HHsearch alignment for GI: 254780771 and conserved domain: PRK00725

>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional.
Probab=98.58  E-value=2.5e-08  Score=63.99  Aligned_cols=66  Identities=17%  Similarity=0.163  Sum_probs=44.4

Q ss_pred             CCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEECCCC
Q ss_conf             32033112210000000233210023322023310024420100000232134454335566653110444320000244
Q gi|254780771|r  146 GVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKV  225 (347)
Q Consensus       146 ~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG~~~~I~~~~vIG~~GFgf~~~~~~~~~~~~~G~v~Ig~~v  225 (347)
T Consensus       331 nSli~~GcvI~G-~~V-enSVI~r~v~Ig~gA~V~nSIIm~~~~IG~ga~l~--------------------naIiDk~v  388 (431)
T PRK00725        331 NSLVSGGCIISG-SVV-VQSVLFTRVRVNSFSNIDSAVLLPEVWVGRSCRLR--------------------RCVIDRAC  388 (431)
T ss_pred             CCEEECCEEEEC-CEE-EECCCCCCCEECCCCEEEEEEECCCCEECCCCEEE--------------------EEEECCCC
T ss_conf             679839989969-999-82982599899999899613988989889999997--------------------13989998


Q ss_pred             CCCCCCCC
Q ss_conf             44544443
Q gi|254780771|r  226 EIGANSAI  233 (347)
Q Consensus       226 ~IG~n~tI  233 (347)
T Consensus       389 ~I~~G~~I  396 (431)
T PRK00725        389 VIPEGMVI  396 (431)
T ss_pred             EECCCCEE
T ss_conf             98989998