HHsearch alignment for GI: 254780771 and conserved domain: cd03360

>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Probab=99.96  E-value=4.3e-29  Score=176.59  Aligned_cols=117  Identities=32%  Similarity=0.475  Sum_probs=89.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEHHHCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEEECCCCCE
Q ss_conf             57654333100156532334420000110011232033112210000000233210023322023310024420100000
Q gi|254780771|r  113 SSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHS  192 (347)
Q Consensus       113 ~~~~~~I~~~a~I~~~a~I~~~v~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG~~~~I~~  192 (347)
T Consensus        81 ~~~~niIhp~a~i~~~~~ig~G~~I~~~~~i~~~~~IG~~~~i~~~~~i~Hd~~ig~~----------------------  138 (197)
T cd03360          81 YRFATLIHPSAVVSPSAVIGEGCVIMAGAVINPDARIGDNVIINTGAVIGHDCVIGDF----------------------  138 (197)
T ss_pred             CEEEEEECCCCEECCCCEECCCCEEECCCEECCCCCCCCEEEECCCHHCCCCCCCCCC----------------------
T ss_conf             9678999999598777479994299317598656530436898770010531501310----------------------


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             23213445433556665311044432000024444544443322222211111222111234444650357718865556
Q gi|254780771|r  193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG  272 (347)
Q Consensus       193 ~~vIG~~GFgf~~~~~~~~~~~~~G~v~Ig~~v~IG~n~tIdrg~~~~t~Ig~~~~id~~v~i~hn~~iG~~~~~~~~~~  272 (347)
T Consensus       139 ------------------------------------------------------------------------~~i~~~~~  146 (197)
T cd03360         139 ------------------------------------------------------------------------VHIAPGVV  146 (197)
T ss_pred             ------------------------------------------------------------------------CEECCCEE
T ss_conf             ------------------------------------------------------------------------10667236


Q ss_pred             EECCCEECCCCEEEECCEEECCEEECCCCEECCCCEEEEEECCCCEEEEEC
Q ss_conf             503636569729730687837859888889862532600007987899824
Q gi|254780771|r  273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMP  323 (347)
Q Consensus       273 ~~g~~~ig~~~~ig~~~~i~~~v~ig~~~~i~a~s~v~~~v~~~~~~~G~p  323 (347)
T Consensus       147 i~g~v~Ig~~~~iG~~~~i~~~i~Ig~~~~igags~v~~~i~~~~~~~G~P  197 (197)
T cd03360         147 LSGGVTIGEGAFIGAGATIIQGVTIGAGAIIGAGAVVTKDVPDGSVVVGNP  197 (197)
T ss_pred             ECCCEEEEEECCCCCCCEECCCCEECCCCEECCCCEEEEECCCCEEEEECC
T ss_conf             778308912162989989879989999999997998912569990999309