HHsearch alignment for GI: 254780771 and conserved domain: cd00710

>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three distinct groups of carbonic anhydrases - alpha, beta and gamma - which show no significant sequence identity or structural similarity. Gamma CAs are homotrimeric enzymes, with each subunit containing a left-handed parallel beta helix (LbH) structural domain.
Probab=99.84  E-value=5e-21  Score=132.86  Aligned_cols=55  Identities=33%  Similarity=0.508  Sum_probs=43.6

Q ss_pred             ECCCEECCCCEEEECCEEECCEEECCCCEECCCCEEE-------EEECCCCEE-EEECCHHHHH
Q ss_conf             0363656972973068783785988888986253260-------000798789-9824175888
Q gi|254780771|r  274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL-------KDIPAGQQY-GGMPARPIGE  329 (347)
Q Consensus       274 ~g~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~-------~~v~~~~~~-~G~pa~~~~~  329 (347)
T Consensus        80 hG~c~Igd~~~IG~gaiv~~-a~Ig~~~vIgags~V~g~~i~~g~~v~~G~~v~~~~pa~~~~~  142 (167)
T cd00710          80 HGPAYIGDNCFIGFRSVVFN-AKVGDNCVIGHNAVVDGVEIPPGRYVPAGAVITSQTQADALPD  142 (167)
T ss_pred             CCEEEECCCCEECCCCEEEC-CEECCCCEECCCCEEECCCCCCCCEECCCCEEECCCCHHHCCC
T ss_conf             12049839988988989982-5976998998898884778399989558828836996697337