HHsearch alignment for GI: 254780771 and conserved domain: cd04651

>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and rate-limiting step in starch biosynthesis in plants and glycogen biosynthesis in bacteria. It is the enzymatic site for regulation of storage polysaccharide accumulation in plants and bacteria. The enzyme is a homotetramer, with each subunit containing an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain with at 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The LbH domain is involved in cooperative allosteric regulation and oligomerization.
Probab=99.14  E-value=2.3e-11  Score=80.50  Aligned_cols=77  Identities=29%  Similarity=0.445  Sum_probs=55.4

Q ss_pred             CCCCCCCCCCCCCCCCCCEEHHHCCCCCCEEEECCCCCCCCHHCCCCCCCCCCCCCEEEEEEEEEEEECCCCCEEEECCC
Q ss_conf             33100156532334420000110011232033112210000000233210023322023310024420100000232134
Q gi|254780771|r  119 ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGN  198 (347)
Q Consensus       119 I~~~a~I~~~a~I~~~v~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~~I~~~iIG~~~~I~~~~vIG~  198 (347)
T Consensus         4 ~~~~~~v-~~S~Ig~Gc~I~-~~~V-~~SVIg~~~~Ig~~a~I-~~svi~~~~~Ig~~~~l~~~Ii~~~~~I~~g~~Ig~   79 (104)
T cd04651           4 IGRRGEV-KNSLVSEGCIIS-GGTV-ENSVLFRGVRVGSGSVV-EDSVIMPNVGIGRNAVIRRAIIDKNVVIPDGVVIGG   79 (104)
T ss_pred             ECCCCEE-EECEECCCCEEE-CCEE-ECCEECCCCEECCCCEE-ECCEEECCCEECCCCEEEEEEECCCCEECCCCEECC
T ss_conf             8899489-849988997995-9999-80897299799999899-600996556899999998619999999998999998


Q ss_pred             C
Q ss_conf             4
Q gi|254780771|r  199 D  199 (347)
Q Consensus       199 ~  199 (347)
T Consensus        80 ~   80 (104)
T cd04651          80 D   80 (104)
T ss_pred             C
T ss_conf             9