HHsearch alignment for GI: 254780771 and conserved domain: PRK09451

>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional.
Probab=99.89  E-value=2e-23  Score=145.82  Aligned_cols=142  Identities=22%  Similarity=0.313  Sum_probs=85.9

Q ss_pred             HCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             00112320331122100000002332100233220233100244201000002321344543355666531104443200
Q gi|254780771|r  141 AVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVI  220 (347)
Q Consensus       141 ~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG~~~~I~~~~vIG~~GFgf~~~~~~~~~~~~~G~v~  220 (347)
T Consensus       260 ~~I~~~v~ig~dv~I~~nvvi~G~v~IG~~v~Ig~g~~I~ns~Ig~~~~I~~~S~Ie--------------------~s~  319 (456)
T PRK09451        260 FDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVKIGAGCVLKNCVIGDDCEISPYSVVE--------------------DAN  319 (456)
T ss_pred             EEEECCEEECCCEEECCCEEEECCEEECCCEEECCCEEEECCEECCCCEEECCEEEC--------------------CCE
T ss_conf             777032896575077577088442475797598240798576984687894225650--------------------663


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCEECCCCEEEECCEEEC-------
Q ss_conf             0024444544443322222211111222111234444650357718865556503636569729730687837-------
Q gi|254780771|r  221 IQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAG-------  293 (347)
Q Consensus       221 Ig~~v~IG~n~tIdrg~~~~t~Ig~~~~id~~v~i~hn~~iG~~~~~~~~~~~~g~~~ig~~~~ig~~~~i~~-------  293 (347)
T Consensus       320 Ig~~~~IGPfA~lR----p~t~i~~~~~iGnfvEi-K~s~i~~g~k~~HlsYi-GDa~iG~~~NiGAGtit~NyDG~~K~  393 (456)
T PRK09451        320 LGAACTIGPFARLR----PGAELLEGAHVGNFVEM-KKARLGKGSKAGHLTYL-GDAEIGDNVNIGAGTITCNYDGANKF  393 (456)
T ss_pred             ECCCCEECCCCCCC----CCCEECCCCEEEEEEEE-ECCEECCCCEECCEEEE-CCCEECCCCEECCCEEEEECCCCCCC
T ss_conf             43671688864348----87623678888228998-24597589770423366-14476588688887699722487665


Q ss_pred             CEEECCCCEECCCCE
Q ss_conf             859888889862532
Q gi|254780771|r  294 YLKIGDNVQIASKSG  308 (347)
Q Consensus       294 ~v~ig~~~~i~a~s~  308 (347)
T Consensus       394 ~t~igd~~fiGsn~~  408 (456)
T PRK09451        394 KTIIGDDVFVGSDTQ  408 (456)
T ss_pred             CCEECCCCEECCCCE
T ss_conf             648789829987844