HHsearch alignment for GI: 254780771 and conserved domain: PRK04928

>PRK04928 consensus.
Probab=99.02  E-value=1.7e-10  Score=75.75  Aligned_cols=51  Identities=20%  Similarity=0.361  Sum_probs=31.5

Q ss_pred             CEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEECCC
Q ss_conf             2033112210000000233210023322023310024420100000232134
Q gi|254780771|r  147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGN  198 (347)
Q Consensus       147 v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG~~~~I~~~~vIG~  198 (347)
T Consensus       328 SvIg~~~~Ig~ga~I~-nSII~~~~~Ig~ga~i~~sIidk~v~Ig~g~~I~~  378 (405)
T PRK04928        328 SVLGFRSNIASACDIS-ESVLLGDVKIGEGCVLRRVIIDKDVEIAPGTQIGE  378 (405)
T ss_pred             CEECCCCEECCCCEEE-CCEEECCCEECCCCEEECCEECCCCEECCCCEECC
T ss_conf             8976998999994995-58996929999999996549889999999999983