIGEGAVIAAGSVVLKDVPPNTLAVGNPAK  249 (269)
T ss_pred             EEEECCCEEEECCEEECCCC----CCCCCCCCCCCCCEEECCCCEEECCEEECCCCEEECCCEEEECCCCCCEECCCCHH
T ss_conf             24742644664443114654----66555688556770875541785781677886773050697216987530488233


Q ss_pred             HHHHH
Q ss_conf             58889
Q gi|254780771|r  326 PIGEY  330 (347)
Q Consensus       326 ~~~~~  330 (347)
T Consensus       250 lIg~~  254 (269)
T KOG4750         250 LIGKI  254 (269)
T ss_pred             HCCCC
T ss_conf             23434