HHsearch alignment for GI: 254780771 and conserved domain: TIGR01173

>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc. The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.
Probab=100.00  E-value=0  Score=301.06  Aligned_cols=265  Identities=28%  Similarity=0.340  Sum_probs=221.0

Q ss_pred             CCHHHCCCCCEEEECC--HHHHHHHHHCCCEEEEECHHHHHCCCCCC---CCEECC--------CCCHHHHHHCCCCCCC
Q ss_conf             7988889986999618--67677775458569998877610144455---310012--------3201122101211122
Q gi|254780771|r   40 SPIARASTGDISYIIS--RKFLNNIEKCKASAIICSQDIVPFIPKNI---PCLLSD--------KPEVSFAIAGSILYPQ  106 (347)
Q Consensus        40 ~~l~~A~~~~IsFi~~--~kyl~~l~~s~A~aiI~~~d~~~~~~~~~---~~Iiv~--------nP~~afA~i~~~l~~~  106 (347)
T Consensus       169 k~I~eiNtG~y~~~~~~L~~~L~~l~n~NaqgEYYLTD~ia~a~~~g~~v~~~~~~d~~E~~GvNdR~qLa~lE~~~q~r  248 (461)
T TIGR01173       169 KAIKEINTGVYVFDGAALKRWLPKLSNNNAQGEYYLTDVIALAVADGEEVRAVQVDDSEEVLGVNDRLQLAQLERILQRR  248 (461)
T ss_pred             HCCCEEEEEEEEECHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCCEEEEEEECCHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             03527888799983289998887628770444314789999985089478999808759833667988999999999999


Q ss_pred             CCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCEEHHHCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEE
Q ss_conf             2112355765433310-015653233442000011001123203311221000000023321002332202331002442
Q gi|254780771|r  107 AMHMEASSFEGGISPQ-AFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG  185 (347)
Q Consensus       107 ~~~~~~~~~~~~I~~~-a~I~~~a~I~~~v~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG  185 (347)
T Consensus       249 ~~~~l~~~GVt~~dP~~~~i~~~v~~G~Dv~I~~~v~leG~v~iG~~v~IGp~~~I~-ns~I~~~~~I~~~s~~e~~~ig  327 (461)
T TIGR01173       249 IAKKLLLQGVTLIDPARTDIRGTVEIGQDVVIDPNVILEGKVQIGDDVVIGPGCVIK-NSVIGSNAVIKPYSVLEGSEIG  327 (461)
T ss_pred             HHHHHHHCCCEEECCCEEEECCCEEECCEEEECCCCEECCEEEECCCEEECCCCEEE-EEEECCCCEEEEEEECCCCEEC
T ss_conf             999898589299868337873547987716975583883407987870788985899-7288688558888841467861


Q ss_pred             ECCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCC
Q ss_conf             0100000232134454335566653110444320000244445444433222222111112221112-----34444650
Q gi|254780771|r  186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ-----VQIGHNVH  260 (347)
Q Consensus       186 ~~~~I~~~~vIG~~GFgf~~~~~~~~~~~~~G~v~Ig~~v~IG~n~tIdrg~~~~t~Ig~~~~id~~-----v~i~hn~~  260 (347)
T Consensus       328 ~~~~vGPFArL--------RP~~~L~~~-----~hiGNFVE~K-----------na~iG~gsKA~HLsYlGDAeiG~~vN  383 (461)
T TIGR01173       328 EGCDVGPFARL--------RPGSVLGAG-----VHIGNFVEVK-----------NARIGEGSKAGHLSYLGDAEIGSNVN  383 (461)
T ss_pred             CCCEECCCCCC--------CCCCHHHCC-----CEEEEEEEEE-----------CCEECCCCCCCCCCEEEEEEECCCCE
T ss_conf             56402773001--------864321177-----8160258652-----------47618864423143332025079600


Q ss_pred             CCCCEEEEEEEEEEC-CCEECCCCEEEECCEEECCEEECCCCEECCCCEEEEEECCCCEEEEECCHHHHH
Q ss_conf             357718865556503-636569729730687837859888889862532600007987899824175888
Q gi|254780771|r  261 IGCGCIIVSQVGIAG-STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGE  329 (347)
Q Consensus       261 iG~~~~~~~~~~~~g-~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~~~v~~~~~~~G~pa~~~~~  329 (347)
T Consensus       384 iGAGtITcNYDG~nK~~T~IGd~VFiGSnt~LVAPV~iG~gA~iaAGstvt~DVp~g~La~~R~~Q~~ie  453 (461)
T TIGR01173       384 IGAGTITCNYDGVNKHKTIIGDGVFIGSNTQLVAPVKIGDGATIAAGSTVTKDVPEGALAIARARQRNIE  453 (461)
T ss_pred             ECCEEEEEECCCCCCCCCEECCCCEECCCCEEECCEEECCCCEECCCCEEECCCCCCCCEEECCCCEECC
T ss_conf             3231689932796220348648878776760455439438118712414802348885266245565522