HHsearch alignment for GI: 254780771 and conserved domain: PRK11132

>PRK11132 cysE serine acetyltransferase; Provisional.
Probab=99.71  E-value=7.3e-18  Score=115.69  Aligned_cols=54  Identities=31%  Similarity=0.579  Sum_probs=50.5

Q ss_pred             CCEECCCCEEEECCEEECCEEECCCCEECCCCEEEEEECCCCEEEEECCHHHHH
Q ss_conf             636569729730687837859888889862532600007987899824175888
Q gi|254780771|r  276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGE  329 (347)
Q Consensus       276 ~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~~~v~~~~~~~G~pa~~~~~  329 (347)
T Consensus       193 HP~i~~~v~igaga~iLG~i~iG~~a~igA~svVl~dvp~~~tv~GvPa~~vg~  246 (273)
T PRK11132        193 HPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQPVPPHTTAAGVPARIVGK  246 (273)
T ss_pred             CCCCCCCEEECCCCEEECCEEECCCCEECCCCEECCCCCCCCEEECCCCEEECC
T ss_conf             980488848754888971858899988867866864379998796667203088