BLAST/PSIBLAST alignment of GI: 254780771 and GI: 140063966 at iteration 1
>gi|140063966|gb|ABO82470.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein [Candidatus Liberibacter asiaticus] Length = 347
 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/347 (99%), Positives = 346/347 (99%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN
Sbjct: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS
Sbjct: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY
Sbjct: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
           SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT+ D
Sbjct: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTMGD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN
Sbjct: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
Sbjct: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347