HHsearch alignment for GI: 254780771 and conserved domain: TIGR03308

>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family. This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein.
Probab=99.74  E-value=3.3e-18  Score=117.60  Aligned_cols=153  Identities=23%  Similarity=0.202  Sum_probs=97.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEHHHCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEE-EEEEECCCCCE
Q ss_conf             76543331001565323344200001100112320331122100000002332100233220233100-24420100000
Q gi|254780771|r  114 SFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHS  192 (347)
Q Consensus       114 ~~~~~I~~~a~I~~~a~I~~~v~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~-~iIG~~~~I~~  192 (347)
T Consensus         6 ~~~p~Ihp~a~i~-~~~lG~~v~Ig~~~~i~-ns~IGDySyI~~~~~I~-n~~IGkfcsIa~~v~I~~~nHp~~~~s~~~   82 (204)
T TIGR03308         6 SPEPTLHPTAELT-ESKLGRYTEIGERTRLR-EVALGDYSYVMRDCDII-YTTIGKFCSIAAMVRINATNHPMERPTLHH   82 (204)
T ss_pred             CCCCEECCCCEEC-CCCCCCCEEECCCCEEE-CCEECCCCEECCCCEEE-CCEECCCCEECCCCEECCCCCCCCCCEECC
T ss_conf             7997689998683-27837833999995883-37999985888997598-886999848889879898778766726777


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             23213445433556665311044432000024444544443322222211111222111234444650357718865556
Q gi|254780771|r  193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG  272 (347)
Q Consensus       193 ~~vIG~~GFgf~~~~~~~~~~~~~G~v~Ig~~v~IG~n~tIdrg~~~~t~Ig~~~~id~~v~i~hn~~iG~~~~~~~~~~  272 (347)
T Consensus        83 f~y~~~~~~~~~~~~~~~~~~~~~~~~~Ig~dvwiG~~~~i~--------------------------------------  124 (204)
T TIGR03308        83 FTYRAAMYFDDASDDADFFAWRRAKRVTIGHDVWIGHGAVIL--------------------------------------  124 (204)
T ss_pred             EEEECCCCCCCCCCCHHHHCCCCCCCEEECCCCEECCCCEEC--------------------------------------
T ss_conf             755375334666661223213347870989976887998991--------------------------------------


Q ss_pred             EECCCEECCCCEEEECCEEECCEEECCCCEECCC-CEEEE
Q ss_conf             5036365697297306878378598888898625-32600
Q gi|254780771|r  273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK-SGVLK  311 (347)
Q Consensus       273 ~~g~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~-s~v~~  311 (347)
T Consensus       125 --~gv~IG~gavigagsvVtk--dv~~~~iv~G~PAk~ir  160 (204)
T TIGR03308       125 --PGVTIGNGAVIAAGAVVTK--DVAPYTIVAGVPAKLIR  160 (204)
T ss_pred             --CCCEECCCCEECCCCEECC--CCCCCEEEEECCCEEEE
T ss_conf             --9979999989977998995--17998499841885663