BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl]
glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str.
psy62]
         (347 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040448|gb|ACT57244.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 347

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/347 (100%), Positives = 347/347 (100%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN
Sbjct: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS
Sbjct: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY
Sbjct: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
           SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD
Sbjct: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN
Sbjct: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
Sbjct: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347


>gi|140063966|gb|ABO82470.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein
           [Candidatus Liberibacter asiaticus]
          Length = 347

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/347 (99%), Positives = 346/347 (99%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN
Sbjct: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS
Sbjct: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY
Sbjct: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
           SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT+ D
Sbjct: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTMGD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN
Sbjct: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR
Sbjct: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347


>gi|315121988|ref|YP_004062477.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495390|gb|ADR51989.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 339

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 267/336 (79%), Positives = 306/336 (91%), Gaps = 4/336 (1%)

Query: 16  MKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           MKLA+SIGASL D +FG+R+++SLSP+ RAS GD+S I SRKFL+++E+CKASAIICS D
Sbjct: 1   MKLAESIGASLSDGDFGKRLVFSLSPVMRASQGDVSCIFSRKFLSDVEECKASAIICSVD 60

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASS-FEGGISPQAFLGEDVKIEDG 134
           I+P+IPK+IPCLLSDKPEVSFAIAGSILYPQAM M +SS   GGISP+AF+ +DV +E+G
Sbjct: 61  IMPYIPKHIPCLLSDKPEVSFAIAGSILYPQAMRMGSSSDIVGGISPKAFVAKDVNLEEG 120

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGV 194
           VVI PMA +  GVEIGR TYVGPGSVIG GVRIGR+CSIGAGSSIYSSLIGN+VI+HSGV
Sbjct: 121 VVIEPMAFIDSGVEIGRGTYVGPGSVIGKGVRIGRDCSIGAGSSIYSSLIGNNVIVHSGV 180

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
           RIGNDGFGYAR +S IHKIVHIGRVIIQDKVEIGANSAIDRGT+DDT+IGENTKIDNQVQ
Sbjct: 181 RIGNDGFGYARDMSTIHKIVHIGRVIIQDKVEIGANSAIDRGTMDDTVIGENTKIDNQVQ 240

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           IGHNVHIG GCII+SQVGIAGSTYIGDNVLI GQCGIAG++ IGDNVQIA+KSGV K+IP
Sbjct: 241 IGHNVHIGVGCIIISQVGIAGSTYIGDNVLIAGQCGIAGHINIGDNVQIAAKSGVHKNIP 300

Query: 315 AGQQYGGMPARPIGEYLRHMVMLSKPSKY---KIKR 347
           AGQ+YGG+PARPI +YLRHM+MLSKPSKY   K+K+
Sbjct: 301 AGQKYGGIPARPIRDYLRHMIMLSKPSKYSDDKVKK 336


>gi|55380592|gb|AAV50035.1| putative UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Candidatus Liberibacter asiaticus]
          Length = 271

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 265/268 (98%), Positives = 267/268 (99%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRLNFFVSHKGIALMKLAQSIGASLLDENFG+RMIYSLSPIARASTGDISYIISRKFLN
Sbjct: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGDRMIYSLSPIARASTGDISYIISRKFLN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS
Sbjct: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY
Sbjct: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
           SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT+ D
Sbjct: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTMGD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIV 268
           TIIGENTKIDNQVQIGHNVHIGCGCIIV
Sbjct: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIV 268


>gi|209916652|gb|ACI96018.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Liberibacter asiaticus]
          Length = 206

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/206 (99%), Positives = 206/206 (100%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN
Sbjct: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NIEKCKASAIICSQDIVPFIPKNIPCLLSDKP+VSFAIAGSILYPQAMHMEASSFEGGIS
Sbjct: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPKVSFAIAGSILYPQAMHMEASSFEGGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY
Sbjct: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARG 206
           SSLIGNSVILHSGVRIGNDGFGYARG
Sbjct: 181 SSLIGNSVILHSGVRIGNDGFGYARG 206


>gi|222085865|ref|YP_002544396.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Agrobacterium radiobacter K84]
 gi|254810166|sp|B9JEX8|LPXD_AGRRK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|221723313|gb|ACM26469.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Agrobacterium radiobacter K84]
          Length = 355

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 245/348 (70%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M+ + FF  H G++L  LA+ +GA L DE F   +I S++P+ RA  GD+ Y++SRK   
Sbjct: 1   MEHIGFFPPHDGVSLRALAEHLGAELADEAFAGVIIKSIAPVYRAGDGDVCYLLSRKNRA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEA-SSFEGGI 119
            +E CKASAIIC   +   +P++IP LLS KP   FA+AG++L+PQAM   A +S    I
Sbjct: 61  ELETCKASAIICLPTLSSLVPEHIPVLLSKKPHTDFALAGALLHPQAMRPVALTSTPTLI 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           SP AF+    K+E  V + P AVV PG EIG  T +G G++IG GV+IGR+C+IG G+S+
Sbjct: 121 SPTAFVDPTAKLEADVGVEPGAVVGPGAEIGEGTRIGAGAIIGPGVKIGRHCTIGGGASV 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             S +GN VI+H+G RIG DGFGYA     + KIV IGRVIIQD VEIGAN+ IDRGT+D
Sbjct: 181 LCSYLGNGVIIHNGARIGQDGFGYAPSPRGMIKIVQIGRVIIQDNVEIGANTTIDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C IVSQVGIAGS  IGD V IGG  GI G+++IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVRIGRYCAIVSQVGIAGSAVIGDGVQIGGHTGINGHIQIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
            VQI + SGV+  IPAG+++ G+PARP+ ++LR    ++K S  + K+
Sbjct: 301 GVQIGAMSGVMNSIPAGERFAGIPARPLWDFLREAAEVAKRSGAREKK 348


>gi|86357542|ref|YP_469434.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhizobium etli CFN 42]
 gi|119371963|sp|Q2K8X9|LPXD_RHIEC RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|86281644|gb|ABC90707.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein
           [Rhizobium etli CFN 42]
          Length = 354

 Score =  365 bits (937), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 182/344 (52%), Positives = 243/344 (70%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA+ +GA L + +  + ++ S++PI+RA  GD+ YI+SR+   
Sbjct: 1   MEQNVFFLPHEGLKLAELAEFLGAELANSDHSDVIVRSVAPISRARAGDVCYILSRRNRE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
               C+ASA+IC + +   +P ++P +LS  P  +FA+AG + YP A+   A S E  I+
Sbjct: 61  EFATCEASAVICDKALADVVPPHLPVILSSNPHAAFAMAGGLFYPAALRPVAISGESEIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+E GV++ P+AV+ P  EIG  T +G  SVIG  V+IGR+CSI AG+SI 
Sbjct: 121 PSAVIDPSAKLEKGVIVEPLAVIGPHAEIGEGTRIGANSVIGPDVKIGRDCSIAAGASIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +LIGN V++H+GVRIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRG +DD
Sbjct: 181 CALIGNGVVIHNGVRIGQDGFGYAPGPRGMIKIVQIGRVIIQDNVEIGANTTIDRGAMDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C IVSQVGIAGST IG+ V IGGQ GI G++ IGD 
Sbjct: 241 TVIGEGTKIDNQVQIGHNVQIGRHCAIVSQVGIAGSTKIGNGVQIGGQVGIKGHVTIGDG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           VQIA+KSG++ D+ AG QYGG+PARP+ +YLR        SK +
Sbjct: 301 VQIAAKSGIMTDLAAGGQYGGIPARPLKDYLREAAQQVSKSKLR 344


>gi|209549190|ref|YP_002281107.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534946|gb|ACI54881.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 354

 Score =  364 bits (935), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 182/344 (52%), Positives = 245/344 (71%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA+ +GA L + +  + ++ S++PI RA  GD+ YI+SR+  +
Sbjct: 1   MEQNVFFLPHEGLKLAELAEFLGAELANSDHADIVVRSVAPINRARAGDVCYILSRRNRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +  C+ASA+IC + +   +P +IP +LS  P  +FA+AG + YP A+     S EG I+
Sbjct: 61  ELATCEASAVICDKALADLVPPHIPIILSSNPHAAFAMAGGLFYPAALRPVVFSGEGEIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    ++E GV++ P+AV+    EIG  T +G  S+IG GV+IGR+CSI AG+SI 
Sbjct: 121 PSAVIDPSARLEKGVIVEPLAVIGAHAEIGEGTRIGAHSLIGPGVKIGRDCSIAAGASIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +LIGN VI+H+GVRIG DGFGYA G   + KIV IGRVIIQDKVEIGAN+ IDRG +DD
Sbjct: 181 CALIGNGVIIHNGVRIGQDGFGYAPGPRGMIKIVQIGRVIIQDKVEIGANTTIDRGAMDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C IV+QVGIAGST IG+ V IGGQ GI G++ IGD 
Sbjct: 241 TVIGEGTKIDNQVQIGHNVQIGRHCAIVAQVGIAGSTKIGNGVQIGGQVGIKGHVTIGDG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           VQIA+KSG++ D+ AG QYGG+PARP+ +YLR        SK +
Sbjct: 301 VQIAAKSGIMTDLAAGGQYGGVPARPLKDYLREAAQQVSKSKLR 344


>gi|222148854|ref|YP_002549811.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Agrobacterium vitis S4]
 gi|221735840|gb|ACM36803.1| UDP glucosamine N-acyltransferase [Agrobacterium vitis S4]
          Length = 355

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 244/348 (70%), Gaps = 2/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M+   F+  H G++L +LA  +GA LL +  G+R+I S++P+ RA   DI YI+SR+   
Sbjct: 2   MEHETFYPPHAGVSLKELADRLGAELLQDEAGDRVIRSVAPVYRAKQSDICYILSRRNKA 61

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG-- 118
            +E C+A AI+C   +   IP++IP LL   P  +FAIAG  L+P        +  G   
Sbjct: 62  ELETCEAGAILCDVALRSLIPEHIPVLLIKNPHAAFAIAGQFLHPDGKQPLPVARPGAAD 121

Query: 119 ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSS 178
           ISP AF+    ++EDGVV+ PMAV+   VEIG  + +G GSVIG GV+IGR+CSI AG+S
Sbjct: 122 ISPAAFVDPSARLEDGVVVEPMAVIGADVEIGASSLIGAGSVIGRGVKIGRDCSIAAGTS 181

Query: 179 IYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTI 238
           I +S IGN VI+H+G RIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRGT+
Sbjct: 182 IIASYIGNGVIIHNGARIGQDGFGYAPGPRGMVKIVQIGRVIIQDNVEIGANTTIDRGTM 241

Query: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIG 298
           DDT+IGE TKIDNQVQI HNV IG  C IV+QVGIAGST IGD VLIGG  G+ G++KIG
Sbjct: 242 DDTVIGEGTKIDNQVQIAHNVRIGRHCGIVAQVGIAGSTVIGDGVLIGGGSGVNGHIKIG 301

Query: 299 DNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           D VQIA+ SGV+ D+P G+++GG+PARP+G++LR    +   S+ K K
Sbjct: 302 DGVQIAAMSGVIGDLPPGEKFGGIPARPLGDFLRDCAQIMGRSEGKSK 349


>gi|190891615|ref|YP_001978157.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhizobium etli CIAT 652]
 gi|190696894|gb|ACE90979.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein
           [Rhizobium etli CIAT 652]
          Length = 355

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 182/345 (52%), Positives = 246/345 (71%), Gaps = 1/345 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA  +GA L + +  + +++S++PI RA  GD+ YI+SR+  +
Sbjct: 1   MEQNYFFLPHEGLKLAELAGFLGAELANPDHADVIVHSVAPINRAQAGDVCYILSRRSRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEA-SSFEGGI 119
            +  C+ASA+IC + +   +P +IP +LS  P  +FA+AG + YP A+   A S  E GI
Sbjct: 61  ELLTCQASAVICDKALADLVPPHIPIILSSNPHAAFAMAGGLFYPAALRPVAISPDESGI 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A +    K+E GV++ P+AV+    EIG+ T +G  +VIG GV+IGR+CSI AG+SI
Sbjct: 121 APSAVIDPSAKLEKGVIVEPLAVIGAHAEIGQGTRIGAQTVIGPGVKIGRDCSIAAGASI 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +LIGN VI+H+GVRIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRG +D
Sbjct: 181 LCALIGNGVIIHNGVRIGQDGFGYAPGPRGMIKIVQIGRVIIQDNVEIGANTTIDRGAMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV +G  C IV+QVGIAGST IG+ V IGGQ GI G++ IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVQMGRHCAIVAQVGIAGSTKIGNGVQIGGQAGIKGHVTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            VQIA+KSG++ D+ AG QYGG+PARP+ +YLR        SK +
Sbjct: 301 GVQIAAKSGIMTDLAAGGQYGGVPARPLKDYLREAAQQVSKSKLR 345


>gi|327189230|gb|EGE56409.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase protein
           [Rhizobium etli CNPAF512]
          Length = 355

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 246/345 (71%), Gaps = 1/345 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA  +GA L + +  + +++S++PI RA  GD+ YI+SR+  +
Sbjct: 1   MEQNYFFLPHEGLKLAELAGFLGAELANPDHADVIVHSVAPINRAQAGDVCYILSRRSRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGI 119
            +  C+ASA+IC + +   +P +IP +LS  P  +FA+AG + YP A+  +  S  E GI
Sbjct: 61  ELLTCQASAVICDKALADLVPPHIPIILSSNPHAAFAMAGGLFYPAALRPVVISPDESGI 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A +    K+E GV++ P+AV+    EIG+ T +G  +VIG GV+IGR+CSI AG+SI
Sbjct: 121 APSAVIDPSAKLEKGVIVEPLAVIGAHAEIGKGTRIGAQTVIGPGVKIGRDCSIAAGASI 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +LIGN VI+H+GVRIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRG +D
Sbjct: 181 LCALIGNGVIIHNGVRIGQDGFGYAPGPRGMIKIVQIGRVIIQDNVEIGANTTIDRGAMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV +G  C IV+QVGIAGST IG+ V IGGQ GI G++ IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVQMGRHCAIVAQVGIAGSTKIGNGVQIGGQAGIKGHVTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            VQIA+KSG++ D+ AG QYGG+PARP+ +YLR        SK +
Sbjct: 301 GVQIAAKSGIMTDLAAGGQYGGVPARPLKDYLREAAQQVSKSKLR 345


>gi|116251985|ref|YP_767823.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|119371964|sp|Q1MH46|LPXD_RHIL3 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|115256633|emb|CAK07721.1| putative lipid A biosynthesis UDP-3-O-[3-hydroxymyristoyl]
           glucosamine N-acyltransferase [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 354

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 245/347 (70%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA+ +GA L++ ++ + ++ S++PI+RA  GD+ YI+SR+  +
Sbjct: 1   MEQNVFFLPHEGLKLAELAEFLGAELVNSDYADVIVRSVAPISRARAGDVCYILSRRSRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +  C+ASA+IC + +   +P+++P +LS  P  +FA+AG + YP A+   A S E  I+
Sbjct: 61  ELATCEASAVICDKALADLVPQHLPVMLSSNPHAAFAMAGGLFYPAALRPVAFSGESEIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    ++E GV++ PMAV+    EIG  T +G  S+IG  V+IGR+CSI AG+SI 
Sbjct: 121 PSAVIDPSARLEKGVIVEPMAVIGAHAEIGEGTRIGAHSIIGPNVKIGRDCSIAAGASII 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +L+GN VI+H+G RIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRG +DD
Sbjct: 181 CALLGNGVIIHNGARIGQDGFGYAPGPRGMIKIVQIGRVIIQDNVEIGANTTIDRGAMDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C IV+ VGIAGS  IG+ V IGGQ GI G++ IGD 
Sbjct: 241 TVIGEGTKIDNQVQIGHNVQIGRHCAIVALVGIAGSAKIGNGVQIGGQVGIKGHVTIGDG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA++SG++ D+ AG QYGG P RP+ +YLR +      +K + K+
Sbjct: 301 VQIAAQSGIMTDLAAGGQYGGTPGRPLNDYLRDVAQQMSKTKLRGKK 347


>gi|241204512|ref|YP_002975608.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240858402|gb|ACS56069.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 354

 Score =  355 bits (910), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 175/344 (50%), Positives = 241/344 (70%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA+ +GA L + +  + ++ S++PI+RA  GD+ YI+SR+  +
Sbjct: 1   MEQNVFFLPHEGLKLAELAEFLGAELANSDHADVVVRSVAPISRARAGDVCYILSRRNRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +  C+ASA+IC + +   +P +IP +LS  P  +FA+AG + YP A+     S E  I+
Sbjct: 61  ELATCEASAVICDKALADLVPPHIPVILSSNPHAAFAMAGGLFYPAALRPVVFSGESEIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+E GV++ PMAV+    EIG  T +G  S+IG  V+IGR+CSI AG+SI 
Sbjct: 121 PSAVIDPSAKLEKGVIVEPMAVIGAHAEIGEGTRIGAQSIIGPNVKIGRDCSIAAGASIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +L+GN VI+H+G RIG DGFGYA G   + KIV IGRVIIQD VEIGAN++IDRGT+DD
Sbjct: 181 CALLGNGVIIHNGARIGQDGFGYAPGPRGMIKIVQIGRVIIQDNVEIGANTSIDRGTMDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C IV+ VGIAGS  IG+ V IGGQ GI G++ IGD 
Sbjct: 241 TVIGEGTKIDNQVQIGHNVQIGRHCAIVAHVGIAGSAKIGNGVQIGGQVGIKGHVTIGDG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           VQIA++SG++ D+ AG QYGG P RP+ +YLR +      +K +
Sbjct: 301 VQIAAQSGIMTDLAAGGQYGGTPGRPLNDYLRDVAQQMSRTKLR 344


>gi|227821905|ref|YP_002825875.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Sinorhizobium fredii NGR234]
 gi|254810175|sp|C3MBR0|LPXD_RHISN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|227340904|gb|ACP25122.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Sinorhizobium fredii NGR234]
          Length = 354

 Score =  352 bits (904), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 180/348 (51%), Positives = 242/348 (69%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF  H+GI L  LA  IGA L D +  +  I+ ++P+ RA  GD+ Y++SRK  +
Sbjct: 1   MEQNWFFPPHQGIRLGDLADRIGAELSDASVADHPIHGVAPVYRAKAGDVCYMLSRKSRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +E C+ASAIIC + I   +P  IP LL+ KP  +FA+AG++L+ +A+    ++   GI+
Sbjct: 61  ELESCQASAIICDKAIASIVPSRIPVLLTQKPHTAFALAGALLHGEALRPSYNTSLRGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P AF+    ++E GV + P AVV  G EIG  T +  G+VIG  VRIGR+C+I AG+SI 
Sbjct: 121 PGAFIDPTARLEPGVEVEPTAVVGAGAEIGSGTRIAAGAVIGPQVRIGRDCTISAGASIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+VI+H G RIG DGFGYA G    + KIV +GRVIIQD VEIGAN+ +DRGT+D
Sbjct: 181 CALIGNNVIIHPGARIGQDGFGYAPGPKGGMIKIVQVGRVIIQDHVEIGANTTVDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQIGHNV IG  C IVSQVGIAGS  IGD V+IGG  G+ G+  IGD
Sbjct: 241 DTVIGEGTKIDNLVQIGHNVRIGRYCGIVSQVGIAGSARIGDGVMIGGNAGVNGHTTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
             QIA+ SGV  D+PAG++YGG+PARP+ ++LR +  ++  S  + K+
Sbjct: 301 GAQIAAMSGVASDVPAGERYGGIPARPMRDFLREVAEIAMRSSERHKK 348


>gi|15888708|ref|NP_354389.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Agrobacterium tumefaciens str. C58]
 gi|22095831|sp|Q8UFL5|LPXD_AGRT5 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|15156448|gb|AAK87174.1| UDP glucosamine N-acyltransferase [Agrobacterium tumefaciens str.
           C58]
          Length = 355

 Score =  351 bits (901), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 180/348 (51%), Positives = 240/348 (68%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M+   FF  H+G+ L  +A   GA L D+  GER+I S++P+ RA    + YI+SRK   
Sbjct: 1   MEYNAFFPPHEGLRLKDIADLFGAELSDDAAGERIIRSVAPVYRAKPDQLCYILSRKSGE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHME-ASSFEGGI 119
            +  C+A A+IC   +   IP +IP L+S  P   FA  G++L+P AM     +  E  I
Sbjct: 61  ELLTCEAGAVICDAALKSLIPSHIPALISKTPHTLFAQVGALLHPSAMRPSLVARMEAEI 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           SP A++    K+E GV++ PMAV+  GV IG  T +GPG VIG+ V+IGR+C+I  G+SI
Sbjct: 121 SPAAYVDPSAKLEPGVIVEPMAVIGAGVHIGAGTRIGPGVVIGSDVQIGRDCTIAGGASI 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
            ++L+GN+VI+H+G RIG DGFGYA G   + KIV IGRVIIQD VE+GAN+ IDRGT+D
Sbjct: 181 LAALLGNNVIIHNGARIGQDGFGYAPGPRGMLKIVQIGRVIIQDHVEVGANTTIDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C IVS VGIAGST IGD V+IGG  G+ G++ IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVRIGRHCGIVSGVGIAGSTRIGDGVMIGGATGVNGHITIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
            VQIA+ SGV+ D+PAG +YGG+PARP+  +LR M  +   ++ + K+
Sbjct: 301 GVQIAAMSGVVSDVPAGTRYGGIPARPMKHFLRDMADILARAEERDKK 348


>gi|325292745|ref|YP_004278609.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Agrobacterium sp. H13-3]
 gi|325060598|gb|ADY64289.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Agrobacterium sp. H13-3]
          Length = 355

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 237/348 (68%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M+   FF  H+G+ L  +A   GA L DE  GER+I S++P+ RA    + YI+SRK  +
Sbjct: 1   MEYNAFFPPHEGLRLKDIADRFGAELSDEAAGERIIRSVAPVYRAKPDQLCYILSRKNRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEA-SSFEGGI 119
            +  C+A A+IC   +   +P +IP L+S  P   FA  G++L+P AM        E  +
Sbjct: 61  ELPTCEAGAVICDAALADMLPSHIPALISKNPHTLFAQVGALLHPAAMRPGTIVVMEAEV 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           S  A +    K+E GV++ P+AV+  G  IG  T +GPG +IGA V++GR+C+I  G+SI
Sbjct: 121 SHTAHVDPSAKLEAGVIVEPLAVIGAGAHIGAGTRIGPGVIIGADVQVGRDCTIAGGASI 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
            ++LIGN+VI+H+G RIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRGT+D
Sbjct: 181 LAALIGNNVIIHNGARIGQDGFGYAPGPRGMLKIVQIGRVIIQDNVEIGANTTIDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C IVS+VGIAGST IGD V+IGG  GI G++ IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVRIGRHCGIVSKVGIAGSTRIGDGVMIGGAAGINGHITIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
            VQIA+ SGV+ D+PAG +YGG PARP+  +LR M  +   ++ + K+
Sbjct: 301 GVQIAAMSGVVADVPAGARYGGTPARPMKYFLRDMADILARAEGRDKK 348


>gi|15965256|ref|NP_385609.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Sinorhizobium meliloti 1021]
 gi|307309279|ref|ZP_07588947.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sinorhizobium meliloti BL225C]
 gi|20138657|sp|Q92Q47|LPXD_RHIME RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|15074436|emb|CAC46082.1| Probable UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Sinorhizobium meliloti 1021]
 gi|306900280|gb|EFN30897.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sinorhizobium meliloti BL225C]
          Length = 354

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 183/348 (52%), Positives = 249/348 (71%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF  H+GI L  LA  IGA LLD +  +R + +++P+ RA  GDI Y++SRK   
Sbjct: 1   MEQNWFFPPHQGIRLGDLANQIGAELLDISAADRTVRAVAPVYRAKPGDICYMLSRKNRE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            ++ C+A+AIIC + I   +P  IP LL+ KP  +FA+AG++L+ +AM    ++ E G++
Sbjct: 61  ELQTCRAAAIICDKAISSLVPDTIPVLLTSKPHTAFALAGTLLHERAMRPSYNTSERGVA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P+AF+    ++E GV + PMAV+  G EIG  T +  G++IG GVRIGR+C+I AG+SI 
Sbjct: 121 PEAFVDPTARLEAGVEVEPMAVIGAGAEIGSGTRIAAGAMIGQGVRIGRDCTISAGASIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+VI+H G RIG DGFGYA G    + KIV +GRVIIQD VEIGAN+ IDRGT+D
Sbjct: 181 CALIGNNVIIHPGARIGQDGFGYAPGPKGGMIKIVQVGRVIIQDHVEIGANTTIDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQIGHNV IG  C IVSQVGIAGST IGD V+IGG  G+ G++ IGD
Sbjct: 241 DTVIGEGTKIDNLVQIGHNVRIGRYCGIVSQVGIAGSTQIGDGVMIGGGVGVNGHITIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
             QIA+ SGV  D+PAG++YGG+PARP+ ++LR +  ++  S  + K+
Sbjct: 301 GAQIAAMSGVASDVPAGERYGGIPARPMRDFLRDVAEMALRSSERQKK 348


>gi|307317021|ref|ZP_07596462.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306897109|gb|EFN27854.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sinorhizobium meliloti AK83]
          Length = 354

 Score =  339 bits (869), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 183/348 (52%), Positives = 248/348 (71%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF  H+GI L  LA  IGA LLD +  +R + +++P+ RA  GDI Y++SRK   
Sbjct: 1   MEQNWFFPPHQGIRLGDLANQIGAELLDTSAADRTVRAVAPVYRAKPGDICYMLSRKNRE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            ++ C+A+AIIC + I   +P  IP LL+ KP  +FA+AG++L+ +AM    ++ E G++
Sbjct: 61  ELQTCRAAAIICDKAISSIVPDTIPVLLTSKPHTAFALAGTLLHERAMRPSYNTSERGVA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P AF+    ++E GV + PMAV+  G EIG  T +  G++IG GVRIGR+C+I AG+SI 
Sbjct: 121 PGAFVDPTARLEAGVEVEPMAVIGAGAEIGSGTRIAAGAMIGQGVRIGRDCTISAGASIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+VI+H G RIG DGFGYA G    + KIV +GRVIIQD VEIGAN+ IDRGT+D
Sbjct: 181 CALIGNNVIIHPGARIGQDGFGYAPGPKGGMIKIVQVGRVIIQDHVEIGANTTIDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQIGHNV IG  C IVSQVGIAGST IGD V+IGG  G+ G++ IGD
Sbjct: 241 DTVIGEGTKIDNLVQIGHNVRIGRYCGIVSQVGIAGSTQIGDGVMIGGGVGVNGHITIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
             QIA+ SGV  D+PAG++YGG+PARP+ ++LR +  ++  S  + K+
Sbjct: 301 GAQIAAMSGVASDVPAGERYGGIPARPMRDFLRDVAEMALRSSERQKK 348


>gi|150396358|ref|YP_001326825.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Sinorhizobium medicae WSM419]
 gi|166199104|sp|A6U8L0|LPXD_SINMW RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|150027873|gb|ABR59990.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sinorhizobium medicae WSM419]
          Length = 354

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 241/348 (69%), Gaps = 1/348 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF  H GI L  LA  IGA LLD    +R + +++P+ RA  GD+ Y++SRK   
Sbjct: 1   MEKNWFFPPHDGIRLGDLADQIGAELLDATAADRAVRAVAPVYRAKAGDVCYMLSRKSRE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            ++ C A+AIIC + I   +P  IP LL+ KP  +FA+AG++L+ +AM    ++ E G+S
Sbjct: 61  ELQTCSATAIICDKAISSLVPDTIPVLLTAKPHTAFALAGTLLHERAMRPSYNTSERGVS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P AF+    ++E GV + PMAV+  G EIG  T +  G++IG GVRIGR+C+I AG SI 
Sbjct: 121 PGAFVDSTARLEAGVEVEPMAVIGAGAEIGSGTRIAAGAMIGPGVRIGRDCTISAGVSIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARG-VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+VI+H G RIG DGFGYA G    + KIV +GRVIIQD VEIGAN+ IDRGT+D
Sbjct: 181 CALIGNNVIIHPGTRIGQDGFGYAPGPTGGMIKIVQVGRVIIQDHVEIGANTTIDRGTMD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQIGHNV IG  C IVSQVGIAGS  IGD V+IGG  G+ G+  IG 
Sbjct: 241 DTVIGEGTKIDNLVQIGHNVRIGRYCGIVSQVGIAGSAQIGDGVMIGGGVGVNGHTSIGS 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
             QIA+ SGV  D+PAG++YGG+PARP+ ++LR +  ++  S  + K+
Sbjct: 301 GAQIAAMSGVASDVPAGERYGGIPARPMRDFLRDVAEMALRSSERQKK 348


>gi|90419600|ref|ZP_01227510.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90336537|gb|EAS50278.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 352

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 155/339 (45%), Positives = 219/339 (64%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M  L FF    G+ L +LA   GASL +       I  ++ ++ A   D+S+  S+++  
Sbjct: 1   MHELTFFPRGDGLTLAELASLTGASLGEGADPALRIAGIAALSEAGPQDLSFFDSKRYSA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   +A  ++ S   V  +P  +P L++    ++F  AG  L+P A+    ++   G+S
Sbjct: 61  ELSATRAGCVLVSPKNVGLLPSGMPALVTASAAIAFTEAGRALFPGAVLPTPATGSHGVS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
            +A +  + ++EDGV +   A + PGVEIGR T VG G+VIGAG RIGRNC IG+  ++ 
Sbjct: 121 LKADIHREARLEDGVTVEAFASIGPGVEIGRGTIVGAGAVIGAGCRIGRNCRIGSNVTLT 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +L+G+ VILH GVRIG DGFGY  G + + K V IGRVIIQD VEIGAN+ +DRG + D
Sbjct: 181 HALVGDRVILHPGVRIGQDGFGYTAGPAGLVKAVQIGRVIIQDDVEIGANTTVDRGGVRD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQI HNV IG  C+IV+QVGI+GST +GD V+IGGQ GI G+L I D 
Sbjct: 241 TVIGEGTKIDNQVQIAHNVRIGRHCVIVAQVGISGSTTLGDGVMIGGQTGINGHLTIADG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            QIA+ S V  D+P G ++GG PA+P+ ++ R ++ LS+
Sbjct: 301 AQIAAVSSVAGDVPKGARWGGTPAKPVRDWFRELMTLSE 339


>gi|163760891|ref|ZP_02167970.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Hoeflea
           phototrophica DFL-43]
 gi|162281935|gb|EDQ32227.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Hoeflea
           phototrophica DFL-43]
          Length = 355

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 219/332 (65%), Gaps = 1/332 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M  ++FF  H+G++L  LA   GA L D +F ER +  ++P++ A   +I++  SRK L 
Sbjct: 1   MDTISFFPPHEGMSLSDLADLCGAELDDPSFAERRVTGVAPLSGAGADEITFANSRKSLP 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGI 119
           +++K +A A+  S +     P+ +  L+++ P+ +FA+A + L P +M  M      G +
Sbjct: 61  DLKKSRAGAVFVSANNSVHAPEGVAVLVTEAPQTAFALAAAQLVPCSMQPMVLGGETGVV 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           S  A +  D ++E GV +A  AV+  G EIG  T +  G+ +G G RIGRNC IG G SI
Sbjct: 121 STGAHVDPDARLEPGVTVAFGAVIGAGSEIGAGTVIAAGAAVGPGCRIGRNCHIGHGVSI 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +LIG+ VI+H G RIG DGFGYA G   + KI  IGRVIIQD VEIGAN+ IDRG +D
Sbjct: 181 QHALIGSGVIIHPGARIGQDGFGYAPGPKGLLKIPQIGRVIIQDDVEIGANTTIDRGALD 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQIGHNV IG  C++V+QVG+AGS  IG+ V+IGG  G+ G++ IGD
Sbjct: 241 DTVIGEGTKIDNLVQIGHNVRIGRHCVLVAQVGVAGSATIGNGVMIGGAAGVNGHVTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
            VQ+A+ SG   DIPAG ++GG PARP+  +L
Sbjct: 301 GVQLAAMSGAATDIPAGARWGGQPARPMRGFL 332


>gi|114704867|ref|ZP_01437775.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fulvimarina pelagi HTCC2506]
 gi|114539652|gb|EAU42772.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fulvimarina pelagi HTCC2506]
          Length = 353

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 220/345 (63%), Gaps = 1/345 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF    G  + ++A  IGA + +    +R +  ++ +  A   D+++  + ++ +
Sbjct: 1   MAAAEFFPRSDGKTIAEIADFIGAEIRNAPQWDRRMTGVASLDEARPNDVAFFDNVRYAD 60

Query: 61  NIEKCKASAIICSQDIVPF-IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
           ++   +A  +I S+      +P+    L++ + + +FA  G +L+P A+  +  S E G+
Sbjct: 61  SLGATRAGCVILSERYGSRPVPEGTAALVTKRADQAFASVGRMLFPMALAPQCVSGETGV 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           S +AF+    ++E GV + P AV+ PGVEIG  T +G  + + +G RIGR+C IGA  S+
Sbjct: 121 SDRAFVDASARLEAGVTVEPFAVIGPGVEIGSGTIIGANATVASGCRIGRDCRIGANVSL 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +LIGN VI+H GVR G DGFGY  G S + K V IGRV+IQD VEIGAN+ IDRG I 
Sbjct: 181 SHTLIGNRVIIHPGVRAGQDGFGYVAGPSGLMKTVQIGRVVIQDDVEIGANTTIDRGAIR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQ+ HNV IG  C+IV QVG++GS  +GD V+IGGQ G+ G++K+GD
Sbjct: 241 DTVIGEGTKIDNQVQVAHNVVIGRHCVIVGQVGLSGSCTLGDGVMIGGQSGVNGHVKVGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             QIA+ S V  D+P G ++GG PA+P+ E+ R ++ LS+ +K +
Sbjct: 301 GAQIAAISTVQNDVPPGVRWGGAPAKPVKEWFREIMTLSELAKKR 345


>gi|319408402|emb|CBI82057.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bartonella schoenbuchensis R1]
          Length = 348

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 213/342 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A+  GA LL+  F   +I +LS I  A  G + +I ++KF + +   
Sbjct: 6   FFTPSRRLTVADVAELTGAKLLNPEFSNTVINTLSSIESAEEGSLVFIENQKFSDALLGS 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
            A A++C+ DI   IPK+I  L++  P+  FA  G IL+P ++       +  ISP A++
Sbjct: 66  SAVAVLCTNDIALKIPKSIAILVTSTPQRDFAQIGRILFPDSVKPIPWLGKKEISPHAYI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               K+E  V +   AV+   VEIG  T V   +VIG   RIGR C I    +I  SLIG
Sbjct: 126 HPSAKLEHDVCVEAGAVIGKNVEIGSGTLVSSTAVIGENCRIGRECYIAPKVTIQYSLIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           + V L+ GV +G DGFGY  GV+ I KI H+GRVIIQD VEIGAN+ IDRGT++DTIIGE
Sbjct: 186 DRVYLYPGVCVGQDGFGYVNGVAGIEKIPHLGRVIIQDDVEIGANTTIDRGTLEDTIIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  G+A ++ IG+ VQIA+
Sbjct: 246 GSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSRLGGSVGVADHIAIGECVQIAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
            SGV+ DIP G+++GG+PARP  ++ R +  L    K K ++
Sbjct: 306 GSGVMNDIPDGEKWGGIPARPFKQWFREVAALRSIGKVKREK 347


>gi|319407368|emb|CBI81015.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bartonella sp. 1-1C]
          Length = 348

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/347 (43%), Positives = 210/347 (60%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  + +  GA LL+  F   +I +LS +  A  G + +I +RKF +
Sbjct: 1   MADTFFFTPSRRLTVADVVKLTGAKLLNPEFSNTVINTLSSVESAGEGSLVFIENRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ DIV  +P+ I  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 61  ALLGSSAVAVFCTSDIVFKVPETIAVLVTSTPQRDFAQVGRILFPASVRPTPWFGQKEIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A++    K+E+ V +   AV+   VEIG  T +   +VIG   RIGR+C I    ++ 
Sbjct: 121 PHAYIHPSAKLENDVCVEAGAVIGRNVEIGSGTLISSTAVIGENCRIGRDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIGN V ++ GV IG DGFGY R    + KI H+GRVIIQD VEIGAN+ IDRGT DD
Sbjct: 181 YSLIGNRVYIYPGVCIGQDGFGYVRSAIGVEKIPHLGRVIIQDGVEIGANTTIDRGTFDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  GIA ++ IG+ 
Sbjct: 241 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGSVGIADHITIGEC 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRSIGKVKREK 347


>gi|154253625|ref|YP_001414449.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|171769677|sp|A7HY09|LPXD_PARL1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|154157575|gb|ABS64792.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 353

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 213/346 (61%), Gaps = 3/346 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF + + ++L ++A  IGA+L D + G R++  ++P+  A + D+S++ + K+  
Sbjct: 1   MADKRFFEAKEPLSLGEIAGRIGAALADADDGSRIVTGVAPLDTAGSNDLSFLDNPKYAE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSF--EGG 118
                 A A I         P N+  +LSD+P  ++A+   I +P   H  A +F   G 
Sbjct: 61  AFYATAAGACIVHPRFAERAPDNVALILSDQPYRAYALVAQIFHPDEAHG-ADTFGARGE 119

Query: 119 ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSS 178
           I P+A +    K+  GV + P   +  GVEIG  T +G  + +G G  +G++C IG   +
Sbjct: 120 IHPRATVHPTAKLGTGVTLEPGVTIGAGVEIGNNTVIGTNTSVGKGCTVGKDCFIGPNVT 179

Query: 179 IYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTI 238
           +  + +G+ V++H GVRIG DGFG+A G+    K+  +GRVI+QD VEIGANS +DRG  
Sbjct: 180 LSHAHLGDRVMVHPGVRIGQDGFGFAMGLPRHEKVPQLGRVIVQDDVEIGANSTVDRGAG 239

Query: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIG 298
            DT+IGE TKIDN VQIGHNV IG GCIIVSQ GIAGST +GD V++  Q G+ G+L I 
Sbjct: 240 PDTVIGEGTKIDNLVQIGHNVEIGRGCIIVSQTGIAGSTKLGDFVVLAAQVGVTGHLTIN 299

Query: 299 DNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
              QIA++  V+ D+PAGQQYGG+PA+PI E+ R +V L K  + +
Sbjct: 300 SGAQIAARGAVVHDVPAGQQYGGVPAKPIAEWRREVVELRKLGRRR 345


>gi|306844017|ref|ZP_07476612.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Brucella
           sp. BO1]
 gi|306275772|gb|EFM57496.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Brucella
           sp. BO1]
          Length = 351

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 141/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPSGIAVLVSRHPHRDFSAVGRMLFPASVRQESWLGETGISPAAFI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRGT+DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGTLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|319899036|ref|YP_004159129.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella clarridgeiae 73]
 gi|319403000|emb|CBI76555.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella clarridgeiae 73]
          Length = 348

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 151/347 (43%), Positives = 210/347 (60%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  + +  GA LL+  F   +I +LS +  A  G + +I +RKF +
Sbjct: 1   MADTFFFTPSRRLTVADVVKLTGAKLLNPEFSNTVINTLSSVESAGEGSLVFIENRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ DIV  +P++I  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 61  ALLGSSAVAVFCTSDIVFKVPESIAILVTSTPQRDFAQVGRILFPTSVKPTPWFGQREIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+ED V +   AV+   VEIG  T +   +VIG   RIGR+C I    ++ 
Sbjct: 121 PHAHIHSSAKLEDDVCVEAGAVIGRNVEIGSGTLISSTAVIGENCRIGRDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V ++ GV IG DGFGY R    + KI H+GRVIIQD VEIGAN+ IDRGT DD
Sbjct: 181 YSLIGDRVYIYPGVCIGQDGFGYVRSAICVEKIPHLGRVIIQDGVEIGANTTIDRGTFDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST +GD   +GG  GIA ++ IG+ 
Sbjct: 241 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSVGDMSQLGGSVGIADHITIGEG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRSIGKLKREK 347


>gi|254693861|ref|ZP_05155689.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 3 str. Tulya]
 gi|261214147|ref|ZP_05928428.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 3 str. Tulya]
 gi|260915754|gb|EEX82615.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 3 str. Tulya]
          Length = 351

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  +  LLS  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPSGVAVLLSRHPHRDFSAVGRMLFPASVRPESWLGETGISPAAFI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|225627621|ref|ZP_03785658.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti str. Cudo]
 gi|237815573|ref|ZP_04594570.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus str. 2308 A]
 gi|225617626|gb|EEH14671.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti str. Cudo]
 gi|237788871|gb|EEP63082.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus str. 2308 A]
          Length = 367

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 22  FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 81

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 82  KAAGVLCTESLADSVPSGIAVLVSRHPHRDFSAVGRMLFPASVRPESWLGETGISPAAFI 141

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 142 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSVQCAFIG 201

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 202 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 261

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 262 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 321

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 322 ASGVMNDIPDGERWGGIPARPIKQWFRDI 350


>gi|294852493|ref|ZP_06793166.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. NVSL 07-0026]
 gi|294821082|gb|EFG38081.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. NVSL 07-0026]
          Length = 351

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPSGIAVLVSRHPRRDFSAVGRMLFPASVRPESWLGETGISPAAFI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|17987114|ref|NP_539748.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|23502031|ref|NP_698158.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis 1330]
 gi|62290066|ref|YP_221859.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82699992|ref|YP_414566.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis biovar Abortus 2308]
 gi|148560402|ref|YP_001259072.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ovis ATCC 25840]
 gi|161619105|ref|YP_001592992.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella canis ATCC 23365]
 gi|163843418|ref|YP_001627822.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis ATCC 23445]
 gi|189024306|ref|YP_001935074.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus S19]
 gi|225852651|ref|YP_002732884.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis ATCC 23457]
 gi|254689377|ref|ZP_05152631.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 6 str. 870]
 gi|254697510|ref|ZP_05159338.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701894|ref|ZP_05163722.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|254704440|ref|ZP_05166268.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|254706664|ref|ZP_05168492.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|254710228|ref|ZP_05172039.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis B2/94]
 gi|254714224|ref|ZP_05176035.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M644/93/1]
 gi|254717660|ref|ZP_05179471.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M13/05/1]
 gi|254730407|ref|ZP_05188985.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 4 str. 292]
 gi|256031722|ref|ZP_05445336.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|256044809|ref|ZP_05447713.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061235|ref|ZP_05451386.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella neotomae 5K33]
 gi|256113714|ref|ZP_05454518.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|256159885|ref|ZP_05457609.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M490/95/1]
 gi|256255122|ref|ZP_05460658.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti B1/94]
 gi|256257623|ref|ZP_05463159.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|256263855|ref|ZP_05466387.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 2 str. 63/9]
 gi|256369578|ref|YP_003107088.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella microti CCM 4915]
 gi|260168855|ref|ZP_05755666.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. F5/99]
 gi|260546617|ref|ZP_05822356.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565591|ref|ZP_05836075.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|260754895|ref|ZP_05867243.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 6 str. 870]
 gi|260758112|ref|ZP_05870460.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 4 str. 292]
 gi|260761936|ref|ZP_05874279.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883907|ref|ZP_05895521.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|261219501|ref|ZP_05933782.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M13/05/1]
 gi|261222320|ref|ZP_05936601.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti B1/94]
 gi|261314124|ref|ZP_05953321.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|261317787|ref|ZP_05956984.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis B2/94]
 gi|261321996|ref|ZP_05961193.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M644/93/1]
 gi|261325243|ref|ZP_05964440.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella neotomae 5K33]
 gi|261752458|ref|ZP_05996167.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|261755118|ref|ZP_05998827.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|261758343|ref|ZP_06002052.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. F5/99]
 gi|265988818|ref|ZP_06101375.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|265991233|ref|ZP_06103790.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995069|ref|ZP_06107626.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|265998283|ref|ZP_06110840.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M490/95/1]
 gi|297248465|ref|ZP_06932183.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 5 str. B3196]
 gi|61227662|sp|P0A3P4|LPXD_BRUME RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|61227663|sp|P0A3P5|LPXD_BRUSU RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|88911354|sp|Q2YRQ3|LPXD_BRUA2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|90185258|sp|P0C111|LPXD_BRUAB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|166199075|sp|A5VQS5|LPXD_BRUO2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|189028512|sp|A9M5G6|LPXD_BRUC2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|189028513|sp|B0CGV1|LPXD_BRUSI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|226740707|sp|B2S603|LPXD_BRUA1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|254810168|sp|C0RJC2|LPXD_BRUMB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|1262292|gb|AAA96789.1| LpxD [Brucella abortus]
 gi|17982776|gb|AAL52012.1| udp-3-o-[3-hydroxymyristoyl] glucosamine n-acyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|23347985|gb|AAN30073.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Brucella suis 1330]
 gi|62196198|gb|AAX74498.1| LpxD, UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616093|emb|CAJ11131.1| Bacterial transferase hexapeptide
           repeat:UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase, LpxD [Brucella melitensis biovar
           Abortus 2308]
 gi|148371659|gb|ABQ61638.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ovis ATCC 25840]
 gi|161335916|gb|ABX62221.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella canis ATCC 23365]
 gi|163674141|gb|ABY38252.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis ATCC 23445]
 gi|189019878|gb|ACD72600.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus S19]
 gi|225641016|gb|ACO00930.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis ATCC 23457]
 gi|255999740|gb|ACU48139.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella microti CCM 4915]
 gi|260095667|gb|EEW79544.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151659|gb|EEW86753.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|260668430|gb|EEX55370.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 4 str. 292]
 gi|260672368|gb|EEX59189.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675003|gb|EEX61824.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 6 str. 870]
 gi|260873435|gb|EEX80504.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|260920904|gb|EEX87557.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti B1/94]
 gi|260924590|gb|EEX91158.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M13/05/1]
 gi|261294686|gb|EEX98182.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M644/93/1]
 gi|261297010|gb|EEY00507.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis B2/94]
 gi|261301223|gb|EEY04720.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella neotomae 5K33]
 gi|261303150|gb|EEY06647.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|261738327|gb|EEY26323.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. F5/99]
 gi|261742211|gb|EEY30137.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|261744871|gb|EEY32797.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|262552751|gb|EEZ08741.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella ceti M490/95/1]
 gi|262766182|gb|EEZ11971.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|263002017|gb|EEZ14592.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093986|gb|EEZ17920.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis bv. 2 str. 63/9]
 gi|264661015|gb|EEZ31276.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|297175634|gb|EFH34981.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella abortus bv. 5 str. B3196]
 gi|326409172|gb|ADZ66237.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis M28]
 gi|326538882|gb|ADZ87097.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella melitensis M5-90]
          Length = 351

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPSGIAVLVSRHPHRDFSAVGRMLFPASVRPESWLGETGISPAAFI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|260566313|ref|ZP_05836783.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 4 str. 40]
 gi|260155831|gb|EEW90911.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella suis bv. 4 str. 40]
          Length = 351

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPSGIAVLVSRHPHRDFSAVGRMLFPASVRPESWLRETGISPAAFI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQNCQIGRNNYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|323137313|ref|ZP_08072391.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylocystis sp. ATCC 49242]
 gi|322397300|gb|EFX99823.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylocystis sp. ATCC 49242]
          Length = 349

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 203/315 (64%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           D++    ++  ++P+  A  GD+ +  S ++   +  C+A+A    +  +P +P+ +  L
Sbjct: 30  DQSPASTVVTGVAPLEAARAGDLCFFDSSRYAEALSCCRATACFLRERHLPLLPEGVIGL 89

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
           + ++P  +   A ++L+PQA+   +     G+SP A +  + ++E GV + P A + P  
Sbjct: 90  VVEQPYRAMTRATALLFPQALRPGSLFAASGVSPGAVVHPEARLEPGVTVDPGAFIGPRA 149

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGV 207
           EIG  T +GP +V+G  VRIGR+CSIGA +S+  +L+GN VI+H G R+G DGFG+A   
Sbjct: 150 EIGSGTTIGPHAVVGPDVRIGRDCSIGAHASLICALVGNRVIIHPGARLGQDGFGFAPTQ 209

Query: 208 SDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
               K   +GRVI+QD VEIGAN+ IDRG   DTIIGE TKIDN VQIGHNV IG  C I
Sbjct: 210 KGYLKTPQLGRVIVQDDVEIGANTTIDRGATRDTIIGEGTKIDNLVQIGHNVVIGRFCAI 269

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGS  IGD V +GGQ  IAG+L IG+   IA+KSGV++D+P G ++GG PARP+
Sbjct: 270 VAQTGIAGSCEIGDFVALGGQSAIAGHLTIGEGAAIAAKSGVMRDVPPGARFGGSPARPL 329

Query: 328 GEYLRHMVMLSKPSK 342
             +LR   ML K ++
Sbjct: 330 RRHLRAEAMLDKMAR 344


>gi|306841877|ref|ZP_07474557.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Brucella
           sp. BO2]
 gi|306288007|gb|EFM59409.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Brucella
           sp. BO2]
          Length = 351

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPSGIAVLVSRHPHRDFSAVGRMLFPASVRPESWLGETGISPAAFI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGRGVTIGAGTLIAATAVIGQNCQIGRNSYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|254719216|ref|ZP_05181027.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. 83/13]
 gi|265984211|ref|ZP_06096946.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. 83/13]
 gi|306837964|ref|ZP_07470822.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. NF 2653]
 gi|264662803|gb|EEZ33064.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. 83/13]
 gi|306406888|gb|EFM63109.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brucella sp. NF 2653]
          Length = 351

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 207/329 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GASL D     R +  L+ +  A  G + ++  +K ++++   
Sbjct: 6   FFKPSRELTIGDVADFTGASLRDPKLAPRSVERLASLKDAGEGALVFVEGKKNVSSLVGL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+ ++C++ +   +P  I  L+S  P   F+  G +L+P ++  E+   E GISP AF+
Sbjct: 66  KAAGVLCTESLADSVPPGIAVLVSRHPHRDFSAVGRMLFPASVRPESWLGETGISPAAFV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               +IEDG  +   AV+  GV IG  T +   +VIG   +IGRN  I  G S+  + IG
Sbjct: 126 HPTAQIEDGATVEAGAVIGSGVTIGAGTLIAATAVIGQDCQIGRNSYIAPGVSVQCAFIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG++DDT+IGE
Sbjct: 186 NNVSLHPGVRIGQDGFGYVPGAAGLDKVPQLGRVIIQDNVEIGANTTVDRGSLDDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C++ +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRFCLVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 306 ASGVMNDIPDGERWGGIPARPIKQWFRDI 334


>gi|304391654|ref|ZP_07373596.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Ahrensia sp. R2A130]
 gi|303295883|gb|EFL90241.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Ahrensia sp. R2A130]
          Length = 352

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 219/338 (64%), Gaps = 1/338 (0%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEK 64
           +FF S   I++  LA+  G+ L D+++    + S+SPI  A+ G ++++ + K+++ +  
Sbjct: 3   DFFRSEGPISVGDLAKLTGSQLADDDYKSVEVISVSPIEAAAEGSLTFLSNPKYVDALAH 62

Query: 65  CKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAF 124
             ASA+ICS+     +P+ +  L+SD+P  SFA A + ++P A     S    GIS  A 
Sbjct: 63  TGASAVICSERYRSGVPEGVAVLVSDQPYKSFARAMAAMFPSAAR-PTSILCDGISTAAG 121

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI 184
           + E   +E+GV +   AV+   V +G  T +GP ++IG  V IGRNC+I AG+S+ ++ +
Sbjct: 122 IHETAILEEGVTVEHGAVIGANVCVGSNTLIGPNAIIGPNVMIGRNCAIAAGASVIAAHL 181

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G++VILHSGVR+G DGFG+A G     K+   G VIIQ+ VEIG+NS +DRG   DT+IG
Sbjct: 182 GDNVILHSGVRVGGDGFGFAMGPGGHLKVPQTGGVIIQNDVEIGSNSCVDRGANRDTVIG 241

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
           E TKIDN V I HNV IG  C+IV Q GIAGS  +GD V++GGQC I G++ IGD  QIA
Sbjct: 242 EGTKIDNLVMIAHNVIIGRHCVIVGQTGIAGSARLGDYVVLGGQCAINGHVSIGDGAQIA 301

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
             SGV  D+PAG Q+GG+PARPI  ++R +  L + ++
Sbjct: 302 GLSGVSGDVPAGVQWGGVPARPIRHWMRDIGRLRREAQ 339


>gi|319404364|emb|CBI77964.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 348

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 208/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  + +  GA LL+  F   +I +LS +  A  G + +I +RKF +
Sbjct: 1   MADTFFFTPSRRLTVADVVKLTGAKLLNPEFSNTVINTLSSVESAGEGSLVFIENRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ DIV  +P+ I  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 61  ALLGSSAVAVFCTSDIVFKVPETIAVLVTSTPQRDFAQVGRILFPASVRPTPWFGQKEIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +    K+E+ V +   AV+   VEIG  T +   +VIG   RIGR+C I    ++ 
Sbjct: 121 LHAHIHPSAKLENDVCVEAGAVIGRNVEIGSGTLISSTAVIGENCRIGRDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V ++ GV IG DGFGY R    + KI H+GRVIIQD VEIGAN+ IDRGT DD
Sbjct: 181 YSLIGDRVYIYPGVCIGQDGFGYVRSAIGVEKIPHLGRVIIQDGVEIGANTTIDRGTFDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  GIA ++ IG+ 
Sbjct: 241 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGSVGIADHITIGEC 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRSIGKVKREK 347


>gi|158423326|ref|YP_001524618.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Azorhizobium caulinodans ORS 571]
 gi|172047943|sp|A8I485|LPXD_AZOC5 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|158330215|dbj|BAF87700.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Azorhizobium caulinodans ORS 571]
          Length = 357

 Score =  276 bits (705), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 145/347 (41%), Positives = 211/347 (60%), Gaps = 1/347 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFL 59
           M    FF     + L ++A   GA L      + + +  +  +A A   +++++   ++L
Sbjct: 1   MSEPAFFPLPTPLTLDEVAALSGARLARPGAQDALRLTGVGTLADAGPSELAFLDQSRYL 60

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
             +   +A AII S+     +P+ I  L+S +P  +F      L+PQA+  +      GI
Sbjct: 61  ATLGTARAGAIITSEKFAGEVPEAIAVLVSPRPASAFVAVTRQLFPQALRPQPVFGHTGI 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P AF+     +E GV + P AV+ PG E+G  + +   +V+GAGVRIGR+ +IGAG S+
Sbjct: 121 APGAFIHPTASLEAGVTVDPGAVIGPGAEVGAGSVICANAVVGAGVRIGRDSTIGAGVSL 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +L+GN VI+H+G RIG DGFGY  G     K+  IGRV++QD VE+GA S IDRG + 
Sbjct: 181 SHALVGNRVIVHAGARIGQDGFGYQPGPGGHLKVPQIGRVVLQDDVEVGAGSTIDRGALR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQI HNV IG  CIIVSQ GI+GST +GD V++GGQ G+ G+  IGD
Sbjct: 241 DTVIGEGTKIDNLVQIAHNVVIGRHCIIVSQTGISGSTTLGDFVMLGGQVGVVGHCTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
             QIA+ S V  D+P G ++GG PA+P+ E+ R M  L K ++ + +
Sbjct: 301 GAQIAASSNVKGDVPPGVRWGGSPAKPVREWFREMTTLKKLAESRAR 347


>gi|319405836|emb|CBI79468.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bartonella sp. AR 15-3]
          Length = 348

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 208/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  L +  GA LL+  F   +I +LS +  A  G + +I ++K  +
Sbjct: 1   MADTFFFTPSRRLTVADLVKLTGAKLLNPEFSNTVINTLSSVESAREGSLVFIENQKLSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ DI   +P+ I  L++  P+  FA  G +L+P ++       + GIS
Sbjct: 61  ALLGSSAVAVFCTSDIAFKVPETIAILVTSTPQRDFAQVGRVLFPASVRPIPWFGQKGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+ + V +   AV+   VE+G  T +   +VIG   RIGR+C I    ++ 
Sbjct: 121 PHAHIHSSAKLGNDVCVEAGAVIAKNVEVGSGTLISSTAVIGENCRIGRDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V ++ GV IG DGFGY +    + KI H+GRVIIQD VEIGAN+ IDRGT DD
Sbjct: 181 YSLIGDRVYIYPGVCIGQDGFGYVKSAVGVEKIPHLGRVIIQDGVEIGANTTIDRGTFDD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST+IGD   +GG  GIA ++ IG+ 
Sbjct: 241 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTFIGDMSQLGGSVGIADHITIGEC 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRSIGKVKREK 347


>gi|163868108|ref|YP_001609312.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella tribocorum CIP 105476]
 gi|189028511|sp|A9ISM1|LPXD_BART1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|161017759|emb|CAK01317.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella tribocorum CIP 105476]
          Length = 348

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 148/347 (42%), Positives = 208/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  +A+  GA LL+  F  ++I +LS +  A  G + ++  RKF +
Sbjct: 1   MADTFFFTPSRQLTVANVAELTGAKLLNPEFSHKVINTLSSLENAVEGSLVFVEHRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            ++   A A+ C+ +IV  +P  +  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 61  ALQGSSAVAVFCTNEIVFKVPDTMAVLVTSTPQRDFAQIGRILFPDSVKPMPWFGQKEIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K    V I   AV+   VEIG  T +   +VIG   RIGR+C I    ++ 
Sbjct: 121 PHAHIHPTAKFAHDVCIEAGAVIGRNVEIGAGTLISSTAVIGENCRIGRDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG++V L+ GV IG DGFGY  G+S I KI  +GRVII+D VEIGAN+ IDRGT  D
Sbjct: 181 CSLIGDTVQLYPGVCIGQDGFGYVGGISGIEKIPQLGRVIIEDGVEIGANTTIDRGTFQD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  G+A ++ IG  
Sbjct: 241 TVIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGGVGVADHIVIGKC 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA++SGV+ DIP G+++GG PARP  ++ R +  L    K K +R
Sbjct: 301 VQIAARSGVMNDIPDGEKWGGSPARPFKQWFREVATLRSMGKVKKER 347


>gi|239832040|ref|ZP_04680369.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Ochrobactrum intermedium LMG 3301]
 gi|239824307|gb|EEQ95875.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Ochrobactrum intermedium LMG 3301]
          Length = 352

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 137/329 (41%), Positives = 202/329 (61%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GA L D     R +  LS +  A+ G + ++  +K  + +   
Sbjct: 7   FFAPSRELTIGDIADFTGARLRDAKLAPRSVARLSSLKDATEGSLVFVEGKKNADGLSSI 66

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
            A+ ++C++ +   +P +I  L++  P+  FA  G +L+P ++   +   E GIS  A +
Sbjct: 67  SAAGVLCTEAVADIVPSHIAALVTRNPQRDFASVGRMLFPASVRPVSWFGETGISSAAII 126

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                IEDG  I   AV+  GV +G  T V   +VIG G +IGRN  I  G ++  + IG
Sbjct: 127 HPTAHIEDGATIEAGAVIGKGVTVGSGTLVASTAVIGEGSQIGRNSYIAPGVTVQCAFIG 186

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ +DRG+++DT+IGE
Sbjct: 187 NQVALHPGVRIGQDGFGYVPGPAGLEKVPQLGRVIIQDNVEIGANTTVDRGSLNDTVIGE 246

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TK+DN VQI HNV IG  CII +  GI+GS  IGD  ++GG+ G+A +L IG  VQ+A+
Sbjct: 247 GTKVDNLVQIAHNVRIGRFCIIAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQVAA 306

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 307 ASGVMNDIPDGERWGGIPARPIKQWFRDI 335


>gi|121601880|ref|YP_988898.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella bacilliformis KC583]
 gi|120614057|gb|ABM44658.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella bacilliformis KC583]
          Length = 349

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 150/347 (43%), Positives = 208/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF+  + + +  + +  GA L D  F   +I +LS +  A  G + ++ ++KF +
Sbjct: 2   MADTFFFMPSRRLTVADIVELTGAKLRDPKFSNIVIKTLSSVENAREGSLVFLENQKFSD 61

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           ++    A+A+ C  D+V  IP++I  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 62  SLLGSFAAAVFCRSDVVVKIPESIAALVTQTPQRDFAQIGRILFPDSVKPMPWFGQKEIS 121

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    KIE  V I   A++   VEIG  T V   +VIG   RIGR C I    +I 
Sbjct: 122 PHAHIHPSAKIEHDVCIEAGAIIGKNVEIGAGTLVSSTAVIGENCRIGRECYIAPRVTIQ 181

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V LH GV IG DGFGY  G   I KI  +GRVIIQD VEIGAN+ +DRGT +D
Sbjct: 182 YSLIGDKVRLHPGVCIGQDGFGYVSGAFGIEKIPQLGRVIIQDGVEIGANTTVDRGTFED 241

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  G+  ++ IG+ 
Sbjct: 242 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSRLGGSVGVVDHVTIGEG 301

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PA+P  ++ R MV L    + K ++
Sbjct: 302 VQIAAGSGVMSDIPDGEKWGGSPAQPFKKWFREMVALRNIGQVKREK 348


>gi|119371944|sp|Q11IJ0|LPXD_MESSB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
          Length = 350

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 208/337 (61%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   +   + ++A   GA L D +  +  I  L+P A      + +I  R+  +
Sbjct: 1   MTEPAFFAPARRFEVGEIAALTGARLRDASQEKITISRLAPAAEGGEETLVFIDGRRHAS 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            I   +A+A++CS+++    P  +  L+S KP+ +FA+   +L+P+A   +  + E G+S
Sbjct: 61  RIGSVRAAALLCSEELAENAPDGVAVLVSPKPQQAFAMVARLLFPEANRPQPVTGETGVS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P+A + E   +EDG +I   AV+  G  +GR T VGP +VIGA   IGR+  +G    + 
Sbjct: 121 PRAVIAEGAVVEDGAIIEAGAVIGVGASVGRGTIVGPNTVIGARCSIGRDGYVGPNVMLQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            ++IG+ VI+H G +IG DGFG+  G +   K   IGRVIIQD VEIGAN+ IDRG + D
Sbjct: 181 YAVIGDRVIIHPGAQIGQDGFGFLPGPNGFEKNPQIGRVIIQDDVEIGANTTIDRGALSD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE TKIDN VQIGHNVHIG  C+I    G++GS  +GD V++GGQ GIA ++ IG+ 
Sbjct: 241 TIIGEGTKIDNLVQIGHNVHIGRRCVIAGLCGLSGSVKLGDYVMLGGQVGIADHITIGNR 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
            Q+A+ SGV+ D+P G+++ G+PA+P+ +  R +  L
Sbjct: 301 AQLAASSGVMDDVPEGERWAGVPAKPMRQAFREIAAL 337


>gi|110633742|ref|YP_673950.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Mesorhizobium sp. BNC1]
 gi|110284726|gb|ABG62785.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chelativorans sp. BNC1]
          Length = 365

 Score =  272 bits (695), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 208/337 (61%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   +   + ++A   GA L D +  +  I  L+P A      + +I  R+  +
Sbjct: 16  MTEPAFFAPARRFEVGEIAALTGARLRDASQEKITISRLAPAAEGGEETLVFIDGRRHAS 75

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            I   +A+A++CS+++    P  +  L+S KP+ +FA+   +L+P+A   +  + E G+S
Sbjct: 76  RIGSVRAAALLCSEELAENAPDGVAVLVSPKPQQAFAMVARLLFPEANRPQPVTGETGVS 135

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P+A + E   +EDG +I   AV+  G  +GR T VGP +VIGA   IGR+  +G    + 
Sbjct: 136 PRAVIAEGAVVEDGAIIEAGAVIGVGASVGRGTIVGPNTVIGARCSIGRDGYVGPNVMLQ 195

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            ++IG+ VI+H G +IG DGFG+  G +   K   IGRVIIQD VEIGAN+ IDRG + D
Sbjct: 196 YAVIGDRVIIHPGAQIGQDGFGFLPGPNGFEKNPQIGRVIIQDDVEIGANTTIDRGALSD 255

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE TKIDN VQIGHNVHIG  C+I    G++GS  +GD V++GGQ GIA ++ IG+ 
Sbjct: 256 TIIGEGTKIDNLVQIGHNVHIGRRCVIAGLCGLSGSVKLGDYVMLGGQVGIADHITIGNR 315

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
            Q+A+ SGV+ D+P G+++ G+PA+P+ +  R +  L
Sbjct: 316 AQLAASSGVMDDVPEGERWAGVPAKPMRQAFREIAAL 352


>gi|296446137|ref|ZP_06888085.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylosinus trichosporium OB3b]
 gi|296256331|gb|EFH03410.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylosinus trichosporium OB3b]
          Length = 350

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 212/339 (62%), Gaps = 3/339 (0%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIE 63
           FF   + ++L + A+ IG + L     E   +I  ++ + RA  GD+S+    ++   + 
Sbjct: 6   FFRLDRPLSLAEAAE-IGGARLAAPVAEEGVVIIGVAALDRAHAGDLSFYDRPRYAAGLR 64

Query: 64  KCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQA 123
            C+A+A +     +P +P  +  L++  P  + A   + L+P+A+  ++     G+SP A
Sbjct: 65  LCRATACLLRARDLPALPPGVAALIASDPHAAMARIMAALFPEALRPQSLFASSGVSPGA 124

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL 183
            +    ++E GV++ P AV+ P  EIG  + +GP +VIG  VRIGR CSIGAG+S+  +L
Sbjct: 125 VVHPSARLEPGVIVDPGAVIGPRAEIGAGSVIGPQAVIGPDVRIGRGCSIGAGASLLCAL 184

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG+ VI+H G R+G DGFG+        K   IGRVI+QD VEIGAN+ IDRG   DTII
Sbjct: 185 IGDRVIIHPGARLGQDGFGFVLSRQGHVKSPQIGRVIVQDDVEIGANTTIDRGATRDTII 244

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           GE TKIDN VQIGHNV IG GC+IV+Q G+AGS  IGD V +GGQ  I G+L IG+  +I
Sbjct: 245 GEGTKIDNLVQIGHNVVIGRGCVIVAQSGLAGSCEIGDFVALGGQSAIGGHLTIGEGARI 304

Query: 304 ASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           A+KSGV +D P+  +  G+PARP+  +LR  ++L + ++
Sbjct: 305 AAKSGVTRDAPSMARLSGVPARPVRRHLRGELLLDRLAR 343


>gi|153009367|ref|YP_001370582.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561255|gb|ABS14753.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 352

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 138/329 (41%), Positives = 201/329 (61%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + + +  +A   GA L D     R +  LS +  A  G + ++  +K  + +   
Sbjct: 7   FFAPSRKLTIGDIADFTGARLRDPKLAPRSVARLSSLKDAIEGSLVFVEGKKNADGLSSI 66

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
            A+ ++CS+ +V  +P +I  L++  P+  FA  G +L+P ++   +   E G+S  A +
Sbjct: 67  NAAGVLCSEAVVDSVPSHIAALVTRNPQRDFASVGRMLFPASVKPVSWFGETGVSSAAII 126

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                IEDG  I   AV+   V +G  T +   +VIG G +IGRN  I  G ++  + IG
Sbjct: 127 HPTAHIEDGATIEAGAVIGKDVSVGSGTLIASTAVIGEGSQIGRNSYIAPGVTVQCAFIG 186

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N V LH GVRIG DGFGY  G + + K+  +GRVIIQD VEIGAN+ IDRG+++DT+IGE
Sbjct: 187 NQVSLHPGVRIGQDGFGYVPGPAGLEKVPQLGRVIIQDNVEIGANTTIDRGSLNDTVIGE 246

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  CI+ +  GI+GS  IGD  ++GG+ G+A +L IG  VQIA+
Sbjct: 247 GTKIDNLVQIAHNVRIGRFCIVAAHCGISGSCVIGDQTMLGGRVGLADHLIIGSRVQIAA 306

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
            SGV+ DIP G+++GG+PARPI ++ R +
Sbjct: 307 ASGVMNDIPDGERWGGIPARPIKQWFRDI 335


>gi|154248350|ref|YP_001419308.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Xanthobacter autotrophicus Py2]
 gi|154162435|gb|ABS69651.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Xanthobacter autotrophicus Py2]
          Length = 365

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 205/348 (58%), Gaps = 6/348 (1%)

Query: 6   FFVSHKGIALMKLAQSIGASLL--DE----NFGERMIYSLSPIARASTGDISYIISRKFL 59
           FF     + L ++A   GA L   DE      G R I  +  +  A   ++++  + +F 
Sbjct: 6   FFPLPAPLTLAEVAALSGARLAVADEAQAAELGARTITGVGTLETAGPDELAFCDTVQFA 65

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
             +   +A A+I ++      P  +  L++ +P  +F      L+P A+   +   + G+
Sbjct: 66  EKLGTVRAGAVITAERFAAKAPPGLVVLIAPRPAAAFLAVTRFLFPGALKPLSIFGQDGV 125

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A +    ++EDGV + P AV+ PG EIG  T V  G++IG  VRIGRNC+IG G+S+
Sbjct: 126 APGAQVHPKARLEDGVTVDPGAVIGPGAEIGAGTIVCAGAIIGPNVRIGRNCAIGPGASV 185

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             + +GN VI+H G RIG+DGFGY        K+  IGRV+IQD VEIGAN+ IDRG + 
Sbjct: 186 IHAFLGNGVIIHGGARIGSDGFGYQPSPRGHVKVPQIGRVVIQDDVEIGANTTIDRGALT 245

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN VQI HNV  G  CI+VSQ GI+GST +GD V++GGQ G+ G+  IG 
Sbjct: 246 DTVIGEGTKIDNLVQIAHNVVTGRHCIVVSQTGISGSTTLGDFVMLGGQVGVVGHATIGT 305

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
             QIA+ S V  D+P G ++GG PA+P+ E+ R +  L + +    +R
Sbjct: 306 GAQIAASSNVKGDVPPGVRWGGSPAKPVREWFREVTTLKRLAAASARR 353


>gi|192291631|ref|YP_001992236.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris TIE-1]
 gi|226740741|sp|B3Q7J5|LPXD_RHOPT RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|192285380|gb|ACF01761.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 360

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 203/339 (59%), Gaps = 1/339 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M   +FF       L ++A    A+L+D ++ E  I  L+ +  A    +S+  + ++ +
Sbjct: 1   MASTSFFPPRPSSTLAEIASLTKATLVDASYAEHRITGLASLDEAGPMHLSFFENLRYSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   +A A + S+     +P ++  L + +P  +F      LY  A+         GI+
Sbjct: 61  ELANTRAGACLVSERFEGRVPSHVAVLRARRPFHAFVAYARHLYSDALRPHTGIGAPGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A + E  K+ED V + P+AV+ P VEIG  T +G G+VI AGV+IGR+C IGAGS + 
Sbjct: 121 PTAVIHETAKLEDEVTVEPLAVIGPDVEIGSGTVIGAGAVIAAGVKIGRDCDIGAGSHLQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +LIGN+V++H G  IG DGFG+        K+   GRVIIQ  VE+GA + IDRG++ D
Sbjct: 181 HALIGNNVLMHPGCHIGQDGFGFIFAGQHT-KVPQTGRVIIQHDVELGAGTTIDRGSLRD 239

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C+I ++ G+AGS  +GDNV +G   GI  ++ IGD 
Sbjct: 240 TVIGEGTKIDNQVQIGHNVTIGRHCVIAAKCGLAGSLTLGDNVALGAMVGINNHVMIGDG 299

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            Q+A+ SGV   IPAG+++GG+ ARP   + R M+ + +
Sbjct: 300 AQVAAMSGVKDSIPAGERWGGIFARPTRTWFREMLAVRR 338


>gi|39935978|ref|NP_948254.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris CGA009]
 gi|60390028|sp|Q6N5Q9|LPXD_RHOPA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|39649832|emb|CAE28354.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine n-acyltransferase
           [Rhodopseudomonas palustris CGA009]
          Length = 360

 Score =  262 bits (670), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 203/339 (59%), Gaps = 1/339 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M   +FF       L ++A    A+L+D ++ E  I  L+ +  A    +S+  + ++ +
Sbjct: 1   MASTSFFPPRPSSTLAEIASLTKATLVDASYAEHRITGLASLDEAGPMHLSFFENLRYSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   +A A + S+     +P ++  L + +P  +F      LY  A+         GI+
Sbjct: 61  ELANTRAGACLVSERFEGRVPSHVAVLRARRPFHAFVAYARHLYSDALRPHTGVGAPGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A + E  K+ED V + P+AV+ P VEIG  T +G G+VI AGV+IGR+C IGAGS + 
Sbjct: 121 PTAVIHETAKLEDEVTVEPLAVIGPDVEIGSGTVIGAGAVIAAGVKIGRDCDIGAGSHLQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +LIGN+V++H G  IG DGFG+        K+   GRVIIQ  VE+GA + IDRG++ D
Sbjct: 181 HALIGNNVLMHPGCHIGQDGFGFIFAGQHT-KVPQTGRVIIQHDVELGAGTTIDRGSLRD 239

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C+I ++ G+AGS  +GDNV +G   GI  ++ IGD 
Sbjct: 240 TVIGEGTKIDNQVQIGHNVTIGRHCVIAAKCGLAGSLTLGDNVALGAMVGINNHVVIGDG 299

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            Q+A+ SGV   IPAG+++GG+ ARP   + R M+ + +
Sbjct: 300 AQVAAMSGVKDSIPAGERWGGIFARPTRTWFREMLAVRR 338


>gi|316933930|ref|YP_004108912.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315601644|gb|ADU44179.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 360

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 208/340 (61%), Gaps = 3/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M   +FF       L ++A    A+L+D +  E  I  L+ +  A    +++  + ++++
Sbjct: 1   MASTSFFPPRPSSTLAEIASLTKATLVDASQAEHRITGLASLDEAGPMHLTFFENLRYVD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           ++   +A A + S+     +P ++  L + +P  +F      LY  A+         GI+
Sbjct: 61  DLVATRAGACLVSERFEGRVPPHVAVLRARRPFHAFVEVARQLYVDALRPSTGLSGQGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A + +  K+ED V + P+AV+ P VEIG  T +G G+VI AGV+IGR+C IGAGS + 
Sbjct: 121 PTAVIDDTAKLEDEVTVEPLAVIGPDVEIGAGTVIGAGAVIAAGVKIGRDCDIGAGSHLQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+V++H G  IG DGFG+    + +H K+   GRVIIQ+ VE+GA + IDRG++ 
Sbjct: 181 HALIGNNVLMHPGCHIGQDGFGFI--FAGLHTKVPQTGRVIIQNDVELGAGTTIDRGSLR 238

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C+I ++ G+AGS  +GDNV +G   GI  ++ IGD
Sbjct: 239 DTVIGEGTKIDNQVQIGHNVTIGRHCVIAAKCGLAGSLTLGDNVALGAMVGINNHVLIGD 298

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+A+ SGV   IPAG+++GGM ARP   + R M+ + +
Sbjct: 299 GAQVAAMSGVKDSIPAGERWGGMFARPTRTWFREMLAVRR 338


>gi|240850311|ref|YP_002971704.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Bartonella grahamii as4aup]
 gi|240267434|gb|ACS51022.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Bartonella grahamii as4aup]
          Length = 348

 Score =  261 bits (668), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 142/347 (40%), Positives = 206/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  +A+  GA LL+  F  ++I +LS +  A  G + ++  RKF +
Sbjct: 1   MADTFFFTPSRQLTVANVAELTGAKLLNPEFSHKVINTLSSLESAVEGSLVFVEHRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ +IV  +P+ +  L++  P+  FA  G IL+P ++         GIS
Sbjct: 61  ALLDSSAVAVFCTNEIVFKVPETMAILVTSTPQRDFAQIGRILFPDSVKPMPWLGSKGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +    K+   V I   AV+   VEIG  T +   +VIG   RIG +C I    ++ 
Sbjct: 121 SHAHIHPTAKLAHDVCIEAGAVIGRNVEIGAGTLISSTAVIGENCRIGCDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            S+IG+ V L+ GV IG DGFGY  G+S I K+  +GRVII+D VE+GAN+ IDRGT  D
Sbjct: 181 CSIIGDKVQLYPGVCIGQDGFGYVGGISGIEKVPQLGRVIIEDGVEVGANTTIDRGTFQD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG+ +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  G+A ++ IG  
Sbjct: 241 TVIGKGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGGVGVADHIIIGKC 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA++SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAARSGVMNDIPDGEKWGGSPARPFKQWFREVATLRSMGKVKKEK 347


>gi|260459222|ref|ZP_05807477.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259034776|gb|EEW36032.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 351

 Score =  261 bits (668), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 131/339 (38%), Positives = 201/339 (59%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   +     ++A   G+ L+D    +  I +L+P +      + ++  ++    +   
Sbjct: 6   FFAPSRRYTAAEVANLTGSVLVDSGQSDVSISALAPASEGGANALVFVDGKRNSALMPSL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A+A++C  +     P  +  L+  +P+ +FA+ G +L+P A      + E GISP A +
Sbjct: 66  RAAAVLCPAEFANKAPDGVAVLIHPRPQQAFALVGRLLFPTAATPGPMTSETGISPHAHI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                +E G +I    V+ PGV IG  T + P +VIG   RIGR+  +G G+SI  +LIG
Sbjct: 126 DPTAHVEAGAIIEAGVVIGPGVSIGSGTVIAPNAVIGQSCRIGRDGYVGPGASIQYALIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+  G     ++  IGRV+IQD VEIG+NS +DRG + DTIIG+
Sbjct: 186 NRVIIHGGARIGQDGFGFVGGAKGPERVPQIGRVVIQDDVEIGSNSTVDRGAMSDTIIGQ 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  CI+    GI+GS  +GDNV +GG  G+A +L IG   ++A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRNCIVAGLSGISGSVVVGDNVTMGGGVGLADHLTIGTGAKLAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           +SG + ++PAG+ +GG PA+P+ E +R + ML   ++ +
Sbjct: 306 RSGFMSNVPAGEIWGGYPAQPMAEAMREIAMLRTMARAR 344


>gi|319783663|ref|YP_004143139.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169551|gb|ADV13089.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 352

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/339 (38%), Positives = 203/339 (59%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   +     ++A   G+ L+D       I +L+P +      + ++  ++    +   
Sbjct: 6   FFAPSRRYTAGEVANLTGSVLVDSGHSNISIEALAPASEGGENALVFVDGKRNSALMPSL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A+A++C  +     P ++  L+  +P+ +FA+ G +L+P+A      + E G+SP A +
Sbjct: 66  RAAAVLCPAEFAGKAPASVAVLIHPRPQQAFALIGRLLFPRAATPGPMTSETGVSPHAHV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                +E G VI   AV+ PG  IG  T + P +VIG   +IGR+  +G G+SI  +LIG
Sbjct: 126 DATAHVEAGAVIEAGAVIGPGASIGSGTVIAPNAVIGQSCQIGRDGYVGPGASIQYALIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+  G     ++  IGRV+IQD VEIG+N+ +DRG + DTIIG+
Sbjct: 186 NRVIIHGGARIGQDGFGFVGGAKGPERVPQIGRVVIQDDVEIGSNTTVDRGAMSDTIIGQ 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  CII    GI+GS  +GDNV +GG  G+A +L IG   ++A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRNCIIAGLSGISGSVVVGDNVTMGGGVGLADHLTIGTGAKLAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           +SG + ++PAG+ +GG PA+P+ E +R + ML K ++ +
Sbjct: 306 RSGFMSNVPAGEIWGGYPAQPMAEAMREIAMLRKLARTR 344


>gi|49474289|ref|YP_032331.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella quintana str. Toulouse]
 gi|60389985|sp|Q6G1J4|LPXD_BARQU RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|49239793|emb|CAF26183.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella quintana str. Toulouse]
          Length = 348

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/347 (41%), Positives = 205/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  +A+  GA LL+  F   +I +LS +  A  G + ++  RKF +
Sbjct: 1   MADTFFFTPSRRLTVANVAELTGAKLLNPEFSNIVISTLSSLEGAGEGSLVFVEHRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ +IV  +P+++  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 61  ALLGSSAVAVFCTNEIVFKVPESMAILVTSTPQRDFAQIGRILFPDSVKPMPWFGQREIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K    V I   AV+   VEIG  + +   +VIG   RIGR+C I    ++ 
Sbjct: 121 PYAHIHPSAKFGHDVCIEAGAVIGKNVEIGSGSLISSTAVIGENCRIGRDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V L+ G  IG DGFGY  G S I K+  +GRVII+D VEIGAN+ IDRGT +D
Sbjct: 181 YSLIGDRVYLYPGTCIGQDGFGYVGGASGIEKVPQLGRVIIKDGVEIGANTTIDRGTFED 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  G+A ++ IG  
Sbjct: 241 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGSVGVADHIVIGKC 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRNIGKVKKEK 347


>gi|49475417|ref|YP_033458.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella henselae str. Houston-1]
 gi|48474555|sp|Q8VQ23|LPXD_BARHE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|18252650|gb|AAL66375.1|AF461795_3 LpxD [Bartonella henselae]
 gi|49238223|emb|CAF27433.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bartonella henselae str. Houston-1]
          Length = 348

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/347 (41%), Positives = 205/347 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   + + +  +A+  GA LL+  F   +I +LS +  A  G + ++  RKF +
Sbjct: 1   MADTFFFTPSRRLTVANVAELTGAKLLNPEFSNTVINTLSSLESAGKGSLVFVEHRKFSD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A A+ C+ +IV  +P+++  L++  P+  FA  G IL+P ++       +  IS
Sbjct: 61  ALVGSSAVAVFCTNEIVFKVPESMAILVTSTPQRDFAQIGRILFPDSVKPMPWFGQREIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+   V I   AV+   VEIG  + +   +VIG   RIG +C I    ++ 
Sbjct: 121 PHAHIHPSAKLAGDVCIEAGAVIGRNVEIGSGSLIASTAVIGENCRIGCDCYIAPKVTVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V L+ G  IG DGFGY  G S I K+  +GRVII+D VEIGAN+ IDRGT +D
Sbjct: 181 YSLIGDKVHLYPGACIGQDGFGYIGGASGIEKVPQLGRVIIEDGVEIGANTTIDRGTFED 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           TIIGE +KIDN VQI HNV IG  C+I +Q GIAGST IGD   +GG  G+A ++ IG  
Sbjct: 241 TIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIGDMSQLGGSVGVADHIVIGKY 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           VQIA+ SGV+ DIP G+++GG PARP  ++ R +  L    K K ++
Sbjct: 301 VQIAAGSGVMNDIPDGEKWGGSPARPFKQWFREVAALRSIGKVKKEK 347


>gi|299134992|ref|ZP_07028183.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Afipia
           sp. 1NLS2]
 gi|298589969|gb|EFI50173.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Afipia
           sp. 1NLS2]
          Length = 362

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 136/339 (40%), Positives = 202/339 (59%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF   + + L  +A   GA L D +   + +   S + +A   D+++   RK+  
Sbjct: 1   MTQPGFFKQPEPMTLGDIAALTGAQLADPSRAGQTVSGTSTLDQAGPRDLAFFDKRKYGE 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            + +  A A + S  +   +P +I  L    P  +F     +LY   +   +S    GI+
Sbjct: 61  ELHRSHAGACLVSASLQADVPDHIAVLRVANPYTAFVEVARVLYADTLRPASSFGNEGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +  D  +EDGV++ P+AV+ P VEIG  T +G  +VIGAGV+IGRNCSIG G +I 
Sbjct: 121 ESAVVHPDALLEDGVIVDPLAVIGPDVEIGMGTVIGASTVIGAGVKIGRNCSIGPGVTIL 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
             LIGN VI+H G RIG DG+G+  G     K+   GRV+IQ+ VEIGA + +DRG + D
Sbjct: 181 HCLIGNDVIIHPGCRIGQDGYGFVSGPKGHKKVPQRGRVLIQNDVEIGAGTTVDRGALRD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDN VQIGHNV IG  CIIVSQ G+AGS+ +GD  ++G + G++ +  IG  
Sbjct: 241 TVIGEGTKIDNLVQIGHNVTIGRRCIIVSQSGVAGSSTLGDGAVLGARVGVSDHATIGAG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             +A++S V+ ++PA  ++GG PA+PI ++ R +  + K
Sbjct: 301 SMLAARSSVVGEVPANVKWGGSPAKPIKQFFRELFEVEK 339


>gi|328543720|ref|YP_004303829.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [polymorphum gilvum SL003B-26A1]
 gi|326413464|gb|ADZ70527.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Polymorphum gilvum SL003B-26A1]
          Length = 350

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 202/314 (64%), Gaps = 16/314 (5%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I  ++P+  A  G + +  + K+L+ + + +A+A + +Q  +  +P+ +  L+   P  S
Sbjct: 35  IAGVAPLEDARAGMLVFFDNVKYLDRLAETQAAACLVAQRHLTKVPEGVAALVCKDPYRS 94

Query: 96  FAIAGSILYPQAM---------HMEASSFEGGI-SPQAFLGEDVKIEDGVVIAPMAVVYP 145
           +A+  + LYP A+         H +A   E  +  PQA L      EDGVV+ P AV+  
Sbjct: 95  WALVLARLYPDALRPAPVYGPIHGDARVSERAVVHPQAVL------EDGVVVEPGAVIGA 148

Query: 146 GVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYAR 205
           G EIG  T +G  +VIG  VRIGR+C++GA +++  +LIGN VILH GV IG DGFGY+ 
Sbjct: 149 GAEIGAGTVIGANAVIGQSVRIGRDCAVGANATVQHALIGNRVILHPGVAIGQDGFGYSM 208

Query: 206 GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
           G     K+  +GRVIIQD VEIGAN+ +DRG   DT+IGE TKIDNQVQ+GHNV IG  C
Sbjct: 209 GAGGHVKVPQVGRVIIQDDVEIGANTTVDRGANRDTVIGEGTKIDNQVQVGHNVIIGRHC 268

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR 325
           +IVSQVG++GS  +GD V IGGQ G+AG+++IG   QIA+ S V   +PAG +YGG+PA+
Sbjct: 269 VIVSQVGLSGSCTLGDYVAIGGQTGVAGHVEIGMGAQIAAVSVVNDTVPAGGRYGGVPAK 328

Query: 326 PIGEYLRHMVMLSK 339
           P+ ++ R +  L K
Sbjct: 329 PVKQWFREVTALKK 342


>gi|254469848|ref|ZP_05083253.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pseudovibrio sp. JE062]
 gi|211961683|gb|EEA96878.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pseudovibrio sp. JE062]
          Length = 345

 Score =  259 bits (661), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/342 (40%), Positives = 217/342 (63%), Gaps = 1/342 (0%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   + I + ++A+  GA ++  +  E  I  ++P+     G + +I + K+L+ +E  
Sbjct: 5   FFPEAQTITVKQVAEWAGAEIVRGDR-ELTISGVAPLDEGVPGTLVFIDNPKYLDQLEDT 63

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KA+A + S+  +  +P+ +  LLS +P  S A   + LYP AM   + + E  ISP+A++
Sbjct: 64  KATACLVSKKHLDKVPEGVVPLLSKEPYRSLAKVLAELYPDAMRPLSVTRETSISPRAYV 123

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
            E  K+ +GVV+   AV+  GV IG  + +GP +VI A  ++G NCSIGA +S+   ++G
Sbjct: 124 EESAKLGEGVVVEAGAVIGAGVVIGAGSRIGPNAVIAANCQLGENCSIGASASLQHCVLG 183

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           + VI+H  V +G DGFG+A G     K+  +GRV++ + VEIGA S IDRG   DT +G+
Sbjct: 184 DRVIIHPNVSLGQDGFGFAMGPGGHIKVPQLGRVVLGNDVEIGAGSCIDRGANRDTTVGD 243

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDNQVQ+GHNV+IG  C+IVSQVGI+GS+ + D V++GGQ G++G+++IG   Q+A 
Sbjct: 244 GTKIDNQVQVGHNVNIGKHCVIVSQVGISGSSTLEDYVVLGGQSGVSGHVRIGMGAQVAG 303

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
            S V  D+  G +YGG+PARPI E+ + M +L + +    K+
Sbjct: 304 VSAVHDDLAPGGRYGGVPARPIREWFKEMTVLRRLTSQSGKK 345


>gi|312114742|ref|YP_004012338.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311219871|gb|ADP71239.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 350

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 144/346 (41%), Positives = 207/346 (59%), Gaps = 8/346 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDE--NFGERMIYSLSPIARASTGDISYIISRKF 58
           M    F+       L  L     A++ +   + G R + ++  +  A   D+S+  +RK+
Sbjct: 1   MDHPGFWAPAGPHTLFDLVAHADATIPEAFLSLGGRKMVAIRTLDEAGPDDVSFFDNRKY 60

Query: 59  LNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG 118
           L  ++  +A A+  SQ     +P+    L++  P  +FA A  + +P A   + +    G
Sbjct: 61  LAALKVTRAGAVFVSQASATQLPETSVPLVARDPYRAFARALELFFPDAGTPKVAP---G 117

Query: 119 ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSS 178
            SP   + E  +IEDGV+I P AV+  G  IGR T +  G+VIG  V IGR+  IG G+S
Sbjct: 118 TSP---VDETAQIEDGVIIEPGAVIGAGASIGRGTRIAAGAVIGYRVAIGRDGFIGPGAS 174

Query: 179 IYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTI 238
           I  +LIGN VI+H+G R+G DGFG+A G    +K+  +GRVIIQD VEIGANS IDRG +
Sbjct: 175 ITHALIGNRVIIHAGARVGQDGFGFAMGPGGHYKVRQVGRVIIQDDVEIGANSTIDRGAL 234

Query: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIG 298
            DTIIGE TKIDN VQI HNV IG  C+I +  GI+GST + D V +GGQCG  G+++IG
Sbjct: 235 KDTIIGEGTKIDNLVQIAHNVVIGRHCVIAALTGISGSTVLEDYVAMGGQCGTVGHIRIG 294

Query: 299 DNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
              QI ++SGV   IP G+++GG PA+P+  + R + +L + +K K
Sbjct: 295 AGAQIGAQSGVSSSIPRGERWGGTPAKPMAAWAREVALLKRLAKRK 340


>gi|300023420|ref|YP_003756031.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525241|gb|ADJ23710.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 353

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 146/340 (42%), Positives = 204/340 (60%), Gaps = 7/340 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M+   FF       L ++AQ+ GA +         I  + P+A AS   IS+I ++K+L 
Sbjct: 1   MEHPGFFERAGPYTLFEVAQAAGAEVPAGADPAMPIEDVRPLAEASRAHISFIDNKKYLA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGI 119
            ++  +A A + +  +   IP     L++ +P   FA A ++ YP AM  M A+     +
Sbjct: 61  QLDGTQAGACLVAPPLAGRIPAGTVGLVTRQPYHGFARALALFYPSAMQPMVATPGAQPV 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
            P A      +IEDGVVI P AV+     IG  T +  G+V+GA V IGRNC IGA +++
Sbjct: 121 DPTA------RIEDGVVIEPGAVIGREAHIGAGTRIAAGAVVGARVTIGRNCYIGALATV 174

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +L+G+ VI+HSGVRIG DGFG+A G     K+  IGRVI+QD VEIGAN+ IDRG + 
Sbjct: 175 THALVGDRVIIHSGVRIGQDGFGFAMGPGGHLKVPQIGRVIVQDDVEIGANTTIDRGALK 234

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDN  QIGHNV +G  C+IV+  GI+GST +GD V++GGQ G  G++KIG 
Sbjct: 235 DTMIGEGTKIDNLCQIGHNVVLGRHCVIVAMCGISGSTELGDYVVMGGQSGTVGHIKIGT 294

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+   S    D+PAG +Y G PA+P+ E  R   +L +
Sbjct: 295 GAQVGGASHPAHDVPAGARYFGTPAKPLRESAREQALLKR 334


>gi|13470834|ref|NP_102403.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Mesorhizobium loti MAFF303099]
 gi|20138695|sp|Q98MC4|LPXD_RHILO RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|14021577|dbj|BAB48189.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine n-acyltransferase
           [Mesorhizobium loti MAFF303099]
          Length = 351

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 201/339 (59%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF   +     ++A   G+ L+D    +  I +L+P +      + ++  R+    +   
Sbjct: 6   FFAPSRRYTAAEVANLTGSVLVDSGQSDVSIEALAPASEGGANALVFVDGRRNSALMPSL 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A+A++C  +     P ++  L+  +P+ +FA+ G +L+P A      + E G+S  A +
Sbjct: 66  RAAAVLCPAEFANKAPSSVAVLIHPRPQQAFALVGRLLFPTAATPGPMTSETGVSAHAHI 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                +E G +I    V+ PGV IG  T + P +VIG   +IGR+  +G G+SI  +LIG
Sbjct: 126 DPTAHVEAGAIIEAGVVIGPGVSIGSGTVIAPNAVIGQSCQIGRDGYVGPGASIQYALIG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+  G     ++  IGRV+IQD VEIG+NS +DRG + DTIIG+
Sbjct: 186 NRVIIHGGARIGQDGFGFVGGAKGPERVPQIGRVVIQDDVEIGSNSTVDRGAMSDTIIGQ 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  CI+    GI+GS  +GDNV +GG  G+A +L IG   ++A+
Sbjct: 246 GTKIDNLVQIAHNVRIGRNCIVAGLSGISGSVVVGDNVTMGGGVGLADHLTIGSGAKLAA 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           +SG + ++PAG+ +GG PA+P+ E +R + ML   ++ +
Sbjct: 306 RSGFMSNVPAGEIWGGYPAQPMAEAMREIAMLRTMARAR 344


>gi|92117250|ref|YP_576979.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter hamburgensis X14]
 gi|119371947|sp|Q1QMM8|LPXD_NITHX RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|91800144|gb|ABE62519.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter hamburgensis X14]
          Length = 361

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 208/343 (60%), Gaps = 1/343 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF     + L+++A S GA L+D + GE+ I  L+ + +A    +++  + K+  
Sbjct: 1   MTQPAFFKQPPPLTLVEIAASTGAQLIDASRGEQRITGLASLDQAGPMHLTFFDNHKYAA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   +A A   S      +P ++  L S  P  +F       +   +  ++      I+
Sbjct: 61  QLAATRAGACFVSPRFEASVPGHVAVLRSAAPFRAFVRIARDCHADTLRPQSWFDNATIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +     +ED VV+ P+AV+ PGVEIG  + +G G+VIG GVRIGRNC++GAG++I 
Sbjct: 121 ASAVVHPSAHLEDAVVVDPLAVIGPGVEIGTGSVIGSGAVIGPGVRIGRNCNVGAGTTIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+V++H G  IG DG+G+    S+ H K+   GRV+IQ+ VEIGA + IDRG++ 
Sbjct: 181 VALIGNNVLIHPGCHIGQDGYGFIFFGSEGHVKVPQTGRVLIQNDVEIGAGTTIDRGSLR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C++ +Q+G+AGS  IGDNV +G + GI  +L IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVTIGRRCLLAAQIGLAGSLTIGDNVALGAKVGINNHLHIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
             Q+ + SGV  DIP   ++GG  A+P  ++ R +  + + ++
Sbjct: 301 GAQVVAMSGVKDDIPPNGRWGGYFAKPTRQWYRELFAVERLAR 343


>gi|307942151|ref|ZP_07657502.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Roseibium sp. TrichSKD4]
 gi|307774437|gb|EFO33647.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Roseibium sp. TrichSKD4]
          Length = 346

 Score =  256 bits (653), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 140/336 (41%), Positives = 206/336 (61%), Gaps = 5/336 (1%)

Query: 6   FFVSHKGIALMKLAQSIGASLL--DENFGERMIYSLSPIARASTGDISYIISRKFLNNIE 63
           FF   + + L  +     A L   DEN     I  ++P+  A  G + +  +  +L+ + 
Sbjct: 6   FFEPPQSVLLKNIVCWADADLERGDENI---EILGVAPVEDAGEGTLVFFDNVVYLDQLS 62

Query: 64  KCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQA 123
           +  A+A + ++  V  +P N+  L+   P  S+A   + LYP AM     +    +SP+A
Sbjct: 63  QTTAAACLVAKKHVSKVPDNVAVLVCKDPYRSWAQVLAKLYPLAMSPVDIACPTDVSPRA 122

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL 183
            +    K+EDGV++   AV+   V +G  T +   +VIGAGV+IGR C IG  +++  SL
Sbjct: 123 SVDTSAKLEDGVIVEAGAVIGANVSVGAGTVIRANTVIGAGVQIGRGCVIGPNTTVQHSL 182

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           +G+ V LH GV +G DGFGYA G++   K+  +GRVIIQD VE+GAN+ IDRG   DT+I
Sbjct: 183 LGDRVFLHPGVCVGQDGFGYAMGLAGHFKVPQVGRVIIQDDVEVGANTTIDRGANRDTVI 242

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           GE TKIDNQVQIGHNV IG  C++VSQVG++GS  + D V IGGQ G+ G+++IG   Q+
Sbjct: 243 GEGTKIDNQVQIGHNVVIGRHCVLVSQVGLSGSCTLEDFVAIGGQSGVRGHVRIGAGAQV 302

Query: 304 ASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           A+ S V +D+PAG +YGG PA+P+ ++ R +  L K
Sbjct: 303 AAISSVNEDLPAGGRYGGTPAKPVKQWFREVAALRK 338


>gi|85716987|ref|ZP_01047950.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter sp. Nb-311A]
 gi|85696189|gb|EAQ34084.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter sp. Nb-311A]
          Length = 372

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 203/340 (59%), Gaps = 1/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF       L ++A S GA L+D + G   I  L+ + +A    +++  + K+  
Sbjct: 11  MTQPAFFKRPLPSTLAEIAASTGAQLVDASRGSLRITGLASLDQAGPMHLAFFDNHKYAE 70

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   KA A + S      +P ++  L S  P  +F       +   +  ++      ++
Sbjct: 71  QLAATKAGACLVSPRFEADVPGHVAVLRSKAPFRAFVSIARDFHADTLRPQSWFDNAAVA 130

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +     +ED VVI P+AV+ P V+IG  + +G G+VIG GVRIGRNC++GAG++I 
Sbjct: 131 ASAVIHPSAHLEDAVVIDPLAVIGPEVQIGTGSVIGSGAVIGPGVRIGRNCNVGAGTTIQ 190

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
           +S IGN+V++H G  IG DG+G+    S+ H K+   GRV+IQ+ VEIGA + IDRG++ 
Sbjct: 191 ASFIGNNVLIHPGCHIGQDGYGFIFFSSEGHVKVPQTGRVLIQNDVEIGAGTTIDRGSLR 250

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C++ +Q+G+AGS  IGDNV +G +CGI  +L IGD
Sbjct: 251 DTVIGEGTKIDNQVQIGHNVTIGRRCLLAAQIGLAGSLTIGDNVALGAKCGINNHLHIGD 310

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+ + S V  DIP   ++GG  A+P  ++ R ++ + +
Sbjct: 311 GAQVTAMSAVKDDIPPNGRWGGHFAKPTKQWFREIIAVER 350


>gi|75676041|ref|YP_318462.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter winogradskyi Nb-255]
 gi|119371428|sp|Q3SRI1|LPXD1_NITWN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 1
 gi|74420911|gb|ABA05110.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter winogradskyi Nb-255]
          Length = 362

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 135/340 (39%), Positives = 207/340 (60%), Gaps = 1/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF       L ++A S GA L+D + G   I  L+ + +A    +++  + K+  
Sbjct: 1   MTQPAFFKRPLPSTLAEIAASTGAQLVDASRGGIRIIGLASLDQAGPMHLAFFDNHKYAG 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   KA A + S      +P ++  L S  P  +F       +  A+  ++      ++
Sbjct: 61  QLAATKAGACLVSPRFEADVPAHVAVLRSKAPFRAFVSIARDFHGDALRPQSWFDNTAVA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +     +ED VVI P+AV+ P V+IGR + +G G+VIG GVRIGR+C++GAG++I 
Sbjct: 121 ASAVIHPSAYLEDEVVIDPLAVIGPDVQIGRGSVIGSGAVIGPGVRIGRDCNVGAGTTIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
           ++LIGN+V++H G  IG DG+G+    S+ H K+   GRV+IQ+ VEIGA + IDRG++ 
Sbjct: 181 ATLIGNNVLIHPGCHIGQDGYGFIFFGSEGHVKVPQTGRVLIQNDVEIGAGTTIDRGSLR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C++ +Q+G+AGS  IGDNV +G + GI  +L IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVTIGRRCLLAAQIGLAGSLTIGDNVALGAKVGINNHLHIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+ + SGV  DIPA  ++GG  A+P  ++ R ++ + +
Sbjct: 301 GAQVTAMSGVKDDIPANGRWGGYFAKPTRQWFRELLAVER 340


>gi|27379963|ref|NP_771492.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bradyrhizobium japonicum USDA 110]
 gi|60390096|sp|Q89KQ2|LPXD_BRAJA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|27353116|dbj|BAC50117.1| UDP glucosamine N-acyltransferase [Bradyrhizobium japonicum USDA
           110]
          Length = 355

 Score =  252 bits (643), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 206/340 (60%), Gaps = 1/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF      AL  +A    A L+D   G+ +I  L+ +  A    +++  + K+ +
Sbjct: 1   MAQPTFFTKPPATALADIATLTKALLVDPTRGDHVITGLASLDEAGPMHLAFFDNLKYAD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            ++  +A A + S      +P ++  L + +P  +F       +  A+  ++     GI+
Sbjct: 61  QLKATRAGACLVSPRFEAQVPAHVAVLRAAQPFRAFVRIAREWHGDALRPQSWVGNDGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    ++EDGV++ P+AV+   VEIG  T VG G+VIG GV+IGR+C++GA ++I 
Sbjct: 121 PSAIIDPTARLEDGVIVDPLAVIGADVEIGSGTVVGVGAVIGPGVKIGRDCNVGARTAIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN V++H G  IG DG+G+     + H K+   GRV+IQ+ VE+GA + IDRG++ 
Sbjct: 181 CALIGNDVLIHPGCSIGQDGYGFIFFGPEGHLKVPQTGRVLIQNNVEVGAGTTIDRGSLR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C++ +Q+G+AGS  IGDNV +G + GI  +LKIGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVTIGRNCLLAAQIGLAGSLTIGDNVALGAKVGINNHLKIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+ + SGV  DIP   ++GG  A+P  ++ + ++ + +
Sbjct: 301 GAQVTAMSGVKDDIPPNGRWGGFFAKPTKQWFKEIIAVER 340


>gi|298291814|ref|YP_003693753.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Starkeya novella DSM 506]
 gi|296928325|gb|ADH89134.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Starkeya novella DSM 506]
          Length = 354

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 191/307 (62%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I +++ +  A   D++Y+   + + ++ +  A A + S+     +P+    L+  +P  +
Sbjct: 36  IANVASLEEAGPSDLAYMDGARHVGDLRRTHAGACLVSERFAAHVPEGTAVLVVARPYAA 95

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           F       +  ++   A   + G++  A +    ++E  V + P AVV PG EIG  T V
Sbjct: 96  FVTVARRFHEASLRPGAVFGQPGVAAGAMVHPQARLEAEVTVDPGAVVGPGAEIGAGTIV 155

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             G+VIG GVRIGR CSIGAG+S+  +L+G+ VI+H G RIG DGFGY  G     K+  
Sbjct: 156 ASGAVIGPGVRIGRACSIGAGASLLHALLGDRVIVHPGARIGQDGFGYLGGARGHAKVPQ 215

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IGRVI+QD VEIGA + IDRG + DT+IGE TKIDN VQI HNV IG  CI+VSQ GIAG
Sbjct: 216 IGRVILQDDVEIGAGTTIDRGGLRDTVIGEGTKIDNLVQIAHNVVIGRHCIVVSQTGIAG 275

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           S  +GD V++GGQ G+ G++ IGD  +IA+ S V  D+P G ++GG PA+P+ E+ R ++
Sbjct: 276 SATLGDFVMLGGQVGVIGHVHIGDGARIAATSNVKDDVPPGVEWGGSPAKPMREWFREVM 335

Query: 336 MLSKPSK 342
            + + ++
Sbjct: 336 AVQRLAR 342


>gi|209964510|ref|YP_002297425.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodospirillum centenum SW]
 gi|226740740|sp|B6ISU1|LPXD_RHOCS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|209957976|gb|ACI98612.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase, putative
           [Rhodospirillum centenum SW]
          Length = 347

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 133/339 (39%), Positives = 202/339 (59%), Gaps = 6/339 (1%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF      +L +LA   GA +        +++ ++P+  A    +S++ +RK+ +
Sbjct: 1   MADPRFFRRAGPFSLAQLASLSGAEIAPGADPALLLHDVAPLESAGPEQLSFLDNRKYAD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
              +  A A I   D+    P     LLS KP  ++A+     YP      A + EGG+S
Sbjct: 61  AFARTGAGACIVHPDLAGRAPAGTALLLSRKPYRAYALCAQAFYP------APAAEGGVS 114

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A L    ++ +G  +AP AV+  G EIG    +GP +VIG  VRIG   ++GA +S+ 
Sbjct: 115 PGAHLHPTARVGEGTEVAPGAVIEAGAEIGNGCRIGPNAVIGRNVRIGDGTTVGACASLS 174

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
              IG+ V+++ GVRIG DGFG+A  V+   ++  +GRV+++D VEIGAN  IDRG   D
Sbjct: 175 HCEIGSRVVIYPGVRIGQDGFGFAMDVAGHVRVPQLGRVLVEDDVEIGANVTIDRGAGPD 234

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG    IDN VQIGHNVH+G GC++V+Q GI+GST +  +V++  Q GI G+LKIG  
Sbjct: 235 TVIGRGCMIDNLVQIGHNVHLGPGCVVVAQAGISGSTKLDHHVILAAQAGITGHLKIGAG 294

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            +IA++SGV++D+  G+Q GG PA P+ ++LR + +L +
Sbjct: 295 ARIAAQSGVMRDVAPGEQVGGSPAVPMRQWLRQVAVLGR 333


>gi|170749838|ref|YP_001756098.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|226740731|sp|B1LTP6|LPXD_METRJ RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|170656360|gb|ACB25415.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 353

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 207/334 (61%), Gaps = 1/334 (0%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           F  +  G+ L ++A + G  L +    +R     + +  A    ++Y+ + ++ + +   
Sbjct: 7   FTAAATGLTLAEIAAAAGTGLPEGADPDRRFSGAASLESAGPDHLAYMDNARYGDALAAT 66

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A A + S       P     L+S  P  ++A     L+P A+   +     G++P A +
Sbjct: 67  RAGACLVSPRFAARCPAGTVALVSRDPYRAYAALLGRLHPDALRPGSQFAVRGVAPGAHV 126

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
             + ++EDGV + P AV+ PG EIG  T VGP +VIG GVRIGR+C+IGAG+++  +L+G
Sbjct: 127 HPEARLEDGVTVDPGAVIGPGAEIGAGTVVGPNAVIGPGVRIGRDCAIGAGTTLSHALLG 186

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G R+G DGFG+A G + + K+  +GRVI+QD VEIGAN+ +DRG   DT+IGE
Sbjct: 187 NRVIVHPGARLGQDGFGFAMGATHL-KVPQVGRVIVQDDVEIGANTTVDRGASRDTVIGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C+IVS VGI+GST + D V++GGQ G+ G+L+IG   QIA 
Sbjct: 246 GTKIDNLVQIAHNVVIGRHCVIVSGVGISGSTTLEDYVVLGGQVGVVGHLRIGRGSQIAG 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            S V +D+P G ++GG PA+P+  + R +  L++
Sbjct: 306 SSNVNRDVPPGSRWGGTPAKPVRAWFRELTTLAR 339


>gi|75677278|ref|YP_319699.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter winogradskyi Nb-255]
 gi|119371910|sp|Q3SMZ4|LPXD2_NITWN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|74422148|gb|ABA06347.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrobacter winogradskyi Nb-255]
          Length = 341

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 203/345 (58%), Gaps = 5/345 (1%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF+S+  +A  ++A   G S + E+F    I +   +A A  G+I Y+   K++ 
Sbjct: 1   MSGETFFLSNHSVAASQIAALAGLSFVTEDFA---ISAAGALATAGIGEICYMDDTKYIE 57

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSF-EGGI 119
            ++  +ASA + S      +P      ++  P   +A   ++LYP+A  + AS+F   GI
Sbjct: 58  ELKVTRASACLISPRFKELVPGGTFSFVTPHPYAIYAQVLALLYPEAT-IPASNFGTNGI 116

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           S +A +     +  GV I P A V P   IG  T +G  +VIG  VRIGRNC IGA  ++
Sbjct: 117 SSKANIHASAIVGHGVTIDPGASVGPNARIGGFTCIGSNAVIGPSVRIGRNCYIGANVTV 176

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +++G+ VI+H G  IG DGFG+        K+  +G VIIQD VE+GAN+ IDRG++ 
Sbjct: 177 AYAVVGDRVIIHPGTSIGQDGFGFTFLGGKWVKVPQVGGVIIQDDVEVGANTTIDRGSMR 236

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            T+IGE TK+DN VQ+ HNV IG  C+I +QVGIAGST IGD V IGG  GIA +L IG+
Sbjct: 237 ATVIGEGTKLDNLVQVAHNVTIGAHCVIAAQVGIAGSTTIGDFVAIGGHAGIAPHLTIGE 296

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             QI   SGV+ DIPAG+++ G+PARP   + R    L + +K K
Sbjct: 297 KAQIGGASGVMCDIPAGERWVGLPARPSRAFFRQFAALKRLAKKK 341


>gi|86749936|ref|YP_486432.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris HaA2]
 gi|119371967|sp|Q2IW89|LPXD_RHOP2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|86572964|gb|ABD07521.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris HaA2]
          Length = 359

 Score =  245 bits (626), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 206/340 (60%), Gaps = 3/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF       L ++A    A L+D + G+R+I  ++ +  A    + +  + K++ 
Sbjct: 1   MTSTLFFKPRPSSTLAEIAALTKAELVDPSQGDRVISGIASLDEAGPMHLGFFENIKYVA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEG-GI 119
            +E+  A A + +Q     +P ++  L    P  +F      ++  AM    S F G GI
Sbjct: 61  ELEQTHAGACLVTQRYETRVPPHVAVLRVKSPVQAFVAYARHIHEDAMR-PMSGFGGTGI 119

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A +    ++EDGV++ P+AV+ P VEIG  + +G G+VI +GV+IGR+C++GA ++I
Sbjct: 120 APSAVIHPSARLEDGVIVDPLAVIGPDVEIGAGSVIGAGAVIASGVKIGRDCNVGANTTI 179

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             SLIGN+V++H G  IG DGF +    +   K+  +GRVIIQ+ VEIG+ + +DRG + 
Sbjct: 180 QFSLIGNNVLIHPGCHIGQDGFRFIFARTH-QKVPQVGRVIIQNDVEIGSGTTVDRGGLR 238

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQ+GHNV IG  C+I +Q G+AGS  +GDNV +G + GI  ++ IGD
Sbjct: 239 DTVIGEGTKIDNQVQVGHNVTIGRHCVIAAQCGLAGSLTLGDNVALGAKVGINNHVMIGD 298

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             QI + S V   +PAG+++GG  A+P  ++ R ++ + +
Sbjct: 299 GAQITAMSAVKDSVPAGERWGGYFAKPTKQWFREIIAVER 338


>gi|254503185|ref|ZP_05115336.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Labrenzia alexandrii DFL-11]
 gi|222439256|gb|EEE45935.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Labrenzia alexandrii DFL-11]
          Length = 347

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 142/339 (41%), Positives = 200/339 (58%), Gaps = 2/339 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF   +GI L  +     A L++    E  I  ++P+  A  G + +  +  +L+
Sbjct: 3   MSEPKFFHFPEGIRLGDIVGWAEAELVN-GAPETEITGVAPLEDAGPGMLVFFDNTAYLD 61

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A+  + S      +P+ +  L+      S+A   + L+P+AM    +  EG +S
Sbjct: 62  ALTTTAAAGCLVSTRHKDKVPEGVAALVCRDAYRSWAKVLAQLFPEAMVPRQAGVEG-VS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
            +A + E   +EDGV + P AVV  G EIG  T +   +VIGAGVRIGR+C IGA  S+ 
Sbjct: 121 ERASVDETASLEDGVCLEPGAVVGAGAEIGAGTVIRSNAVIGAGVRIGRDCVIGANCSVQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            S++GN V  H GV  G DGFGYA G     K+  +GRV+IQD VEIGAN+ IDRG   D
Sbjct: 181 HSILGNRVYFHPGVCCGQDGFGYAMGPGGHLKVPQVGRVVIQDDVEIGANTTIDRGANRD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQIGHNV IG  C++VSQVGI+GS  + D V IGGQ G+ G++ IG  
Sbjct: 241 TVIGEGTKIDNQVQIGHNVVIGRHCVVVSQVGISGSATLEDYVAIGGQSGVGGHVTIGMG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            Q+A+ S V + + AG +YGG PA+P+ ++ R +  + K
Sbjct: 301 AQVAAVSVVSESLEAGGRYGGTPAKPVKQWFREVAAVRK 339


>gi|148255861|ref|YP_001240446.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bradyrhizobium sp. BTAi1]
 gi|166199073|sp|A5EK46|LPXD_BRASB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|146408034|gb|ABQ36540.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bradyrhizobium sp. BTAi1]
          Length = 355

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 207/340 (60%), Gaps = 1/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M + +FF S     L  +A +  A+L+D + GE++I  L+ +  A    +++  + K+ +
Sbjct: 1   MAQPSFFQSPPPTTLAAIAAAANATLVDASRGEQVITGLAALDEAGPMHLAFFDNLKYAD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   KA A + S      +P ++  + +++P  +F      ++  A+  ++     GIS
Sbjct: 61  QLAMTKAGACLVSPRFEARVPSHVAVVRANQPFRAFVQLARTMHADALRPQSWFGCDGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
            QA +    ++EDGVV+ P+AV+   VEIG  T VG G+VIG  V+IGR+C++GA + I 
Sbjct: 121 SQAIIDPSARLEDGVVVEPLAVIGAHVEIGAGTIVGAGAVIGPHVKIGRDCNVGARTVIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN V++H    IG DG+G+       H K+   GRVIIQ+ VEIGA + IDRG++ 
Sbjct: 181 CALIGNDVLIHPACAIGQDGYGFIFFGPGGHVKVPQTGRVIIQNHVEIGAGTTIDRGSLR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C++ +Q+G+AGS  IGDNV +G + GI  +L IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVTIGRHCLLAAQIGLAGSLTIGDNVALGAKVGINNHLTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+ + SGV  DIP   ++GG  A+P  ++ R +V + +
Sbjct: 301 GAQVTAMSGVKDDIPPNGRWGGFFAKPTKQWFREIVAVER 340


>gi|91977318|ref|YP_569977.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisB5]
 gi|119371968|sp|Q136B3|LPXD_RHOPS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|91683774|gb|ABE40076.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisB5]
          Length = 359

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 203/339 (59%), Gaps = 1/339 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF       L ++A    A L+D + G+R+I  ++ +  A    + +  +  ++ 
Sbjct: 1   MTSTLFFKPRPSSTLAEIAALTKAELIDPSQGDRVITGIASLDEAGPMHLGFFENLNYVA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +E+  A A + +Q     +P ++  L    P  +F      ++  AM   +     GI+
Sbjct: 61  ELEQTCAGACLVTQRHESRVPSHVAVLRVKSPVRAFVTYARHIHEDAMRPMSGFRSVGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    ++EDGV++ P+AV+ P VEIG  + +G GSVI +GV+IGR+C++GA ++I 
Sbjct: 121 PSAVIHATARLEDGVIVDPLAVIGPEVEIGAGSVIGAGSVIASGVKIGRDCNVGANTTIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +LIGN+V++H G  IG DGF +    +   K+  +GRVIIQ+ VEIG+ + +DRG + D
Sbjct: 181 FALIGNNVLIHPGCHIGQDGFRFIFAQTH-QKVPQVGRVIIQNDVEIGSGTTVDRGGLRD 239

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQ+GHNV IG  C+I +Q G+AGS  +GDNV +G + G+  ++ IGD 
Sbjct: 240 TVIGEGTKIDNQVQVGHNVTIGRHCVIAAQCGLAGSLTLGDNVALGAKVGVNNHVTIGDG 299

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            QI + S V   +PAG+++GG  A+P  ++ R ++ + +
Sbjct: 300 AQITAMSAVKDSVPAGERWGGFFAKPTKQWFREIIAVER 338


>gi|163795632|ref|ZP_02189598.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [alpha
           proteobacterium BAL199]
 gi|159179231|gb|EDP63764.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [alpha
           proteobacterium BAL199]
          Length = 342

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 195/339 (57%), Gaps = 6/339 (1%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF SH    L +L++  GA L+     +R +  L+ +  A   D+S++ +R++++
Sbjct: 1   MTDPQFFQSHGPFTLGELSKMTGAELVGTADVDRPLSDLAALDAAGPSDLSFLENRRYID 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
               C+A A + + + V   P  +  L++ +P  +FA  G   +P+            + 
Sbjct: 61  GFRNCRAGACLVAPEFVDQAPPGLALLVTPRPRRNFARVGHAFFPRVPAEPGIHARASVD 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +     I  G V+  +A       IG  T +GP +VIG  V IG    IGAG+S+ 
Sbjct: 121 PTADVAPSATIGAGAVVGRLA------RIGAGTEIGPNAVIGDAVEIGEGTRIGAGASVS 174

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            + IG+ V ++ G RIG  GFG+         +  +GRVII+D VE+GAN+ IDRG+  D
Sbjct: 175 HARIGSRVFVYPGARIGQPGFGFEMDRDGPFMVPQLGRVIIEDDVEVGANTTIDRGSGPD 234

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG  T IDN VQIGHNV +G GCIIV+QVGI+GST +G+ V++ GQ GIAG+++IGD 
Sbjct: 235 TVIGRGTMIDNLVQIGHNVVVGSGCIIVAQVGISGSTRLGNRVVVAGQVGIAGHIEIGDG 294

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           VQIA+KSGV + IPAG   GG PA P  E+ R +  + +
Sbjct: 295 VQIAAKSGVTRSIPAGAVMGGAPAVPAREFRRQIAAIKR 333


>gi|218530311|ref|YP_002421127.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254810173|sp|B7KZG7|LPXD_METC4 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|218522614|gb|ACK83199.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium chloromethanicum CM4]
          Length = 351

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 207/334 (61%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           F     G+ L  +A++ G  L D     + +   +P+  A   +++Y+ + ++ + +   
Sbjct: 6   FIAPKGGLTLGSVAEACGVPLPDGADPSQPVTGAAPLETAGPSELAYMDNARYGDALATT 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A A + S    P +P     L++  P  ++A   + LY +AM   +     G+SP A +
Sbjct: 66  RALACLVSPRFAPRVPAGTIALVTRDPYRAYAGLLARLYEEAMRPGSLFAAAGVSPGAHV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               ++EDGV I P AVV PG EIG  T +GP +VIG  VRIGR+CSIGAG+++  +L+G
Sbjct: 126 HPQARLEDGVRIDPGAVVGPGAEIGAGTVLGPNAVIGPNVRIGRDCSIGAGTTLTHALVG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+A G     K+  +GRVIIQD VEIGAN+ IDRG   DT++GE
Sbjct: 186 NRVIVHPGARIGQDGFGFAMGAGGHIKVPQVGRVIIQDDVEIGANTTIDRGASRDTVVGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C+IVS VGI+GST + D V++GGQ G+ G+L+IG   QIA 
Sbjct: 246 GTKIDNLVQIAHNVVIGRHCVIVSGVGISGSTTLEDYVVLGGQVGVVGHLRIGMGSQIAG 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            S V +D+P G ++GG PA+P+  + R M  L++
Sbjct: 306 SSNVNRDVPPGSRWGGTPAKPVRTWFREMTTLAR 339


>gi|90423945|ref|YP_532315.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisB18]
 gi|119371429|sp|Q215E0|LPXD1_RHOPB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 1
 gi|90105959|gb|ABD87996.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisB18]
          Length = 358

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 127/343 (37%), Positives = 206/343 (60%), Gaps = 3/343 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M + +FF       L ++A    A L+D +  +  I  ++ +  A    + +  + K+  
Sbjct: 1   MAQPSFFKQGPSSTLAEIAALTKAELVDASRADHRITGVASLDEAGPMHLGFFENIKYAG 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            + + +A A++ S      +P ++  L +  P  +F     +++  AM  ++     GI+
Sbjct: 61  QLAQTRAGAVLVSPRFEASVPPHVAVLRAKSPFRAFVAYARLIHQDAMRPQSGFDLTGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +    ++EDGV + P+AV+ P VEIG  + +G G+V+  GVRIGR+C++GAG+ I 
Sbjct: 121 ASAVIHPTARLEDGVTVDPLAVIGPQVEIGAGSVIGSGAVLSPGVRIGRDCNVGAGTVIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            +LIGN+V++H G +IG DG+G+    ++ H K+   GRVIIQ+ VEIGA + IDRG++ 
Sbjct: 181 FALIGNNVLIHPGCQIGQDGYGFI--FAETHQKVPQTGRVIIQNDVEIGAGTTIDRGSLR 238

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE +KIDNQVQIGHNV IG  C+I +Q G+AGS  +GDNV +G + GI  +L IGD
Sbjct: 239 DTVIGEGSKIDNQVQIGHNVTIGRHCLIAAQCGLAGSLTLGDNVALGAKVGINNHLHIGD 298

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
             Q+ + S V  D+PA  ++GG  A+P  ++ R ++ + +  K
Sbjct: 299 GAQVTAMSAVKDDVPANGRWGGYFAKPTKQWFREILAVERLPK 341


>gi|240138671|ref|YP_002963143.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Methylobacterium extorquens AM1]
 gi|240008640|gb|ACS39866.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Methylobacterium extorquens AM1]
          Length = 351

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 207/334 (61%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           F     G+ L  +A++ G  L D     + +   +P+  A   +++Y+ + ++ + +   
Sbjct: 6   FIAPKGGLTLGSVAEACGVPLPDGADPSQPVTGAAPLETAGPSELAYMDNARYGDALATT 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A A + S    P +P     L++  P  ++A   + LY +AM   +     G+SP A +
Sbjct: 66  RALACLVSPRFAPRVPAGTIALVTRDPYRAYAGLLARLYEEAMRPGSLFAAAGVSPGAHV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               ++EDGV I P AVV PG EIG  T +GP +VIG  VRIGR+CSIGAG+++  +L+G
Sbjct: 126 HPQARLEDGVRIDPGAVVGPGAEIGAGTVLGPNAVIGPNVRIGRDCSIGAGATLTHALVG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+A G     K+  +GRVIIQD VEIGAN+ IDRG   DT++GE
Sbjct: 186 NRVIVHPGARIGQDGFGFAMGAGGHIKVPQVGRVIIQDDVEIGANTTIDRGASRDTVVGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C+IVS VGI+GST + D V++GGQ G+ G+L+IG   QIA 
Sbjct: 246 GTKIDNLVQIAHNVVIGRHCVIVSGVGISGSTTLEDYVVLGGQVGVVGHLRIGMGSQIAG 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            S V +D+P G ++GG PA+P+  + R M  L++
Sbjct: 306 SSNVNRDVPPGSRWGGTPAKPVRTWFREMTTLAR 339


>gi|188581293|ref|YP_001924738.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylobacterium populi BJ001]
 gi|226740730|sp|B1ZLC2|LPXD_METPB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|179344791|gb|ACB80203.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium populi BJ001]
          Length = 351

 Score =  242 bits (618), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 208/334 (62%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           F V   G+ L  +A++ G  L +     + +   +P+  A   D++Y+ + ++ + +   
Sbjct: 6   FIVPKAGLTLGAVAEACGVPLPEGADPSQPVTGAAPLETAGPSDLAYMDNARYGDALGTT 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A A + S    P +P     L++  P  ++A   + LY +AM   +     G+SP A +
Sbjct: 66  RALACLVSPRFAPRVPAGTIALVTRDPYRAYAGLLARLYEEAMRPGSLFAASGVSPGAHV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               ++EDGV + P AVV PG EIG  T +GP +VIG  VRIGR+CSIG+G+++  +L+G
Sbjct: 126 HPQARLEDGVRVDPGAVVGPGAEIGSGTVLGPNAVIGPNVRIGRDCSIGSGATLTHALVG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+A G     K+  +GRVIIQD VEIGAN+ IDRG   DT++GE
Sbjct: 186 NRVIIHPGARIGQDGFGFAMGAGGHIKVPQVGRVIIQDDVEIGANTTIDRGASRDTVVGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C+IVS VGI+GST + D V++GGQ G+ G+L+IG   QIA 
Sbjct: 246 GTKIDNLVQIAHNVVIGRHCVIVSGVGISGSTTLEDYVVLGGQVGVVGHLRIGMGSQIAG 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            S V +D+P G ++GG PA+P+  + R M  L++
Sbjct: 306 SSNVNRDVPPGSRWGGTPAKPVRTWFREMTTLAR 339


>gi|146341060|ref|YP_001206108.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bradyrhizobium sp. ORS278]
 gi|166199074|sp|A4YVF7|LPXD_BRASO RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|146193866|emb|CAL77883.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Bradyrhizobium sp. ORS278]
          Length = 355

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 132/340 (38%), Positives = 207/340 (60%), Gaps = 1/340 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF S   + L  +A    A L D + G+++I  L+ +  A    +++  + K+ +
Sbjct: 1   MAQPTFFQSPPPMTLAAIAAKAKAELADVSQGDKVIKGLAALDEAGPMHLAFFDNLKYAD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            + +  A A + S      +P ++  + +++P  +F       +  A+  +    + GIS
Sbjct: 61  QLARTNAGACLVSPRFEARVPGHVVVVRANQPFRAFVQLAREFHADALRPQPWFGDDGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           PQA +    ++EDGV++ P+AV+   VEIG  T VG G+VIG  V++GR+C++GA + I 
Sbjct: 121 PQAIIDPTARLEDGVIVEPLAVIGAHVEIGAGTIVGAGAVIGPHVKVGRDCNVGARTVIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            SLIGN V++H G  IG DG+G+    ++ H K+   GRVIIQ+ VE+GA + IDRG++ 
Sbjct: 181 CSLIGNDVLIHPGCSIGQDGYGFIFFGANGHTKVPQTGRVIIQNHVEVGAGTTIDRGSLR 240

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGE TKIDNQVQIGHNV IG  C++ +Q+G+AGS  IGDNV +G + GI  +L IGD
Sbjct: 241 DTVIGEGTKIDNQVQIGHNVTIGRHCLLAAQIGLAGSLTIGDNVALGAKVGINNHLTIGD 300

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             Q+ + SGV  DIP   ++GG  A+P  ++ R +V + +
Sbjct: 301 GAQVTAMSGVKDDIPPNGRWGGFFAKPTKQWFREIVAVER 340


>gi|163851504|ref|YP_001639547.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium extorquens PA1]
 gi|226740728|sp|A9W4H0|LPXD_METEP RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|163663109|gb|ABY30476.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium extorquens PA1]
          Length = 351

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 207/334 (61%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           F     G+ L  +A++ G  L D     + +   +P+  A   +++Y+ + ++ + +   
Sbjct: 6   FIAPKGGLTLGSVAEACGVPLPDGADPAQPVTGAAPLETAGPSELAYMDNARYGDALATT 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A A + S    P +P     L++  P  ++A   + LY +AM   +     G+SP A +
Sbjct: 66  RALACLVSPRFAPRVPAGTIALVTRDPYRAYAGLLARLYEEAMRPGSLFAAAGVSPGAHV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               ++EDG+ I P AVV PG EIG  T +GP +VIG  VRIGR+CSIGAG+++  +L+G
Sbjct: 126 HPQARLEDGMRIDPGAVVGPGAEIGSGTVLGPNAVIGPNVRIGRDCSIGAGATLTHALVG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+A G     K+  +GRVIIQD VEIGAN+ IDRG   DT++GE
Sbjct: 186 NRVIVHPGARIGQDGFGFAMGAGGHIKVPQVGRVIIQDDVEIGANTTIDRGASRDTVVGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C+IVS VGI+GST + D V++GGQ G+ G+L+IG   QIA 
Sbjct: 246 GTKIDNLVQIAHNVVIGRHCVIVSGVGISGSTTLEDYVVLGGQVGVVGHLRIGMGSQIAG 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            S V +D+P G ++GG PA+P+  + R M  L++
Sbjct: 306 SSNVNRDVPPGSRWGGTPAKPVRTWFREMTTLAR 339


>gi|254561267|ref|YP_003068362.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Methylobacterium extorquens DM4]
 gi|254268545|emb|CAX24502.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Methylobacterium extorquens DM4]
          Length = 351

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 207/334 (61%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           F     G+ L  +A++ G  L +     + +   +P+  A   +++Y+ + ++ + +   
Sbjct: 6   FIAPKGGLTLGSVAEACGVPLPEGADPSQPVTGAAPLETAGPSELAYMDNARYGDALVTT 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +A A + S    P +P     L++  P  ++A   + LY +AM   +     G+SP A +
Sbjct: 66  RALACLVSPRFAPRVPAGTIALVTRDPYRAYAGLLARLYEEAMRPGSLFAAAGVSPGAHV 125

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
               ++EDGV I P AVV PG EIG  T +GP +VIG  VRIGR+CSIGAG+++  +L+G
Sbjct: 126 HPQARLEDGVRIDPGAVVGPGAEIGSGTVLGPNAVIGPNVRIGRDCSIGAGATLTHALVG 185

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N VI+H G RIG DGFG+A G     K+  +GRVIIQD VEIGAN+ IDRG   DT++GE
Sbjct: 186 NRVIVHPGARIGQDGFGFAMGAGGHIKVPQVGRVIIQDDVEIGANTTIDRGASRDTVVGE 245

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV IG  C+IVS VGI+GST + D V++GGQ G+ G+L+IG   QIA 
Sbjct: 246 GTKIDNLVQIAHNVVIGRHCVIVSGVGISGSTTLEDYVVLGGQVGVVGHLRIGMGSQIAG 305

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            S V +D+P G ++GG PA+P+  + R M  L++
Sbjct: 306 SSNVNRDVPPGSRWGGTPAKPVRTWFREMTTLAR 339


>gi|23013001|ref|ZP_00052962.1| COG1044: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 339

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 202/345 (58%), Gaps = 8/345 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDE-NFGERMIYSLSPIARASTGDISYIISRKFL 59
           M    FF       L +LA+  GA++ +    G R +  ++P+ +A    +S++ +RK++
Sbjct: 1   MADPRFFTVAGPFTLAQLAEISGAAVAEGGELGARFV-DVAPLEQAEADTVSFLDNRKYV 59

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
              +  KA   + + ++    P  +  LLS  P  ++A      YP        + E  +
Sbjct: 60  AAFQASKAGLCVVAPEMAEKAPAGMHLLLSADPYRAYARIAQAFYPN------PAPEPWV 113

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A++     + +G  I P AV+     IG +  +G   VIG GV +G +C+IGA +++
Sbjct: 114 APTAYIDVTASVGEGCRIEPGAVIGSNARIGARCRIGANVVIGQGVVLGEDCTIGANATV 173

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +L+GN V ++ G RIG DGFG+A G     K+  +GRV+I + VEIGAN+ IDRG   
Sbjct: 174 SHALVGNRVNIYPGARIGQDGFGFAMGPQGHLKVPQLGRVVIGNNVEIGANTTIDRGAGP 233

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT IG+   IDN VQIGHNV +G GC+IV+QVGI+GST +GD V  GGQ GI G+LKIG 
Sbjct: 234 DTQIGDGCMIDNLVQIGHNVQLGRGCVIVAQVGISGSTRMGDFVAAGGQAGITGHLKIGA 293

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             +IA+++GV++DIP G+  GG PA P+ ++LR   +L K ++ K
Sbjct: 294 GAKIAAQAGVMRDIPPGETVGGAPAVPMADWLRQSAILGKMARKK 338


>gi|118590002|ref|ZP_01547406.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Stappia
           aggregata IAM 12614]
 gi|118437499|gb|EAV44136.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Stappia
           aggregata IAM 12614]
          Length = 345

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 144/344 (41%), Positives = 201/344 (58%), Gaps = 12/344 (3%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M   NFF S   ++L  +A    A +      E MI  ++P+  A+ G + +  +  +L 
Sbjct: 1   MSEPNFFESPAPVSLTDIATWADAEIA-RGEPELMITGVAPLEDATPGALVFFDNTAYLK 59

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAM-HMEAS----SF 115
            ++   A+A + ++     +P  +  L+      S+A   + LYP AM  +EA     S 
Sbjct: 60  KLDGTTAAACLVNRKHKDKVPAGVAVLVCADAYRSWAKVLAKLYPAAMVPVEAGPAVISE 119

Query: 116 EGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGA 175
              I P A L ++V +E GVVI        G EIG  T +   +VIG GV+IGR+C IG 
Sbjct: 120 RAVIDPAASLEDNVTVEAGVVIGA------GAEIGAGTVIRANAVIGQGVKIGRDCVIGP 173

Query: 176 GSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDR 235
            S++  ++IGN V +H GV  G DGFGYA G     K+  +GRVIIQD VEIGAN+ IDR
Sbjct: 174 NSTVQHTVIGNRVYMHPGVCCGQDGFGYAMGPMGHLKVPQVGRVIIQDDVEIGANTTIDR 233

Query: 236 GTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYL 295
           G   DTIIGE TKIDNQVQIGHNV +G  C+IVSQVG++GS  + D V IGGQ G+ G++
Sbjct: 234 GANRDTIIGEGTKIDNQVQIGHNVVVGRHCVIVSQVGLSGSCTLEDFVAIGGQTGVRGHV 293

Query: 296 KIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            IG   Q+A+ S V  D+PAG +YGG PA+P+ ++ R +  + K
Sbjct: 294 TIGMGAQVAAVSVVNDDLPAGGRYGGTPAKPVKQWFREVAAVRK 337


>gi|83311587|ref|YP_421851.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Magnetospirillum magneticum AMB-1]
 gi|119371942|sp|Q2W4D3|LPXD_MAGMM RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|82946428|dbj|BAE51292.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Magnetospirillum magneticum AMB-1]
          Length = 339

 Score =  238 bits (608), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 206/345 (59%), Gaps = 8/345 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDE-NFGERMIYSLSPIARASTGDISYIISRKFL 59
           M    FF       L +LA+  GAS+ +  + G   +  ++P+ +A   ++S++ +RK++
Sbjct: 1   MADPRFFRVAGPFTLAQLAELSGASVAEGCDLGASFV-DVAPLEQAGQDNVSFLDNRKYV 59

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
              +  KA   + + ++    P+ +  LLS  P  ++A      YP        + E  +
Sbjct: 60  GAFQASKAGLCVIAPEMADKAPEGMALLLSPDPYRAYARIAQAFYPN------PAPEPWV 113

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A++     + +G  I P AV+  G  IG +  +G   VIG GV +G +C+IGA +++
Sbjct: 114 APTAWVDASAAVGEGCRIEPGAVIGAGARIGARCRIGANVVIGQGVVLGDDCTIGANATV 173

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +L+G+ V ++ G RIG DGFG+A G     K+  +GRV+I + VEIGAN+ IDRG   
Sbjct: 174 SHALVGSRVNIYPGARIGQDGFGFAMGPQGHLKVPQLGRVLIGNNVEIGANTTIDRGAGP 233

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IG+ + IDN VQIGHNV +G GC+IV+QVGI+GST +GD V  GGQ GI G+LKIG 
Sbjct: 234 DTVIGDGSMIDNLVQIGHNVQLGRGCVIVAQVGISGSTRMGDFVAAGGQAGITGHLKIGA 293

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             +IA+++GV++DI  G+  GG PA P+ ++LR   +L K ++ K
Sbjct: 294 GAKIAAQAGVMRDIAPGETVGGAPAVPMADWLRQSAILGKMARKK 338


>gi|114327606|ref|YP_744763.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Granulibacter bethesdensis CGDNIH1]
 gi|119371936|sp|Q0BTL2|LPXD_GRABC RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|114315780|gb|ABI61840.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Granulibacter bethesdensis CGDNIH1]
          Length = 341

 Score =  237 bits (605), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 197/307 (64%), Gaps = 6/307 (1%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  ++P+  A   ++S++ +R++ + +E+ +A A+I   D+V  +P  +  L+  +P ++
Sbjct: 40  LTGVAPLQIAGPSEVSFLDNRRYADALEQTRAGAVIIKADMVDRVPAGVIALVVPEPYLA 99

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +A   ++ YP          + GI P A + E   I+    I P+AV+  GVEIG    +
Sbjct: 100 WARVAALFYP------LPPVQPGIHPSAVVDETACIDPSAQIGPLAVIEAGVEIGPDCRI 153

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
              +VIGAGV++GR+C IG+ +S+  +++G+ V ++ GVRIG DGFG+A        +  
Sbjct: 154 AAHAVIGAGVKMGRSCRIGSHASLSHAILGDRVYVYPGVRIGQDGFGFAPSSEGFVTVPQ 213

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           +GRV++++ VE+GANS IDRG++ DT+IG  +++DN V I HNV +G  C+IVSQVGI+G
Sbjct: 214 LGRVVLENDVEVGANSTIDRGSMHDTVIGAGSRLDNLVMIAHNVRMGRACVIVSQVGISG 273

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           ST +GD+V++ GQ G+ G+LKIG   +I +++GV+ D+PAG +  G PA+P  ++ R + 
Sbjct: 274 STTLGDHVVLAGQAGLIGHLKIGSGARIGAQAGVMADVPAGAEIVGSPAQPAKDFFRQIA 333

Query: 336 MLSKPSK 342
            L + ++
Sbjct: 334 TLRRLAR 340


>gi|218670647|ref|ZP_03520318.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhizobium etli GR56]
          Length = 243

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 169/243 (69%), Gaps = 1/243 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M++  FF+ H+G+ L +LA+ +GA L + +  + ++ S++PI RA  GD+ YI+SR+  +
Sbjct: 1   MEQNVFFLPHEGLKLAELAEFLGAELANSDHADIIVRSVAPINRARAGDVCYILSRRSRD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGI 119
            +  C+ASA+IC + +   +P++IP +LS  P  +FA+AG + YP A+  +  S  EG I
Sbjct: 61  ELLTCQASAVICDKALADLVPQHIPIVLSSNPHAAFAMAGGLFYPAALRPVTISPGEGEI 120

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P A +    K+E GV++ P+AV+    EIG  T +G  S+IG GV+IGR+CSI AG+SI
Sbjct: 121 APSAVIDPSAKLEKGVIVEPLAVIGAHAEIGEGTRIGAHSIIGPGVKIGRDCSIAAGASI 180

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +LIGN VI+H+GVRIG DGFGYA G   + KIV IGRVIIQD VEIGAN+ IDRG +D
Sbjct: 181 LCALIGNGVIIHNGVRIGQDGFGYAPGPRGMIKIVQIGRVIIQDNVEIGANTTIDRGAMD 240

Query: 240 DTI 242
           DT+
Sbjct: 241 DTV 243


>gi|256831139|ref|YP_003159867.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Desulfomicrobium baculatum DSM 4028]
 gi|256580315|gb|ACU91451.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Desulfomicrobium baculatum DSM 4028]
          Length = 342

 Score =  236 bits (602), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 139/344 (40%), Positives = 200/344 (58%), Gaps = 39/344 (11%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L ++A  +G +L  ++     I  ++ +A AS  ++S++ + K+   +E   A A++ S 
Sbjct: 3   LSEIASRLGLTLKGKDL---EITGVNTLAEASASELSFLANPKYAPQLETTGAGAVLVSA 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKIED 133
           D         PCL+S  P + FA +  +   PQ       SFEG ISP AF+ E  +I+ 
Sbjct: 60  DQAL---DTKPCLISAHPYLDFARSVQLFAKPQG------SFEG-ISPLAFVHEAARIDP 109

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRI------GRNCSIGAGSSIYS------ 181
              +AP              Y+GPG+ +GAGVRI      G +CSIG  + IY       
Sbjct: 110 SAAVAPF------------VYIGPGAQVGAGVRIFSGSYLGEDCSIGEDTIIYPNCSLMA 157

Query: 182 -SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +L+G  VILH+G  +G+DGFG+A+  S + K   IGR +I+D VEIGAN+ IDR  + +
Sbjct: 158 GTLVGKRVILHAGTVLGSDGFGFAQAASGMTKFPQIGRTVIEDDVEIGANTTIDRAALGE 217

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T +G  TKIDN VQ+GHNV +G  CIIVSQVGIAGST +GD V++ GQ G+AG+L +GD 
Sbjct: 218 TRVGHGTKIDNLVQLGHNVRVGRNCIIVSQVGIAGSTTLGDGVVLAGQVGVAGHLNLGDG 277

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            +I +KSGV KD+P GQ   G+P  P G +LR   ++ K  + K
Sbjct: 278 CRIGAKSGVGKDVPPGQDLSGIPVMPHGSFLRASAIMPKLPEMK 321


>gi|115524569|ref|YP_781480.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisA53]
 gi|115518516|gb|ABJ06500.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisA53]
          Length = 360

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 200/339 (58%), Gaps = 1/339 (0%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M +  FF  +    L ++A    A L+D +  + +I  ++ +  A    +S+  +  ++ 
Sbjct: 1   MAQAVFFKRYPSSTLAEIAALTKAELVDPSRADHVITGVAALDEAGPMHLSFFENLNYVA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +E+  A A +  +     +P ++  L +  P  +F      ++  AM  ++     GI+
Sbjct: 61  QLEQTHAGACLVPERFEDRVPPHVIVLRAKSPIRAFVTYARHIHEDAMRPQSGFGLSGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +     +ED V + P+AV+ P VEIG  T +G G+VI AGV+IGR+C+IGA ++I 
Sbjct: 121 TSAVIHPSAHLEDDVTVDPLAVIGPDVEIGSGTIIGSGAVISAGVKIGRDCNIGATTTIQ 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +LIGN+V++H G +IG DGF +    +   K+  +GRVIIQ+ VEIG+ + +DRG + D
Sbjct: 181 FALIGNNVLIHPGCQIGQDGFRFIFAQTH-QKVPQVGRVIIQNDVEIGSGTTVDRGGLRD 239

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IGE TKIDNQVQ+GHNV IG  C+I +Q G+AGS  +GDNV +G + GI  ++ IGD 
Sbjct: 240 TVIGEGTKIDNQVQVGHNVTIGRHCVIAAQCGLAGSLTLGDNVALGAKVGINNHVTIGDG 299

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            QI + S V   +P G ++GG  A+P  ++ R ++ + +
Sbjct: 300 AQITAMSAVKDSVPPGARWGGFFAKPTKQWFREILAVER 338


>gi|90423964|ref|YP_532334.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisB18]
 gi|119371911|sp|Q215C1|LPXD2_RHOPB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|90105978|gb|ABD88015.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisB18]
          Length = 373

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 195/339 (57%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF+   G+++  +    GA+  D     R I  L+P+ RA   D+S+I   K+  
Sbjct: 1   MSESGFFLDAVGLSVGDIVALTGATPRDGADLSRAISDLAPLDRAGIADLSFIAETKYAG 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   +A A++ ++      P+++  L   KP  +F      LYP A+   +     G++
Sbjct: 61  VLAATQAGAVLTTERFAHLAPESVAVLRIAKPYEAFVAVARRLYPSALRPTSLFGTLGVA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+  GV + P AV+ P  EIG+ + +G  +VIG  V+IG +C+IGAG ++ 
Sbjct: 121 PGAVVHPSAKLAAGVTVDPGAVIGPRAEIGKGSLIGANAVIGPHVKIGADCAIGAGCTVT 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            S IG+ VI+H G +IG DGFGY    +   K+  IGRV+I D VEIGA S IDRG + D
Sbjct: 181 HSEIGDRVIVHPGSQIGQDGFGYISSANGHTKVPQIGRVVIHDDVEIGAGSNIDRGGMRD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG+ TKIDN  QIGHN  IG  CIIV+Q G++GS  + D  ++G + G+  ++ IG  
Sbjct: 241 TVIGQGTKIDNLCQIGHNCVIGRHCIIVAQSGLSGSVTVEDFAVLGARTGVIPHITIGKG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             +AS+S V  ++PAG  +GG PA+   +++R +V L +
Sbjct: 301 AMLASRSTVYSNVPAGAVWGGFPAQSKRQWMREVVALRQ 339


>gi|148261431|ref|YP_001235558.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acidiphilium cryptum JF-5]
 gi|146403112|gb|ABQ31639.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidiphilium cryptum JF-5]
          Length = 361

 Score =  233 bits (593), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 192/335 (57%), Gaps = 8/335 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEK 64
            FF       + +LA + GA    +    R +  ++P+  A   D+S++ +RK+L  +  
Sbjct: 13  RFFARRGPFTVAELAAATGAEPAGD--AARELTGVAPLQTAGPADVSFLDNRKYLPLLAA 70

Query: 65  CKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAF 124
            KA A+I   D+    P     L +D P  ++A A ++ +P    +       GI P A 
Sbjct: 71  TKAGAVILRGDMAATSPAGAATLATDAPYEAWARACALFHPAPEAVP------GIHPSAV 124

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI 184
           + +  KI     I P AV+  G  IG  + +GP +VIG GV IG   S+GAG+SI  +LI
Sbjct: 125 IADAAKIHPSAEIGPFAVIGAGSRIGAGSRIGPHAVIGPGVEIGAGTSVGAGASIGFALI 184

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G+ V +H GVRIG DGFG+A        +  +GRVII+  V+IGAN+ IDRG+  DT+IG
Sbjct: 185 GDRVTIHPGVRIGQDGFGFATTKQGFLSVPQLGRVIIEHDVDIGANTTIDRGSAQDTVIG 244

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
             T+IDN VQI HNV IG  C+IV+QVGI+GST + D V++ GQ GI+G++ +G   +I 
Sbjct: 245 AGTRIDNLVQIAHNVRIGRCCVIVAQVGISGSTTLEDFVVLAGQAGISGHVTLGKGARIG 304

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            ++GV+ D+  G    G PA+P  +++R +  + +
Sbjct: 305 PQAGVMSDVKPGIDMLGSPAQPAKDFMREVAAVRR 339


>gi|254418374|ref|ZP_05032098.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brevundimonas sp. BAL3]
 gi|196184551|gb|EDX79527.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Brevundimonas sp. BAL3]
          Length = 337

 Score =  232 bits (592), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 133/345 (38%), Positives = 202/345 (58%), Gaps = 15/345 (4%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF +   + + +LA  IG  +  E  G+R I S++P++ A  G I+++  RKF+ 
Sbjct: 1   MPDTRFFQTLSPLTVAELAAQIGGEV--ERGGDRTIASVAPLSSADGGAIAFLGDRKFVA 58

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGI 119
            +   +A  +I   + V   P     ++S  P+ S+A+A ++L+ P  +           
Sbjct: 59  ALAGTRAGCVIVPAEAVASAPAEAAVIISRTPQASWAMASALLHRPVTLD---------- 108

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
             +A    +   +D VVI P  V+  GV IGR T +   +VIG GV+IGR+C IG+  ++
Sbjct: 109 --RAIQASEAAEDDSVVIEPGVVLGEGVRIGRGTRICANTVIGPGVQIGRDCVIGSNVTV 166

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +LIG+ V L++G RIG  GFG     +    I  +GRVI+QD V +GANS IDRG  D
Sbjct: 167 GFALIGDRVKLYAGARIGEAGFGATGTAAGAMDIPQLGRVILQDGVTVGANSCIDRGAYD 226

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGENTKIDN V +GHN  IG   ++ +  GI+GS   GDNV+ GG+ GI  ++ IG+
Sbjct: 227 DTVIGENTKIDNLVMVGHNCVIGRNNLMAANTGISGSVTSGDNVIFGGKAGIGDHITIGE 286

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             ++A+ +GVL +IPAG+ + G PARPI ++LR  + L+K +  K
Sbjct: 287 GARVAAGAGVLANIPAGETWSGYPARPIRQFLRETIWLAKQASSK 331


>gi|86608764|ref|YP_477526.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|119371981|sp|Q2JLY8|LPXD_SYNJB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|86557306|gb|ABD02263.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 363

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 127/326 (38%), Positives = 197/326 (60%), Gaps = 12/326 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++AQ +G +   +   E  I+S++ +A A  G++S++   ++L  +E+ +ASA+I 
Sbjct: 1   MQLQEIAQKLGCAYEGDPTLE--IHSVASLAEARPGELSFLSEARYLPLLEQTQASAVIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            + +   +P +I CL    P + FA A  + Y      +      GI P A +   V++ 
Sbjct: 59  EEGLA--LPCSIACLRGRDPRLLFAQAIELFY------QPYRLPVGIHPTAVIDPSVELG 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
           +GV I P AVV  GV+IG  T + P   I   VRIG  C + A   I+  + IG+  ++H
Sbjct: 111 EGVAIGPHAVVMEGVKIGDHTQIHPNVTIYPHVRIGSRCQLFANCVIHERTEIGDDCLIH 170

Query: 192 SGVRIGNDGFGY-ARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  IG+DGFG+         +++  GRV+++D VE+G+N+ IDR  + +T IG  TKID
Sbjct: 171 SGAVIGDDGFGHIPLADGSWRRMLQAGRVVLEDNVEVGSNTTIDRAAVGETRIGRGTKID 230

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGH V  G  C+IV+QVGIAGST +G +V++ GQCG+AG+L IGD V++A+++GV 
Sbjct: 231 NLVQIGHGVRTGSHCLIVAQVGIAGSTQLGHHVILAGQCGLAGHLHIGDGVRVAAQTGVT 290

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVM 336
            D+PAGQ   G P +PI E+ + M +
Sbjct: 291 SDVPAGQTVAGYPHQPIAEWRKSMAV 316


>gi|115524595|ref|YP_781506.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisA53]
 gi|115518542|gb|ABJ06526.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rhodopseudomonas palustris BisA53]
          Length = 356

 Score =  229 bits (585), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 125/339 (36%), Positives = 189/339 (55%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M   +FFV   G+ +  +    GA   D     R I  L+P+ RA   D+S+I   K+  
Sbjct: 1   MSEGSFFVDSVGLTVGAIIALTGAEPRDGTDLSRPINDLAPLDRAGIADLSFIAESKYAG 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +   KA A++ ++      P  +  L   KP  +F       YP+A+   +     GI+
Sbjct: 61  VLAVTKAGAVLTTERFAAMAPAGVAVLRLPKPYEAFIAVARNFYPEALRPTSLFGTIGIA 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A +    K+  GV + P A++ P  EIG  + +G  +VIG  VRIG +C+IGA  ++ 
Sbjct: 121 PGANVHPSAKLAAGVTVDPGAMIGPDAEIGAGSLIGANAVIGPQVRIGADCAIGASCTVT 180

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            ++IG+ VILH G +IG DGFGY        K+  IGRV+I D VE+G+ + IDRG + D
Sbjct: 181 HAVIGDRVILHPGSQIGQDGFGYISSAGGHVKVPQIGRVVIHDDVEVGSGTCIDRGGMRD 240

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG+ TKIDN  QIGHN  IG  CIIV Q G++GS  + D  ++G + G+  ++ IG  
Sbjct: 241 TVIGQGTKIDNLCQIGHNCVIGRHCIIVGQTGLSGSVTLEDYAVLGARTGVLPHITIGKG 300

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             +A++S V  D+PAG  +GG PA+   +++R M+ L +
Sbjct: 301 AMLAARSSVYNDVPAGAVWGGFPAQDKRQWMREMLTLRR 339


>gi|86605713|ref|YP_474476.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus sp. JA-3-3Ab]
 gi|119371980|sp|Q2JVM2|LPXD_SYNJA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|86554255|gb|ABC99213.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus sp. JA-3-3Ab]
          Length = 343

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/326 (38%), Positives = 195/326 (59%), Gaps = 12/326 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++AQ +G     +   E  I+ ++ +A A  G++S++   ++L  +E+ +ASA+I 
Sbjct: 1   MQLQEIAQKLGCPYEGDPTLE--IHGVASLAEARPGELSFLSEARYLPLLEQTQASAVIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            + +V  +P+ I CL    P + FA A  + Y      +      GI P A +   V++ 
Sbjct: 59  EESLV--LPRPIACLRGKDPRLLFAQAIELFY------QPYRLPVGIHPTAVIDPSVELG 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
           +GV I P  VV  GV+IG  T + P   I   VR+G  C + A   I+  + IG+  ++H
Sbjct: 111 EGVAIGPHVVVMEGVKIGDYTQIHPNVTIYPHVRVGSRCQLFANCVIHERTEIGDDCLIH 170

Query: 192 SGVRIGNDGFGY-ARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  IG+DGFG+         +++  GRV+++D VE+G+N+ IDR  + +T IG  TKID
Sbjct: 171 SGAVIGDDGFGHIPLPDGSWRRMLQAGRVVLEDGVEVGSNTTIDRAAVGETRIGRGTKID 230

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGH V  G  C+IV+QVGIAGST +G +V++ GQCG+AG+L IGD V++A+++GV 
Sbjct: 231 NLVQIGHGVKTGSHCLIVAQVGIAGSTQLGHHVILAGQCGLAGHLHIGDGVRVAAQTGVT 290

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVM 336
            D+PAGQ   G P +PI E+ R M +
Sbjct: 291 SDVPAGQTVAGYPHQPIAEWRRSMAV 316


>gi|326404911|ref|YP_004284993.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidiphilium multivorum AIU301]
 gi|325051773|dbj|BAJ82111.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidiphilium multivorum AIU301]
          Length = 361

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 192/335 (57%), Gaps = 8/335 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEK 64
            FF       + +LA + GA    +    R +  ++P+  A   D+S++ +RK+L  +  
Sbjct: 13  RFFARRGPFTVAELAAATGAEPAGD--AARELTGVAPLQTAGPADVSFLDNRKYLPLLAA 70

Query: 65  CKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAF 124
            KA A+I   D+    P     L +D P  ++A A ++ +P      A     GI P A 
Sbjct: 71  TKAGAVILRGDMAAASPAGAATLATDAPYEAWARACALFHP------APEAVPGIHPSAV 124

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI 184
           + +  KI     I P AV+  G  IG  + +GP +VIG GV IG   S+GAG+SI  +LI
Sbjct: 125 IADAAKIHPSAEIGPFAVIGAGSRIGAGSRIGPHAVIGPGVEIGAGTSVGAGASIGFALI 184

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G+ V +H GVRIG DGFG+A        +  +GRVII+  V+IGAN+ IDRG+  DT+IG
Sbjct: 185 GDRVTIHPGVRIGQDGFGFATTKQGFLSVPQLGRVIIEHDVDIGANTTIDRGSAQDTVIG 244

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
             T+IDN VQI HNV IG  C+IV+QVGI+GST + D V++ GQ GI+G++ +G   +I 
Sbjct: 245 AGTRIDNLVQIAHNVRIGRCCVIVAQVGISGSTTLEDFVVLAGQAGISGHVTLGKGARIG 304

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            ++GV+ D+  G    G PA+P  +++R +  + +
Sbjct: 305 PQAGVMSDVKPGIDMLGSPAQPAKDFMREVAAVRR 339


>gi|197105233|ref|YP_002130610.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Phenylobacterium zucineum HLK1]
 gi|226740735|sp|B4RBY4|LPXD_PHEZH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|196478653|gb|ACG78181.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Phenylobacterium zucineum HLK1]
          Length = 343

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 131/345 (37%), Positives = 203/345 (58%), Gaps = 14/345 (4%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    F+     + L +LA+  GA L     G R+I + + +A A    ++++  RK L 
Sbjct: 1   MPDPRFYEDLGPVPLAELAKLGGADLPAGADGARLIRAAAVLAHAGPDTVTFLTDRKHLP 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGI 119
            + + + +  + ++D    +P     L++  P  ++A+A   L+ P+A+  +A      I
Sbjct: 61  GLARLEGACFVQARD-ASVLPDGCIPLVTRNPHGAYALAAQTLHRPRAVGSDA------I 113

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
           +P      DV +E GV +    V+ PGV++GR T +GP +V+GAGV IGR C IGA  ++
Sbjct: 114 AP------DVVLEPGVELGAGVVLGPGVKVGRGTRIGPNAVVGAGVAIGRECDIGANVTL 167

Query: 180 YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
             +L+G+ V + +G  IG  GFG   G   +  I  +GRVIIQD V IGAN+ IDRG  D
Sbjct: 168 GFALLGDRVRILAGAVIGEPGFGATAGAQGLIDIPQLGRVIIQDGVTIGANTTIDRGAFD 227

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           DT+IGENTKIDN VQI HNV +G  C++ +  GI+GS  IG+    GG+ G+A ++ IG 
Sbjct: 228 DTVIGENTKIDNLVQIAHNVRVGRNCVMAAHTGISGSVEIGEGAQFGGRAGVADHVTIGA 287

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             ++ + +GV+KDIPAG+ +GGMPARPI  +L+    L++ +  +
Sbjct: 288 GARVGAAAGVMKDIPAGETWGGMPARPIRHWLKETAWLARMANRR 332


>gi|325295287|ref|YP_004281801.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065735|gb|ADY73742.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 334

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 197/336 (58%), Gaps = 15/336 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +L + +G  L+ ++  E  I  +S I  A  GD++++ + K+   ++  KASA+I 
Sbjct: 1   MKLKELVEILGCKLIGDS--EVEIKGVSEIQTAEEGDLTFLTNPKYRKFLKTTKASAVIL 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            ++I       I  LL ++P V+FA A S+ YP+ +     S    IS    +GED  I 
Sbjct: 59  EKEIPEL---KIAQLLCEEPYVAFAKALSVFYPERLPEPKISDRAIISDTTTIGEDCYIG 115

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
           D V I        G +IG++  + PG  IG    IG N  I    +IY  + +G  V +H
Sbjct: 116 DNVFIGK------GTKIGKEVKIFPGVYIGNDCEIGDNTVIFPNVTIYERTKVGRFVRIH 169

Query: 192 SGVRIGNDGFGYARGVSD--IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           +G  IG+DGFGYA    D  I+K+   GRVII+D VEIGAN+ IDRGTI DT+IGE TKI
Sbjct: 170 AGSVIGSDGFGYAFSKKDVKIYKVPQTGRVIIEDFVEIGANTTIDRGTIGDTVIGEGTKI 229

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQIGHNV IG  C IVSQVGI+GST IGD V + G+ G+AG+++I  NV + +K+G+
Sbjct: 230 DNLVQIGHNVKIGKYCFIVSQVGISGSTKIGDFVTLAGKVGVAGHIEIASNVTVGAKAGI 289

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYK 344
            K I     Y G PARP  E+ +   ++ + P  Y+
Sbjct: 290 TKSIKKPGTYAGFPARPYREWKKIQTIVDRLPEIYE 325


>gi|170738981|ref|YP_001767636.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylobacterium sp. 4-46]
 gi|226740732|sp|B0UQ03|LPXD_METS4 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|168193255|gb|ACA15202.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium sp. 4-46]
          Length = 352

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 194/308 (62%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDK 91
           G   +   +P+  A   D++Y+ + K+   + + +A A + S      +P+    L++ +
Sbjct: 32  GTLAVAGAAPLESAGPDDLAYMDNAKYAEALGRTRARACLVSPRFAARVPEGTAALVTPQ 91

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
           P   FA   + L+P A    +     G+SP +F+  + ++E GVV+ P  V+ PG EIG 
Sbjct: 92  PYRGFAQVLARLFPSAARPGSLFGATGVSPGSFVHPEARLEPGVVVDPGVVIGPGAEIGS 151

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
            T +  G+V+G G RIGR C+IG G+S+  +L+GN VI+H G RIG DGFG+A G     
Sbjct: 152 GTVLAAGAVVGPGTRIGRGCAIGPGASLLHALVGNRVIVHGGARIGQDGFGFAMGAGGHL 211

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           K+  +GRVIIQD VEIGAN+ IDRG   DTI+GE TKIDN VQI HNV IG  C+IV+QV
Sbjct: 212 KVPQVGRVIIQDDVEIGANTTIDRGASRDTIVGEGTKIDNLVQIAHNVVIGRHCVIVAQV 271

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GI+GST + D V++GGQ G+ G+L+IG   QIA  S + KD+P G ++GG PA+P+ E+ 
Sbjct: 272 GISGSTTLEDYVVLGGQVGVVGHLRIGMGAQIAGSSNINKDVPPGARWGGTPAKPVREWF 331

Query: 332 RHMVMLSK 339
           R M  L +
Sbjct: 332 REMTTLKR 339


>gi|296536117|ref|ZP_06898248.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Roseomonas cervicalis ATCC 49957]
 gi|296263562|gb|EFH10056.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Roseomonas cervicalis ATCC 49957]
          Length = 330

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 120/307 (39%), Positives = 177/307 (57%), Gaps = 7/307 (2%)

Query: 34  RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPE 93
           R+   ++P+A A    I+++  RK L  +   +A A++   +    +P+    L    P 
Sbjct: 1   RLFEGVAPLAEAGPAQIAFLDGRKHLPALRASRAGAVLLRPEFAAEVPEGCAALAVASPH 60

Query: 94  VSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKT 153
           + FA    + +P      A +   GI P A +  D  I +G  I P AV+  G  +G + 
Sbjct: 61  LGFARVAGLFHP------APAPVPGIHPTAVVAPDATIGEGSEIGPHAVIGAGAVLGARA 114

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIH-K 212
           YVGP +VIG G   G +  I A +S    + G+ V LH G R+G +GFG+A      +  
Sbjct: 115 YVGPHAVIGPGCVFGEDARIHAHASAICCIAGHRVTLHHGARVGQEGFGFAPTPEGRYVT 174

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  +GRV+++D+VEIGANS +DRG + DT+IG  T++DN VQIGHNV  G GC+IV+QVG
Sbjct: 175 IPQLGRVLLEDEVEIGANSCVDRGALGDTVIGRGTRLDNLVQIGHNVVTGRGCVIVAQVG 234

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           I+GST +GD V I GQ G+ G+L IG   +I +++GV  D+PAGQ   G PA P+ + LR
Sbjct: 235 ISGSTRLGDYVTIAGQAGLTGHLHIGSQARIGAQAGVQADVPAGQDVTGSPAMPVKDALR 294

Query: 333 HMVMLSK 339
             + L +
Sbjct: 295 AALHLRR 301


>gi|220921524|ref|YP_002496825.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylobacterium nodulans ORS 2060]
 gi|254810174|sp|B8INJ6|LPXD_METNO RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|219946130|gb|ACL56522.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 352

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 193/307 (62%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  I   +P+  A   D++Y+ + K+   +   +A A + S      +P+    L++ +P
Sbjct: 33  ELAIRGAAPLESAGPDDLAYMDNAKYAEALGLTRARACLVSPRFAARVPEGTIALVTPQP 92

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
              FA   + L+P A    +     G+SP +F+    ++E GVV+ P  V+ PG EIG +
Sbjct: 93  YRGFAKVLARLFPSAARPTSLFGATGVSPGSFVHPAARLEPGVVVDPGVVIGPGAEIGAE 152

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
           T +  G+VIG G RIGR C++G G+S+  +LIGN VI+H G RIG DGFG+A G     K
Sbjct: 153 TVLAAGAVIGPGTRIGRGCAVGPGASVLHALIGNRVIIHGGARIGQDGFGFAMGAGGHLK 212

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           +  +GRVIIQD VEIGAN+ IDRG   DTIIGE TKIDN VQI HNV IG  C+IV+QVG
Sbjct: 213 VPQVGRVIIQDDVEIGANTTIDRGASRDTIIGEGTKIDNLVQIAHNVVIGRHCVIVAQVG 272

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           I+GST + D V++GGQ G+ G+L+IG   QIA  S + KD+P G ++GG PA+P+ E+ R
Sbjct: 273 ISGSTTLEDYVVLGGQVGVVGHLRIGMGAQIAGSSNINKDVPPGARWGGTPAKPVREWFR 332

Query: 333 HMVMLSK 339
            M  L +
Sbjct: 333 EMTTLKR 339


>gi|254294069|ref|YP_003060092.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hirschia baltica ATCC 49814]
 gi|254042600|gb|ACT59395.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hirschia baltica ATCC 49814]
          Length = 335

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 177/303 (58%), Gaps = 12/303 (3%)

Query: 38  SLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFA 97
           S++    AS GD+++I + K  + +   KAS  I S++I   +P+NI  ++SD+P  SF 
Sbjct: 35  SVNSFENASNGDLTFIENIKGAD-LTDVKASVCITSREIAEQLPENISIIVSDRPRWSFG 93

Query: 98  IAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVG 156
            A  ++  P+       S          + +   +E+GV++ P  V+   V IG  T + 
Sbjct: 94  QASKLIASPRQFQSNTPS----------ISDSSTVEEGVILGPNVVIGDDVSIGAGTVIA 143

Query: 157 PGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHI 216
           PG+VI  GV+IG+NCSIG+  +I +SLIGN+V L SGV +G  GFG + G +      H 
Sbjct: 144 PGTVIWPGVKIGKNCSIGSNVTIKTSLIGNNVTLSSGVVLGESGFGLSIGANGADDSPHF 203

Query: 217 GRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS 276
           GRVI+QD   IG NS +D G   DTIIGE  KIDN   I HNV I    ++ +  GIAGS
Sbjct: 204 GRVIVQDWASIGCNSCVDCGVFGDTIIGERAKIDNLCHISHNVVIEAHSVLAAFCGIAGS 263

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVM 336
           T +G    +GG C IA +LKIG  V++A  SG++ DIP G+ +GG PA+PI  + R  V 
Sbjct: 264 TIVGSGTQMGGACSIADHLKIGRQVKLAGNSGLMSDIPDGETWGGYPAKPIKSWFRETVW 323

Query: 337 LSK 339
           LSK
Sbjct: 324 LSK 326


>gi|225851272|ref|YP_002731506.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Persephonella marina EX-H1]
 gi|225646453|gb|ACO04639.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Persephonella marina EX-H1]
          Length = 328

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 137/328 (41%), Positives = 195/328 (59%), Gaps = 15/328 (4%)

Query: 15  LMKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L ++A+  G  L+  N  + + I SLS +  A  GD++++  +KFLN + K KASAII  
Sbjct: 3   LTRIAEITGGKLI--NLKDDIDIRSLSSLEGAEEGDLTFVSGKKFLNLVYKTKASAIITG 60

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +++      + P ++ DKP+  F     + YP          +G IS  A +G+DV I +
Sbjct: 61  KEL----DIDKPQIIVDKPDQVFYELIKVFYPD------EEVKGQISETAVIGKDVSIGE 110

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILHS 192
            V I    V+  GV+IGR T + P S IG    IG +  I    ++Y  ++ G  VI+HS
Sbjct: 111 DVYIGDYVVIQDGVKIGRGTKIYPFSFIGKNCVIGEDTVIYPRVTLYPDVVLGKRVIIHS 170

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           GV IG+DGFGY +      KI H+G+VII+D VEIGAN+ IDR  ID T+IG+ TKIDN 
Sbjct: 171 GVVIGSDGFGYYQKDGKHIKIKHVGKVIIEDDVEIGANTTIDRAMIDKTVIGKGTKIDNL 230

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           V + HN  IG  CII++QVG+AGS  IG NV++ GQ G+A ++ IGDNV +  KS V KD
Sbjct: 231 VMVAHNCQIGENCIILAQVGMAGSGRIGKNVILAGQVGVADHINIGDNVIVIGKSSVPKD 290

Query: 313 IPAGQQYG-GMPARPIGEYLRHMVMLSK 339
           +P+   YG  +PA    ++ R +  LSK
Sbjct: 291 LPSNGVYGSSIPAMEWNKWKRILAYLSK 318


>gi|16126156|ref|NP_420720.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Caulobacter crescentus CB15]
 gi|221234927|ref|YP_002517363.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Caulobacter crescentus NA1000]
 gi|20138700|sp|Q9A713|LPXD_CAUCR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|254810170|sp|B8GWR3|LPXD_CAUCN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|13423366|gb|AAK23888.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Caulobacter crescentus CB15]
 gi|220964099|gb|ACL95455.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Caulobacter crescentus NA1000]
          Length = 339

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/339 (38%), Positives = 189/339 (55%), Gaps = 9/339 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF S     L +LAQ+  A+L D   GER+I   +P+  +    I++    K  +
Sbjct: 1   MPDPRFFDSLGPALLSELAQAGAATLADAALGERVITHAAPLDASDAQAITFFSDAKRKD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
                +A A     +   F+P     L++ +P+ ++A A + L+    H      E G +
Sbjct: 61  AAASTRAGACFVRPEHQGFLPPTCAALVTGRPQAAWAAAANRLHAPRRH------EAG-A 113

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P   L  D  +EDGV +AP   +  G  IGR T +GPG VIG GV IGR C IGA + I 
Sbjct: 114 PS--LHPDAALEDGVALAPNVTIGQGASIGRGTRIGPGVVIGPGVVIGRYCRIGANAVIG 171

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +++G++V + +G  IG  GFG A G   +  +  +GRV+IQD V +GANS +DRG   D
Sbjct: 172 FAMLGDNVAISAGAVIGEAGFGAALGPRGMVDLPQLGRVVIQDNVTLGANSCVDRGAFGD 231

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T IGENTKIDN V + HNV IG  C++ +  G++GST +GD V  GG+ G+A +L IG  
Sbjct: 232 TTIGENTKIDNLVHVAHNVRIGRNCVLAAYTGVSGSTVVGDGVAFGGKAGVADHLNIGSG 291

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             I + + V KD+P G+ + G PARP+  +LR    LS+
Sbjct: 292 ASIGAAASVFKDVPDGETWTGFPARPLKRWLRETAWLSR 330


>gi|144898242|emb|CAM75106.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 339

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 141/344 (40%), Positives = 194/344 (56%), Gaps = 6/344 (1%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF       L +LA+  GA L       +++  ++ +  A    IS++ +RK++N
Sbjct: 1   MADSRFFTVAGPFTLAQLAEICGAELSQPQQSGQVVIDVAALEIAGADHISFLDNRKYIN 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
                KA A+I   D+    P   P LLS  P  ++A+     YPQ       S    + 
Sbjct: 61  AFTATKAGAVIVHPDLAERGPAGTPLLLSKDPYRAYAMVAQAFYPQPAPSAWVSPTAHVD 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +G +  I  GVVI   A      EIG    +   +VIG GV IG   +IGA +++ 
Sbjct: 121 SSAKIGANCWIGHGVVIGARA------EIGDNCRIEANAVIGDGVVIGPGGTIGANATVQ 174

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            ++IG  V ++ G RIG DGFG+A G+    K+  +GRVII + VEIGAN+ IDRG   D
Sbjct: 175 CAIIGAKVNIYPGARIGQDGFGFAMGIQGHLKVPQLGRVIIGNGVEIGANTTIDRGAGPD 234

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG+   IDN VQIGHNV +G GC+IV+QVGI+GST  GD    GGQ G AG+LKIG  
Sbjct: 235 TVIGDGCWIDNLVQIGHNVQLGRGCVIVAQVGISGSTQFGDFAAAGGQAGFAGHLKIGSG 294

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            +I +++GV+ DIPAGQ YGG PA P  E+LR   +LSK ++ K
Sbjct: 295 AKIMAQAGVISDIPAGQTYGGCPAIPRMEWLRQSAVLSKLARNK 338


>gi|162147927|ref|YP_001602388.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542545|ref|YP_002274774.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786504|emb|CAP56086.1| putative UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferas
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530222|gb|ACI50159.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 356

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 194/344 (56%), Gaps = 8/344 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASLL--DENFGERMIYSLSPIARASTGDISYIISRKFLNNI 62
            FF  +   +L  LA+  GA +   DE         ++P+  A   ++S++ +R++   +
Sbjct: 13  RFFERNGPFSLRALAECAGARVEGGDEADDAPRYVGIAPLQSAGPQEVSFLDNRRYAPLL 72

Query: 63  EKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQ 122
           E+ +A  +I +   V  +PK    L+   P +++A    + +P    +       GI P 
Sbjct: 73  EQTRAGVVILAPAFVDRLPKGTVGLVCSTPYLAWARVAGLFHPVPAAIP------GIHPT 126

Query: 123 AFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS 182
           A +G    I+    I P   +  G ++G  + +   ++IG GVRIG +C IG+ +S+  +
Sbjct: 127 AIVGAGADIDPSAQIGPFVTIGAGAQVGAGSRIDAYALIGDGVRIGAHCRIGSHASVSHA 186

Query: 183 LIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTI 242
           L+G+ V L SG RIG +GFG+A G      +  +GRV+++D VE+GANS IDRG+  DT+
Sbjct: 187 LLGDRVTLLSGARIGQEGFGFAVGPDGFETVPQLGRVVLEDGVEVGANSTIDRGSSQDTV 246

Query: 243 IGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQ 302
           IG  +++DN VQIGHN  +G  CI+VSQ GI+GST +GD V I  Q G+ G++++G   +
Sbjct: 247 IGAGSRLDNLVQIGHNARLGRCCIVVSQAGISGSTELGDFVTIAAQAGLIGHIRVGTKAR 306

Query: 303 IASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           I ++ GV+ D+ AG    G PA P  E+ R++ +L + +K   +
Sbjct: 307 IGAQCGVMSDVEAGADVIGSPAMPFREFFRNVAVLRRLAKKATQ 350


>gi|217979935|ref|YP_002364082.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase LpxD
           [Methylocella silvestris BL2]
 gi|217505311|gb|ACK52720.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase LpxD
           [Methylocella silvestris BL2]
          Length = 349

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 182/324 (56%), Gaps = 9/324 (2%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF+  K ++L +L    GA   D       +Y  +P   A  GD++Y    K L+ +   
Sbjct: 6   FFLRAKQLSLAELVALTGARPADGADLSPQVYGGAPFEEAEPGDVTYFAHPKRLHRLPDT 65

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEG-GISPQAF 124
            A+A   ++      P+    L++D+PE +FA A + +YP A+  EAS F   G++P A 
Sbjct: 66  NATACFVAERYAFAAPRGTAALVTDQPEQAFAQALAAMYPSALQ-EASLFAAAGVNPGAS 124

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI 184
           +  + ++E GV + P AV+ P  EIG  T VG  SVIG GVRIGR+CSIGA  +I ++LI
Sbjct: 125 VHPEARLEPGVAVDPGAVIGPRAEIGSGTIVGANSVIGPGVRIGRDCSIGAQVTIVNALI 184

Query: 185 GNSVILHSGVRIGNDGF--GYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTI 242
           GN V L  G RIG  G     AR  +       IGRVIIQD VEIGAN+AIDRG+  DT+
Sbjct: 185 GNRVKLRPGARIGQAGSPQNAARAATP-----QIGRVIIQDDVEIGANAAIDRGSGRDTV 239

Query: 243 IGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQ 302
           IGE   I N V+IG +V +G  C I +   I GS  IGD   IG Q  +  +L IG +  
Sbjct: 240 IGEGATIGNLVEIGADVTVGRKCRIGALAVIGGSVEIGDFARIGAQADVGEHLHIGFSAH 299

Query: 303 IASKSGVLKDIPAGQQYGGMPARP 326
           I  ++GV  D+P   +Y G PARP
Sbjct: 300 ILPQAGVASDVPPFARYAGSPARP 323


>gi|330993383|ref|ZP_08317318.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconacetobacter sp. SXCC-1]
 gi|329759413|gb|EGG75922.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconacetobacter sp. SXCC-1]
          Length = 359

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 123/345 (35%), Positives = 188/345 (54%), Gaps = 9/345 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASL---LDENFGERMIYSLSPIARASTGDISYIISRKFLNN 61
            FF  H    L +LA+  GA L   ++ +        ++P+  A+ G +S++ +R++L  
Sbjct: 11  RFFTRHGPFGLEELARHGGAELRAAVNGSAAPGSFTGIAPLQSATLGQVSFLDNRRYLPL 70

Query: 62  IEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISP 121
           +    A A+I +      +P +   L+S  P  ++A   S+ YP            GI P
Sbjct: 71  LAGTGAGAVIVAPAFADKVPLHAAALVSRTPYQAWARIASLFYPP------PPVNPGIHP 124

Query: 122 QAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS 181
            A +G    I+    I   AV+  GV++G    +G    IG GVRIG  C IGA  +I  
Sbjct: 125 TAVIGTGCVIDPTAAIGAFAVLGDGVQVGAGVDIGTHVSIGPGVRIGARCRIGAHVAISH 184

Query: 182 SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDT 241
           +L+G  V L  G RIG DGFG+A        +  +G V+++D VEIGANS +DRG++ DT
Sbjct: 185 ALLGERVTLLPGARIGQDGFGFAVTPEGFESVPQLGLVVLEDGVEIGANSTVDRGSMRDT 244

Query: 242 IIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNV 301
           +IG  +++DN VQIGHN  +G  CI+VSQ GI+GST +GD V +  Q G+ G++KIG   
Sbjct: 245 VIGAGSRLDNLVQIGHNARLGRCCIVVSQAGISGSTELGDFVTVAAQAGLIGHIKIGTKA 304

Query: 302 QIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           +I ++ GV+ D+ AG    G PA P  E+ R++  L + +K   +
Sbjct: 305 RIGAQCGVMSDVEAGADVIGSPAMPFREFFRNVAFLRRMAKKTTQ 349


>gi|315499839|ref|YP_004088642.1| udp-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Asticcacaulis excentricus CB 48]
 gi|315417851|gb|ADU14491.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Asticcacaulis excentricus CB 48]
          Length = 337

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 118/312 (37%), Positives = 184/312 (58%), Gaps = 10/312 (3%)

Query: 30  NFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLS 89
           +   R +   +P++ A  GD++Y   R++L N+ + +A      +  +  +P+    L++
Sbjct: 31  DLTARRVNGCAPLSVAGQGDVAYFSDRRYLENLRRTRAGFAFVHEADIDHVPEQTLALVT 90

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
             P+ S++   + LY    H      EG   PQA +    +IEDGV +    +V  G EI
Sbjct: 91  RSPQASWSRLAAKLYRPRRH------EG---PQA-IHPTARIEDGVTLGVGVIVGQGAEI 140

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSD 209
           GR +++   +VIG G +IGRNC IGA ++IY +LIG+ V L SGVRIG  GFG +     
Sbjct: 141 GRGSHIEAYTVIGPGCQIGRNCYIGAHATIYCALIGDGVHLASGVRIGEAGFGVSGDHEG 200

Query: 210 IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVS 269
           +  +  +GRV++QD V IGA + +DRG  DDT+IGE +KIDN VQI HNV +G   I+ +
Sbjct: 201 LIDVPQLGRVVLQDHVSIGAGTCVDRGAYDDTVIGEASKIDNMVQIAHNVKLGRNVIVAA 260

Query: 270 QVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGE 329
             G++GS  +GD  + GG+ G+  ++ IG   ++A+ + V KD+PAGQ + G PA+P  +
Sbjct: 261 HSGLSGSVQVGDGAMFGGRAGVIDHIDIGAGAKVAAGAVVFKDVPAGQMWSGFPAKPSRQ 320

Query: 330 YLRHMVMLSKPS 341
           +LR    LSK +
Sbjct: 321 FLRETAWLSKAA 332


>gi|296115050|ref|ZP_06833692.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295978387|gb|EFG85123.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 359

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/345 (35%), Positives = 188/345 (54%), Gaps = 9/345 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFG---ERMIYSLSPIARASTGDISYIISRKFLNN 61
            FFVS       +LA+  GA L               ++P+  A    +S++ +R++L  
Sbjct: 13  RFFVSDGPFDATELARCAGAELQGAGAAIADAPHFTGIAPLQSAGPTQVSFLDNRRYLPL 72

Query: 62  IEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISP 121
           +E+  A A+I +   V  +P +   L+S  P +++A   S  YP      A   + GI P
Sbjct: 73  LEQTGAGAVIVAPAFVDKVPSHAVALVSRTPYLAWARVASRFYP------APPVDPGIHP 126

Query: 122 QAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS 181
            A +GE  +++    I   +V+     IG    +G   ++G GV IG    IG+   +  
Sbjct: 127 TAVIGEGAQVDPSASIGAFSVIGARARIGAGVTLGTHVMVGDGVEIGARSRIGSHVCLSH 186

Query: 182 SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDT 241
           +L+G  V L  GVRIG +GFG+A G      +  +GRVI++D VE+GANS IDRG+I DT
Sbjct: 187 ALLGERVTLLPGVRIGQEGFGFATGPDGFETVPQLGRVILEDGVEVGANSTIDRGSIRDT 246

Query: 242 IIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNV 301
           +IG  +++DN VQIGHN  +G  CI+VSQ GI+GST +GD V +  Q G+ G++KIG   
Sbjct: 247 LIGAGSRLDNLVQIGHNARLGRCCIVVSQAGISGSTELGDFVTVAAQAGLIGHIKIGTKA 306

Query: 302 QIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           +I ++ GV+ D+ AG    G PA P  E+ R++  L + +K   +
Sbjct: 307 RIGAQCGVMSDVEAGADVIGSPAMPFREFFRNVAFLRRLAKKPTQ 351


>gi|329850626|ref|ZP_08265471.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Asticcacaulis biprosthecum C19]
 gi|328840941|gb|EGF90512.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Asticcacaulis biprosthecum C19]
          Length = 354

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 134/348 (38%), Positives = 195/348 (56%), Gaps = 17/348 (4%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASL-LDENFGERMIYSLSPIARASTGDISYIISRKFL 59
           M  L FF     I L ++A      L +    G   + + +P++    G  ++   R++L
Sbjct: 1   MPDLRFFDIGSKIDLDQVAVLTSTRLGVPGRKGSGFVTACAPLSLGGPGKAAFFSDRRYL 60

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
            N+ + +A  +    D +  +P     ++S  P+ S+A   S LY   MH  AS     +
Sbjct: 61  TNLHRTEAEFVFVHSDYIEHVPDKSVPIISPAPQASWARLASRLYRPRMHEGASP----V 116

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
            P       VK EDGV++    V+   VEIG  T +   +VIG GVRIGR+C IGA S+I
Sbjct: 117 HPS------VKREDGVMLGVGVVIGQDVEIGAGTRIEAYAVIGPGVRIGRDCHIGAHSTI 170

Query: 180 YSSLIGNSVILHSGVRIGNDGFGY---ARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRG 236
           Y +L+G+ V L SGVRIG  GFG    ARG+ D+ +   +GRVI+QD V IGA + +DRG
Sbjct: 171 YCALLGDRVQLSSGVRIGEAGFGVSGDARGLVDVPQ---LGRVILQDDVSIGAGTCVDRG 227

Query: 237 TIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLK 296
             +DTI+GE TKIDN VQI HNV IG  CI+ +  G++GS  IGD  + GG+ GI  +++
Sbjct: 228 AFEDTIVGEATKIDNMVQIAHNVRIGRNCIVAAHSGLSGSVRIGDGAMFGGRAGIIDHIE 287

Query: 297 IGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           IG   ++A+ + V KD+  G    G PA+P  ++LR +V L K +  K
Sbjct: 288 IGAGAKVAAGAIVFKDVAPGAMVSGFPAKPSRQFLREVVWLEKNAAVK 335


>gi|302383598|ref|YP_003819421.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302194226|gb|ADL01798.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 333

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/344 (38%), Positives = 199/344 (57%), Gaps = 14/344 (4%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF +   + L  LA   G  ++  +  E  +  ++P+A A  G ++++  RKF  
Sbjct: 2   MPDARFFTTSAPLGLDDLAALTGGEVVRRS--EVAVTRVAPLAEADAGSLAFMADRKFAA 59

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
            +    A  +I     V  +P     ++S + + ++A   + L+ + + +EA+       
Sbjct: 60  ALSASGAGVVIVPPSAVDAVPAGAAVIVSREAQAAWARVAAHLH-RPILLEAAGPS---- 114

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
                  DV  +D VV+ P  VV  G  IGR + +G  +VIG GV+IGR+C IG+G++I 
Sbjct: 115 -------DVCEDDTVVLEPGVVVGIGARIGRGSRIGANTVIGPGVQIGRDCVIGSGATIG 167

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            SLIG+ V +++G RIG  GFG A        I  +GRVI+QD V IGAN+ IDRG   D
Sbjct: 168 FSLIGDRVKIYAGARIGEAGFGAAGAAGGPVDIPQLGRVILQDGVTIGANTCIDRGAYGD 227

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T++GENTKIDN VQIGHN  IG  C+I +  GI+GS  +GDNV+ GG+ GI  ++ IG+ 
Sbjct: 228 TVVGENTKIDNLVQIGHNCIIGRSCLIAAHTGISGSVTVGDNVMFGGKAGIGDHIAIGEG 287

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            ++A+ +GVL DIPAG+ + G PA+PI ++LR  V L++    K
Sbjct: 288 ARVAAGAGVLADIPAGETWSGYPAKPIRQFLREAVWLARQVNRK 331


>gi|319790222|ref|YP_004151855.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thermovibrio ammonificans HB-1]
 gi|317114724|gb|ADU97214.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thermovibrio ammonificans HB-1]
          Length = 336

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 198/344 (57%), Gaps = 28/344 (8%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L ++AQ +G  ++ ++     I  ++ I  A  G I+++ + K+   ++  KASA++  +
Sbjct: 3   LGEIAQVLGCRVIGDD--SVTIKGVAEIHSAGPGQITFLTNPKYRKFLKSTKASAVLVGE 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
              P     +P L+  +P V+FA    +  P+ +         G+S  A + E V+I   
Sbjct: 61  ---PIEGLELPQLVCKEPYVAFAKLLDLFNPETLPAP------GVSDSAHICEGVEIGKD 111

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNS 187
             I P   +  G  IGR+ Y+ PG      V +GRNC IG G+ ++  +       IG +
Sbjct: 112 CYIGPNVYIGEGTVIGREVYLFPG------VYVGRNCRIGDGTVLFPGVKIYDRVKIGRA 165

Query: 188 VILHSGVRIGNDGFGYA--RGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           V +H+G  +G+DGFGYA  +    I+KI   G V+I+D VEIGAN+ IDRGTI DT+IGE
Sbjct: 166 VRIHAGAVVGSDGFGYAFSKEEKKIYKIPQTGGVVIEDLVEIGANTTIDRGTIGDTVIGE 225

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQIGHNV IG  C IVSQVGI+GST IGD V + G+ G+AG+++I  NV +A+
Sbjct: 226 GTKIDNLVQIGHNVKIGRYCFIVSQVGISGSTKIGDFVTLAGKVGVAGHIEIASNVTVAA 285

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKY-KIKR 347
           K+G+ K I     Y G PARP  E+ R   ++ + P  Y KIK 
Sbjct: 286 KAGITKSIKEPGTYAGFPARPYKEWRRIQALVDRLPELYQKIKE 329


>gi|167646757|ref|YP_001684420.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Caulobacter sp. K31]
 gi|189028514|sp|B0SZ11|LPXD_CAUSK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|167349187|gb|ABZ71922.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Caulobacter sp. K31]
          Length = 340

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 188/339 (55%), Gaps = 10/339 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF       L +LA   GA L D   G +++  ++P+  A  G ++++   K L 
Sbjct: 1   MPDPRFFEDLGPATLAELASLSGARLADPATGHQLVSHVAPLESAGPGAVTFLSDPKRLA 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           ++     +      +     P     LL++ P+ S+A A       A  + AS    G  
Sbjct: 61  DLAGLSGAVCFLRPEHAADAPPGCALLLTNHPQASWAAA-------AHRLHASRRHDGAQ 113

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P   +  D ++E+GV++AP  V+  G  IGR T VGPG VIG GV +GR+C IGA + I 
Sbjct: 114 P---VHPDCELEEGVLLAPGVVIGQGARIGRGTQVGPGVVIGPGVAVGRDCRIGANAVIG 170

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +L+G+ V +H+G  IG  GFG A G + +  +  +GRV++QD V IGANS +DRG   D
Sbjct: 171 FALVGDRVSIHAGAVIGEAGFGAAGGPTGVVDLPQLGRVVLQDGVTIGANSCVDRGAFGD 230

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T IGEN+KIDN V + HNV +G  C+  +  GI+GST +GD V  GG+ G+A +L IG  
Sbjct: 231 TTIGENSKIDNLVHVAHNVRLGRNCVAAAFTGISGSTVVGDGVAFGGKAGVADHLTIGAG 290

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             I + + V K +PAG+ + G PARP+  +LR    LS+
Sbjct: 291 ANIGAAASVFKSVPAGETWTGFPARPLKRWLRETAWLSR 329


>gi|297171672|gb|ADI22666.1| hypothetical protein [uncultured Gemmatimonadales bacterium
           HF0500_22O06]
          Length = 360

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 112/330 (33%), Positives = 190/330 (57%), Gaps = 11/330 (3%)

Query: 12  GIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           G+ + ++A+ +G  L  E  G   +  + P+  A  G ++++  +++   +   +AS+ +
Sbjct: 13  GLTMKEIAELVGGKL--EGDGGLWVSGIGPVDEADAGQMAFLARKRYARYVPGSRASSFL 70

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
            S D+  ++P + P ++ ++P  +        +P   H         + P A +G  V++
Sbjct: 71  VSSDLQVYVPSHAPRIIVEEPYRALRTLLKRFHPPQPH------SARVHPTAVIGLGVEL 124

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVIL 190
            +GV + P AV+    +IG    +GP  VIG G  +G+ C +      Y  ++IG+ V++
Sbjct: 125 GNGVSVGPYAVIEDDAQIGDGCRIGPHCVIGRGSSLGKECLLHPQVVTYEETVIGDRVVV 184

Query: 191 HSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           HSGVR+G+DGFG+   V D+H KI  +GR +I+D VEIGAN+ IDRG++ DT++G  +K 
Sbjct: 185 HSGVRLGSDGFGFTL-VDDVHLKIPQVGRCVIEDDVEIGANATIDRGSLGDTVVGRGSKT 243

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V + HNV +G G +  + VG+AGST IG  V +GGQ G++ +L IGD  ++A  + +
Sbjct: 244 DNLVHLAHNVKVGAGSLFAALVGVAGSTRIGKGVWMGGQVGVSDHLDIGDGARLAIATKL 303

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           ++D+P GQ   G PAR   E L+    LS+
Sbjct: 304 MRDVPDGQTVSGHPAREHREQLKKQANLSR 333


>gi|258541754|ref|YP_003187187.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256632832|dbj|BAH98807.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256635889|dbj|BAI01858.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256638944|dbj|BAI04906.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256641998|dbj|BAI07953.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256645053|dbj|BAI11001.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256648108|dbj|BAI14049.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256651161|dbj|BAI17095.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654152|dbj|BAI20079.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 361

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 188/341 (55%), Gaps = 9/341 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFG---ERMIYSLSPIARASTGDISYIISRKFLNN 61
            FF          LA++ GA L+    G   E     ++P+  A   D+S++ +R++   
Sbjct: 14  RFFTRAGPFDAATLAETAGAELVLPKAGAVPEEGFVGIAPLQAAGPRDVSFLDNRRYAPL 73

Query: 62  IEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISP 121
           +E+ KA  +I +      +P     L++  P ++++    + +P+           G+ P
Sbjct: 74  LEQTKAGLVIVAPAFADKVPAGCAALVTGTPYLAWSRVARLFHPRV------PARAGVHP 127

Query: 122 QAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS 181
            A +     I+    I P  VV    EIG    +G  +V+G GV++ ++C IG+  ++  
Sbjct: 128 SACIDPTASIDPTAEIGPFVVVGAKAEIGPGCIIGSHAVVGDGVQLAQDCRIGSHVTLSH 187

Query: 182 SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDT 241
           +++G  VI+  G RIG DGFG+A G      +  +GRV++++ VEIGANS IDRG+++DT
Sbjct: 188 AVLGERVIILPGSRIGQDGFGFAVGPQGFETVPQLGRVVLENDVEIGANSTIDRGSVNDT 247

Query: 242 IIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNV 301
           +IG  +++DN VQIGHN  +G  CI+VSQ GI+GST + D V I  Q G+ G+++IG   
Sbjct: 248 VIGAGSRLDNLVQIGHNARLGRCCIVVSQAGISGSTVLEDYVTIAAQAGLIGHIRIGAKA 307

Query: 302 QIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           +I ++ GV+ DI  G    G PA P  E+ R++ +L K +K
Sbjct: 308 RIGAQCGVMSDIEGGADVIGSPAMPFREFFRNVAVLRKLAK 348


>gi|329114460|ref|ZP_08243222.1| UDP-3-O- glucosamine N-acyltransferase [Acetobacter pomorum DM001]
 gi|326696536|gb|EGE48215.1| UDP-3-O- glucosamine N-acyltransferase [Acetobacter pomorum DM001]
          Length = 361

 Score =  209 bits (533), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 189/341 (55%), Gaps = 9/341 (2%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFG---ERMIYSLSPIARASTGDISYIISRKFLNN 61
            FF          LA++ GA L+    G   E+    ++P+  A   D+S++ +R++   
Sbjct: 14  RFFTRAGPFDAATLAETAGAELVLPKAGALPEKGFVGIAPLQAAGLHDVSFLDNRRYAPL 73

Query: 62  IEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISP 121
           +E+ KA  +I +      +P     L++  P ++++    + +P+           G+ P
Sbjct: 74  LEQTKAGLVIVAPAFADKVPAGCAALVTGTPYLAWSRIARLFHPRV------PARAGVHP 127

Query: 122 QAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS 181
            A +     I+    I P  VV    EIG    +G  +V+G GV++ ++C IG+  ++  
Sbjct: 128 SACIDPTASIDPTAEIGPFVVVGAKAEIGPGCIIGSHAVVGDGVQLAQDCRIGSHVTLSH 187

Query: 182 SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDT 241
           +++G  VI+  G RIG DGFG+A G      +  +GRV++++ VEIGANS IDRG+++DT
Sbjct: 188 AVLGERVIILPGSRIGQDGFGFAVGPQGFETVPQLGRVVLENDVEIGANSTIDRGSVNDT 247

Query: 242 IIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNV 301
           +IG  +++DN VQIGHN  +G  CI+VSQ GI+GST + D V I  Q G+ G+++IG   
Sbjct: 248 VIGAGSRLDNLVQIGHNARLGRCCIVVSQAGISGSTVLEDYVTIAAQAGLIGHIRIGAKA 307

Query: 302 QIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           +I ++ GV+ DI  G    G PA P  E+ R++ +L K +K
Sbjct: 308 RIGAQCGVMSDIEGGADVIGSPAMPFREFFRNVAVLRKLAK 348


>gi|55380588|gb|AAV50032.1| putative UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Candidatus Liberibacter africanus]
          Length = 146

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 123/146 (84%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           MQRL FF+SH+GI+LM LA+ I ASL DE FG++++YSLSPI RA +GDI Y+ SR FL+
Sbjct: 1   MQRLKFFLSHQGISLMDLAKRIRASLSDEKFGKKIVYSLSPIVRALSGDICYVKSRNFLD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           NI+KCKASA+ICS++I  F+P++IPCL+SD PEVSFAIAGSILYP+AM ME+S    GIS
Sbjct: 61  NIDKCKASAVICSEEIKQFVPEHIPCLVSDNPEVSFAIAGSILYPRAMRMESSFVLEGIS 120

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPG 146
           PQAFL +DVKIED VVIAPMAV+  G
Sbjct: 121 PQAFLEKDVKIEDEVVIAPMAVICSG 146


>gi|297171203|gb|ADI22211.1| hypothetical protein [uncultured Gemmatimonadales bacterium
           HF0200_34B24]
 gi|297171319|gb|ADI22324.1| hypothetical protein [uncultured actinobacterium HF0500_01C15]
          Length = 352

 Score =  209 bits (531), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 192/351 (54%), Gaps = 21/351 (5%)

Query: 4   LNFFVSHKGIAL-MKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNI 62
           LN+  +  G  L +  A S+    LD + G   I+ L+P+  A  G+++++  +++   +
Sbjct: 3   LNYQGAEPGAPLTLTQAASLVQGRLDGD-GSIQIHGLAPLDEAGPGEMAFLAMKRYGRLL 61

Query: 63  EKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHM-----EASSFEG 117
               A A + S +    IP     ++ DKP           YP    +     + +    
Sbjct: 62  RTSSAGAYLVSSEFEDLIPTGASKVIVDKP-----------YPALRELLLYFGDEAVLRP 110

Query: 118 GISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGS 177
            +   A +G  V++  GV I P  V+  GV IG  T +G  SV+G+   +GR+  + A  
Sbjct: 111 EVHDTAVIGSRVRLGSGVRIEPFVVIEDGVSIGDGTRLGSHSVVGSNSTVGRDSILHAHV 170

Query: 178 SIY-SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDR 235
            IY  S+IG++V+LHSG RIG+DGFGY   +  IH KI HIGR II+D VEIG+N+ +DR
Sbjct: 171 VIYPRSVIGSNVVLHSGTRIGSDGFGYTE-IEGIHRKIPHIGRAIIEDNVEIGSNTTVDR 229

Query: 236 GTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYL 295
           G+  DT +G  TKIDN VQ+ HNV IG   ++ + VGIAGST IG  V +GG+     +L
Sbjct: 230 GSFGDTRVGTGTKIDNLVQVAHNVQIGARSLLAALVGIAGSTRIGKGVWMGGRASATNHL 289

Query: 296 KIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           +IGD  Q+A  S V+KDI AG+   G PARP  E LR    + +  K + +
Sbjct: 290 EIGDTAQVAFDSTVMKDIKAGETVSGSPARPHREELRRQANVHRLGKLQER 340


>gi|114798725|ref|YP_760482.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Hyphomonas neptunium ATCC 15444]
 gi|119371940|sp|Q0C1B1|LPXD_HYPNA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|114738899|gb|ABI77024.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Hyphomonas neptunium ATCC 15444]
          Length = 338

 Score =  209 bits (531), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 169/278 (60%), Gaps = 10/278 (3%)

Query: 68  SAIICSQDIVPFIPKNIPCLLSDKPEVSF-AIAGSILYPQAMHMEASSFEGGISPQAFLG 126
           +A+  + ++  FIP+ +  L +  P  +  AIA S+  P+  H+  +  E        + 
Sbjct: 67  AAVFVAAEMKHFIPEGVGVLETAFPRNAHSAIASSLFRPR--HLMGAGHE-------LVS 117

Query: 127 EDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGN 186
              +I    ++ P AV+ PG  +G    +G  +VIG GV+IGRN SIGA +SI+ +L+G+
Sbjct: 118 ALAQIHANAIVQPGAVIGPGAAVGEGAVIGANAVIGPGVQIGRNTSIGANASIHCALVGD 177

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
            V + +G RIG  GFG   G        H GRVIIQD V IGANS IDRG  +DTIIGE 
Sbjct: 178 QVTILAGARIGETGFGVLVGPQGAEDSPHFGRVIIQDHVTIGANSCIDRGVFEDTIIGER 237

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
           TKIDN  QI HNV +G G I+ +  GI+GS  +GD  ++GG+ GIA ++K+GD V +A+ 
Sbjct: 238 TKIDNLCQIAHNVVLGRGVIVAAFGGISGSVRVGDGSMLGGRVGIADHVKVGDRVSLAAS 297

Query: 307 SGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           +G+ +D+ +G+ +GG PA+PI +++R +  L K +  K
Sbjct: 298 AGLFRDVDSGETWGGTPAKPIRQWMREVAWLQKQANPK 335


>gi|297172575|gb|ADI23545.1| hypothetical protein [uncultured Gemmatimonadales bacterium
           HF0770_41L09]
          Length = 360

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/330 (33%), Positives = 189/330 (57%), Gaps = 11/330 (3%)

Query: 12  GIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           G+ + ++A+ +G  L  E  G   +  + P+  A  G ++++  +++       +AS+ +
Sbjct: 13  GLTMKEIAELVGGRL--EGDGGLWVSGIGPVDEADAGQMAFLARKRYARYAPGSRASSFL 70

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
            S  +  ++P ++P ++ ++P  +        +P   H         + P A +G  V++
Sbjct: 71  VSSGLQVYVPSHVPRIIVEEPYRALRTLLKRFHPPQPHSVR------VHPTAVIGLGVEL 124

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVIL 190
            +GV + P AV+    +IG    +GP  VIG G  +G+ C +      Y  ++IG+ V++
Sbjct: 125 GNGVSVGPYAVIEDDAQIGDGCRIGPHCVIGRGSSLGKECLLHPQVVTYEETVIGDRVVV 184

Query: 191 HSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           HSGVR+G+DGFG+   V D+H KI  +GR II+D VEIGAN+ IDRG++ DT++G  +K 
Sbjct: 185 HSGVRLGSDGFGFTL-VDDVHLKIPQVGRCIIEDDVEIGANATIDRGSLGDTVVGRGSKT 243

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V + HNV +G G +  + VG+AGST IG  V +GGQ G++ +L IGD  ++A  + +
Sbjct: 244 DNLVHLAHNVKVGAGSLFAALVGVAGSTRIGKGVWMGGQVGVSDHLDIGDGARLAIATKL 303

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           ++D+P GQ   G PAR   E L+    LS+
Sbjct: 304 MRDVPGGQTVSGHPAREHREQLKKQANLSR 333


>gi|226226993|ref|YP_002761099.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gemmatimonas aurantiaca T-27]
 gi|226090184|dbj|BAH38629.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gemmatimonas aurantiaca T-27]
          Length = 360

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 184/331 (55%), Gaps = 9/331 (2%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           +    +A  +G  L+ +  G   ++ ++P+ RA   D+S++   ++       +A+A+I 
Sbjct: 23  VTAADIAAQVGGRLVGD--GTVSLFGVAPLDRAREQDLSFLTHARYTAWFTDSRAAAVIM 80

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           S    P + +    ++ DKP  +     S+L   A          G+   A +     I 
Sbjct: 81  SPQFEPVVGRPAVRIIVDKPMDAMV---SVL---ARFHRREPRAVGVHATAVVSASASIG 134

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
            GV I P AV+   V IG   ++G  +V+GAG  +GR+  + A +++Y  + +G+ V+L 
Sbjct: 135 AGVTIDPYAVIGDDVVIGDGCWIGANAVVGAGSVLGRDVRLHAQATVYPYTELGDRVVLC 194

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG R+G +GFG+    +   +I H GR I++  VEIGANS +DRG++DDTIIG  TKIDN
Sbjct: 195 SGARVGREGFGFVPQANGPVRIPHSGRCILEHDVEIGANSCVDRGSVDDTIIGAGTKIDN 254

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQI HNV +G  C   SQ G+AGST I D V IGGQ G+ G+L IG    +A+++GV  
Sbjct: 255 LVQIAHNVRVGRMCFFASQAGVAGSTRIEDGVQIGGQVGLGGHLTIGSRATVAAQAGVFG 314

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           DIP G+ + G PARP  E LR    L + +K
Sbjct: 315 DIPGGELWSGYPARPHKEALRSQAALHRLAK 345


>gi|148361281|ref|YP_001252488.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Legionella pneumophila str. Corby]
 gi|148283054|gb|ABQ57142.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Legionella pneumophila str. Corby]
          Length = 343

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 129/349 (36%), Positives = 194/349 (55%), Gaps = 17/349 (4%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYS-LSPIARASTGDISYIISRKFL 59
           M    F        L +LA+  GA+L  E  GE    S L+ I+ A++ D+  +  +K++
Sbjct: 1   MSNYQFTKPAGPFRLSELAKISGATLY-EGKGETFTVSGLAKISEATSNDLVMLHQKKYV 59

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSF---E 116
             ++   A + I   D V + P ++  L+   P  +FA+     YP     ++SSF    
Sbjct: 60  KELKNTAARSCIIGPDYVKYAPDSMYLLVHPNPYKAFALIAQAFYPSE---KSSSFIAPS 116

Query: 117 GGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAG 176
             I   A +G D  I  G  I   A       IG++  +G  + IG GV IG NC I   
Sbjct: 117 AKIESTALIGSDCSIAHGAYIGNHA------RIGKRCKIGVNTYIGDGVTIGDNCIIEDN 170

Query: 177 SSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRG 236
            SI  ++IG++V+++ G RIG DGFG+A      +KI H G VII + VEIGAN+ IDRG
Sbjct: 171 VSIRHAVIGSNVVVYPGARIGQDGFGFASDAEGHYKIPHAGGVIIGNDVEIGANTCIDRG 230

Query: 237 TIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLK 296
           ++D+T+I +  ++DN VQIGHNV IG G ++V+QVGIAGST +G++V + GQ G+ G+LK
Sbjct: 231 SLDNTVIEDWCRLDNLVQIGHNVKIGKGSVLVAQVGIAGSTELGEHVTLAGQAGVIGHLK 290

Query: 297 IGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLS---KPSK 342
           IG+   + ++  V KD+  G + GG PA  I ++ + +  L    KP K
Sbjct: 291 IGNGATVLARGVVYKDVKPGDRVGGHPAVSISDWQKQIRFLKTAIKPKK 339


>gi|218888083|ref|YP_002437404.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226740723|sp|B8DSI1|LPXD_DESVM RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|218759037|gb|ACL09936.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 343

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 185/321 (57%), Gaps = 25/321 (7%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPC-LLSDK 91
           +R I  ++ +  A   ++S++ + K+ + +   +A A+I + +        +PC L+S  
Sbjct: 20  DRAIEGVNTLEAAGPAEVSFLANPKYTHLLANTRAGAVIVTAEHA----DAVPCALVSTN 75

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
           P   F   G  L   A+  +      G+S  AF+  + ++ +G        VYP   IG 
Sbjct: 76  PYFDF---GRTL---ALFSKPQGSLSGVSDMAFVHPEAELGEG------CTVYPFAFIGP 123

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYA 204
           +  +G GSV+  GV +G +C +GAG  +Y +        IGN  ILH+GV +G DGFG+A
Sbjct: 124 RARIGAGSVLFPGVYVGEDCRVGAGCLLYPNAVLMAGTEIGNGCILHAGVVLGADGFGFA 183

Query: 205 RGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCG 264
           R    I KI  +G V + + VE+GAN+AIDR  +  T +G++TKIDN VQIGHNV +G  
Sbjct: 184 RTDFGIQKIPQVGTVRLGNDVEVGANTAIDRSVLGVTTVGDSTKIDNLVQIGHNVEMGRN 243

Query: 265 CIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPA 324
           C+IVSQVGI+GST +GD+V + GQ G+AG+L IG+ V +  KSGV K IP G+  GG PA
Sbjct: 244 CLIVSQVGISGSTKVGDDVTMAGQVGVAGHLSIGNGVTLGPKSGVAKSIPDGETMGGAPA 303

Query: 325 RPIGEYLRHMVMLSK-PSKYK 344
                Y+R + ++ K P  YK
Sbjct: 304 VDKATYMRTLTVMPKLPDMYK 324


>gi|208434147|ref|YP_002265813.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Helicobacter pylori G27]
 gi|208432076|gb|ACI26947.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Helicobacter pylori G27]
          Length = 336

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 127/327 (38%), Positives = 187/327 (57%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLNAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK++  L+ D P ++FA A      P   + E+ S      P+ F        +
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVS-----EPKHF--------E 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++VI+H+
Sbjct: 108 KVTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVIIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|254778907|ref|YP_003057012.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori B38]
 gi|254000818|emb|CAX28744.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori B38]
          Length = 336

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 185/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFICK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KEFSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +    ++Y ++++ ++VI+H+G
Sbjct: 109 VTIMPNVMIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVTLYQNTILEDNVIIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|328954378|ref|YP_004371712.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454702|gb|AEB10531.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfobacca acetoxidans DSM 11109]
          Length = 344

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 126/333 (37%), Positives = 182/333 (54%), Gaps = 13/333 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L +LAQ +G         +  +  ++ I +A   +I+++   KF   +E+ +A A I S
Sbjct: 4   TLKELAQLVGGECRGPE--DLPLSGINAIDQAGPHEITFVTRPKFARRVEQSRAGAFIVS 61

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
             +        P L++D P +++A    +  P            G+S QA+LG   ++ +
Sbjct: 62  PHLGHL---GRPLLITDDPYLAYAKIAEVFAPPLWRWP------GVSNQAYLGNACRLGE 112

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHS 192
            V IAP   +   V +G +  + PG V+G GV IG +  +    +I     IGN VI+H 
Sbjct: 113 QVSIAPFVWIGDNVSLGDRAILLPGVVVGNGVSIGADVVLHPNVTIRDGCTIGNRVIIHG 172

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           G  IG DGFG+A      HKI  +G V+I+D VEIGAN  IDRG + DT I    KIDN 
Sbjct: 173 GAVIGADGFGFAPDRESFHKIPQLGSVVIEDDVEIGANCTIDRGALGDTRICRGVKIDNL 232

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQ+ HNV IG   IIV+QVGI+GST +G NV++ GQ G+ G++ IGD V+I ++SGV   
Sbjct: 233 VQVAHNVVIGENSIIVAQVGISGSTQVGRNVMLAGQVGLVGHITIGDGVRIGAQSGVSNS 292

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYK 344
           +PAGQ   G P  P GE+LR + +  K P  Y 
Sbjct: 293 VPAGQTVMGSPVLPHGEFLRMITVQKKLPEMYN 325


>gi|296108620|ref|YP_003620321.1| UDP-3-O-(3-hydroxymyristoyl) [Legionella pneumophila 2300/99 Alcoy]
 gi|295650522|gb|ADG26369.1| UDP-3-O-(3-hydroxymyristoyl) [Legionella pneumophila 2300/99 Alcoy]
          Length = 343

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 189/332 (56%), Gaps = 11/332 (3%)

Query: 15  LMKLAQSIGASLLDENFGERMIYS-LSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L +LA+  GA+L  E  GE    S L+ I+ A++ D+  +  +K++  ++   A + I  
Sbjct: 15  LYELAKISGATLY-EGKGETFTVSGLAKISEATSNDLVMLHQKKYVKELKNTAARSCIIG 73

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            D V F P ++  L+   P  +FA+     YP        +    I   A +G D  I  
Sbjct: 74  PDYVKFAPDSMYLLVHPNPYKAFALIAQAFYPSEKPNSFIATSAMIESTAVIGVDCFIAH 133

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSG 193
           G  I         V+IG +  +G  + IG  V +G +C I    SI  ++IGN+V+++SG
Sbjct: 134 GAYIGNQ------VKIGNRCKIGVNTYIGDAVTLGDDCLIEDNVSIRHAVIGNNVVIYSG 187

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            RIG DGFG+A   +  +KI H G VII + VEIGAN+ IDRG++D+T+I +  ++DN V
Sbjct: 188 ARIGQDGFGFASDANGHYKIPHAGGVIIGNDVEIGANTCIDRGSLDNTVIEDWCRLDNLV 247

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QIGHNV IG G ++V+QVGIAGST +G++V + GQ G+ G+LKIG+   + ++  V KD+
Sbjct: 248 QIGHNVKIGKGSVLVAQVGIAGSTELGEHVTLAGQAGVIGHLKIGNGATVLARGVVYKDV 307

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLS---KPSK 342
             G + GG PA  I ++ + +  L    KP K
Sbjct: 308 KPGDRVGGHPAVSISDWQKQIRFLKTAIKPKK 339


>gi|121535903|ref|ZP_01667700.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thermosinus carboxydivorans Nor1]
 gi|121305522|gb|EAX46467.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thermosinus carboxydivorans Nor1]
          Length = 370

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 179/326 (54%), Gaps = 13/326 (3%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA+ +   +L +  G   +  ++ I  A   DI++ +    L     C+A+A++   
Sbjct: 32  LAELAKLLQGEVLGD--GAVTVTGVTSIDDAGPSDITFAVP-PHLEKAANCRAAAVVIPA 88

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
            +  F PK  P +  D P  +FA    +  P      A + + G+ P A +G+ V++ + 
Sbjct: 89  TVDRF-PK--PAIRVDNPRAAFAQLLELFTP------APAVQRGVHPTAMIGQGVRLGEN 139

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I    V+  G  +G  T + P + IGAG +IG +  I    +I     IG+ VI+HSG
Sbjct: 140 VAIMAYVVIDDGAAVGDNTVIYPHTYIGAGTQIGADTLIYPNVTIREHCRIGSRVIIHSG 199

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG+DGFG+        K+  IG VII+D VEIGAN AIDR T   TI+   TKIDN V
Sbjct: 200 AVIGSDGFGFVTSGGRHKKVPQIGNVIIEDDVEIGANVAIDRATTGSTIVRAGTKIDNLV 259

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
            + HNV IG  C +V+Q GIAGS  +G+NV   GQCG AG+L IGDN   A+++ V+ D+
Sbjct: 260 HLAHNVVIGENCFLVAQTGIAGSAKVGNNVTFAGQCGSAGHLTIGDNCVFAARTAVISDV 319

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSK 339
           PAG  Y G PARP  E+LR    + K
Sbjct: 320 PAGSFYAGFPARPHKEWLRGEAAIHK 345


>gi|317012039|gb|ADU82647.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori Lithuania75]
          Length = 336

 Score =  205 bits (522), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 184/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +    ++Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVTLYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|315586194|gb|ADU40575.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori 35A]
          Length = 336

 Score =  205 bits (522), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 127/326 (38%), Positives = 183/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + RA+  DISYI    +L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDRATPNDISYIDQAHYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PRHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++VI+H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVIIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|317181504|dbj|BAJ59288.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori F57]
          Length = 336

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 126/326 (38%), Positives = 184/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++VI+H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVIIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|225848144|ref|YP_002728307.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644101|gb|ACN99151.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 327

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 138/331 (41%), Positives = 191/331 (57%), Gaps = 22/331 (6%)

Query: 16  MKLAQSIGASLLD---ENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           MKL Q   ASL++   EN  + + I +L  I  A+  D+++I   K L    K KA AI+
Sbjct: 1   MKLTQI--ASLINAKVENLKQDIEIKALKSIESATEQDLTFIKDPKKLT---KTKAGAIL 55

Query: 72  CSQDIVPFIPK-NIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
                  FI   +IP L+ +KP+++F     I YP+         EG IS +A +G++V 
Sbjct: 56  TPS----FIENLDIPQLIVEKPDIAFYKLIEIFYPEERQ------EGFISERAVIGKNVS 105

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVI 189
           I +  VI+   V+   V+IG+ T V P S IG    IG NC I     IY  + IGN+VI
Sbjct: 106 IANSAVISEYVVIKDNVKIGKNTVVYPFSYIGENTEIGDNCIIYPSVVIYKDTKIGNNVI 165

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           +HSG  I +DGFGY +  +   KI H+G+VII+D VEIGAN+ IDR  +D TII   TKI
Sbjct: 166 IHSGAVIASDGFGYYQEGNQRKKIKHVGKVIIEDDVEIGANTTIDRALVDYTIIKRGTKI 225

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V +GHN  IG   ++VSQVGIAGS  IG+NV++ GQ G+A ++ I DNV + +KSGV
Sbjct: 226 DNLVMVGHNCKIGENTVLVSQVGIAGSCNIGNNVILAGQVGVADHITITDNVIVTAKSGV 285

Query: 310 LKDIPAGQQYG-GMPARPIGEYLRHMVMLSK 339
              I     YG  + A    ++ R M ++ K
Sbjct: 286 GSSITESGIYGSSINAIEWKKWKRVMSVIYK 316


>gi|163783992|ref|ZP_02178956.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N acyltransferase
           [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880739|gb|EDP74279.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N acyltransferase
           [Hydrogenivirga sp. 128-5-R1-1]
          Length = 328

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/330 (39%), Positives = 190/330 (57%), Gaps = 14/330 (4%)

Query: 13  IALMKLAQSIGASLLDENFGE-RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           + L K+A+     L   NF E + I  +S +  A+  DIS++  +K  + ++K KA+A+ 
Sbjct: 1   MKLSKIAEIFNGQLY--NFKEDKEITGVSSLFNATENDISFLSDKKLSDLLKKTKAAAVF 58

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
             +   PF   ++  ++ + P+V+F     ILYP         F+   +  A +G+ V+I
Sbjct: 59  VKE---PFEDVDVVQIVVNNPQVAFYKLIDILYPD------EKFKYRKAKTAKIGKKVEI 109

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVIL 190
            + V I    V+   V+IG  T + P + IG    IG +C I    SIY  + IG+ VI+
Sbjct: 110 GENVYIGDYVVIEDNVKIGNNTVIYPFTFIGKNTEIGNDCVIYPRVSIYKDTKIGSRVII 169

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           HSG  I +DGFGY +      KI HIG+VII+D VEIGAN  IDR  +D+T+I + TKID
Sbjct: 170 HSGTVIASDGFGYYQENGKHRKIKHIGKVIIEDDVEIGANVTIDRAMLDETVIKQGTKID 229

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N V IGHNV IG   I+VSQVGIAGS+ +G+N ++ GQ G+A ++ I DNV I +KSGV 
Sbjct: 230 NLVMIGHNVQIGENTILVSQVGIAGSSKVGNNCILAGQVGVADHITITDNVIITAKSGVG 289

Query: 311 KDIPAGQQYG-GMPARPIGEYLRHMVMLSK 339
           K+I     YG G+ A    ++ + +  L K
Sbjct: 290 KNIDKAGVYGSGISAVEWSKWKKVLFYLYK 319


>gi|268679918|ref|YP_003304349.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Sulfurospirillum deleyianum DSM 6946]
 gi|268617949|gb|ACZ12314.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Sulfurospirillum deleyianum DSM 6946]
          Length = 317

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 130/329 (39%), Positives = 193/329 (58%), Gaps = 20/329 (6%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L  LAQ++  +   E   ++ + S +P+  A++  IS++   K L++++  KA A+I 
Sbjct: 2   MKLSFLAQTMQLAFEGE---DKEVRSFAPLKDATSEHISFLSDPKLLDDLKTTKAGAVIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           S     F+P +   L+SD P +S A A S L+ +A     +S    ISP+A +   V I 
Sbjct: 59  SPAFEGFVPSHCRLLVSDNPYLSMAYA-SKLFAKAPF--DTSMPSNISPKAHVSHHVSI- 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILH 191
                   +VV  G      +Y+ P   IGA VRIG+N +I     IY +++IG+S ++ 
Sbjct: 115 -----GSRSVVEEG------SYIMPNVSIGADVRIGKNVTIYPNVVIYDNAIIGDSCMIQ 163

Query: 192 SGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           +G  IG+DGFGYA   +  H KI H G VI++++VEIGANS IDR     TII + TKID
Sbjct: 164 AGAVIGSDGFGYAHTKTGEHVKIYHHGNVILEEEVEIGANSTIDRAVFGSTIIKKGTKID 223

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGHN  +G   IIV+Q G+AGS+ +G NV++GGQ   AG+L+IGD   IA++ GV 
Sbjct: 224 NLVQIGHNCEVGAYSIIVAQAGLAGSSKLGRNVVMGGQSATAGHLEIGDFATIAARGGVS 283

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           K I  G+ YGG P     E+L++   L++
Sbjct: 284 KSIEGGKVYGGFPLTLQSEWLKNNAKLAR 312


>gi|15644825|ref|NP_206995.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori 26695]
 gi|6685610|sp|O24991|LPXD_HELPY RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|2313283|gb|AAD07263.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase (lpxD)
           [Helicobacter pylori 26695]
          Length = 336

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 183/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLNAYSIETEFSNDFEVHALAELNKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK +  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKRMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------ER 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +    ++Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVTLYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|54295783|ref|YP_128198.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Legionella pneumophila str. Lens]
 gi|81601142|sp|Q5WSK5|LPXD2_LEGPL RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|53755615|emb|CAH17117.1| hypothetical protein lpl2873 [Legionella pneumophila str. Lens]
          Length = 343

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 185/332 (55%), Gaps = 11/332 (3%)

Query: 15  LMKLAQSIGASLLDENFGERMIYS-LSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L +LA+ I  S L E  GE    S L+ ++ A+T ++  +  +K+L  ++   A A I  
Sbjct: 15  LAELAE-ISGSTLYEGKGEAFTVSGLAKLSEATTHNLVMLHQKKYLKELKNTAARACIIG 73

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            + V F P ++  L+   P  +FA+     YP        +    I   A +G +  I  
Sbjct: 74  PEYVKFAPDSMYLLVHPNPYKAFALIAQAFYPSEKPAGFIASSAAIETSAVIGSNCYIAH 133

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSG 193
           GV I   A +  G +IG  TY      IG GV IG +C I    SI  ++IG  V+++ G
Sbjct: 134 GVYIGNNAKIGSGCQIGVNTY------IGDGVTIGDDCLIEDNVSIRHAVIGKHVVIYPG 187

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            RIG DGFG+A   S  +KI H G VII + VEIGAN+ IDRG++D+T+I +  ++DN V
Sbjct: 188 ARIGQDGFGFASDASGHYKIPHAGGVIIGNHVEIGANTCIDRGSLDNTVIEDWCRLDNLV 247

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           Q+GHNV IG G IIV+QVGIAGST +G+ V + GQ G+ G+LKIG    + +   V K++
Sbjct: 248 QVGHNVKIGKGSIIVAQVGIAGSTELGEYVTLAGQAGVIGHLKIGKGATVLASGKVYKNV 307

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLS---KPSK 342
            +G + GG PA  I ++ + +  L    KP K
Sbjct: 308 KSGDRVGGHPAVSISDWQKQIRFLKTAIKPKK 339


>gi|261837645|gb|ACX97411.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Helicobacter pylori 51]
          Length = 336

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/326 (38%), Positives = 187/326 (57%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  +A A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSQAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA        +A H     F    +P++    D K  + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFA--------KASHAFKIPFFK--NPESM--NDPKHFEK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GVRIG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVRIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEYSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|307636886|gb|ADN79336.1| UDP-3-O-3-hydroxy myristoyl glucosamine N-acetyltransferase
           [Helicobacter pylori 908]
 gi|325995475|gb|ADZ50880.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Helicobacter pylori 2018]
 gi|325997073|gb|ADZ49281.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Helicobacter pylori 2017]
          Length = 336

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 189/327 (57%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQVRYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK++  L+ D P ++FA ++ +   P   + ++ S      P+ F        +
Sbjct: 61  KESSKVPKSMQALIVDNPHLAFAKVSHAFKIPFFKNPQSVS-----EPKHF--------E 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++VI+H+
Sbjct: 108 KVTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILEDNVIIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|120601942|ref|YP_966342.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio vulgaris DP4]
 gi|120562171|gb|ABM27915.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Desulfovibrio vulgaris DP4]
          Length = 344

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/342 (36%), Positives = 187/342 (54%), Gaps = 34/342 (9%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC-- 72
           L ++A  +G  L  E+   R +  ++ +  A   +IS++ + +++  +   +A A+I   
Sbjct: 5   LSEIAGLLGLELRGED---REVSGVNTLEAAGPDEISFLANPRYMGQLSTTRAGAVIVAA 61

Query: 73  --SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
             +QD+          L+S  P   F    ++   +    E  S +  + P+A +GE   
Sbjct: 62  EHAQDVA-------VALVSANPYFDFGRTLALFARKQGSFEGVSEQAVVHPEAVVGEG-- 112

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
                       VYP V IG +  +G G+V+  G  IG +C +G G ++Y ++       
Sbjct: 113 ----------CTVYPHVYIGPRARIGAGTVLFPGCYIGEDCVVGGGCTLYPNVVLMAGVE 162

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG+  ILH+GV +G DGFG+AR    I KI  +G V I   VEIGAN+ IDR  +  T +
Sbjct: 163 IGDDCILHAGVVLGADGFGFARTEFGIQKIPQVGTVRIGSDVEIGANTTIDRSVLGVTTV 222

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G+ TKIDN V +GHNV +G  C+IVSQVGI+GST +GD+V + GQ G+AG+L IG  V I
Sbjct: 223 GDGTKIDNLVMLGHNVEMGRNCLIVSQVGISGSTKVGDDVTMAGQVGVAGHLSIGSGVTI 282

Query: 304 ASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYK 344
             KSGV KDIPAG+  GG PA     Y+R + ++ K P  YK
Sbjct: 283 GPKSGVAKDIPAGETVGGAPAVDKSTYMRTLTVMPKLPDMYK 324


>gi|258406349|ref|YP_003199091.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Desulfohalobium retbaense DSM 5692]
 gi|257798576|gb|ACV69513.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Desulfohalobium retbaense DSM 5692]
          Length = 346

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 185/327 (56%), Gaps = 25/327 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA ++G   L     ++ I  ++ +  A   DIS++ + K+   ++  +A A+I 
Sbjct: 1   MKLSELASTLG---LAYQGPDKEIRGVATLEEAGPEDISFLANPKYAGMLQSTRAGAVIL 57

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           ++    F  +    L+S+ P + FA A  +           S +  I P+A + +D    
Sbjct: 58  AER---FGEQTTTALVSENPYLDFARAVQLFAKPQGSFNGHSQQAWIHPEAEVADD---- 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
                   AVVYP V +G    VG G+ + +GV +G +C +G    IY ++       +G
Sbjct: 111 --------AVVYPFVSVGAGARVGSGTTLFSGVYVGEDCQLGPNCVIYPNVTLMAGTQLG 162

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
             VILH+GV +G+DGFG+A   +   K   +GRV++ D VEIGAN+ +DR  + +T IG 
Sbjct: 163 QGVILHAGVVLGSDGFGFAEAAAGREKFPQVGRVVVGDNVEIGANTCVDRAALGETRIGS 222

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            +KIDN VQ+GHNV +G  CI+VSQVGIAGST +G NV+I GQ G+AG+L+IG+  ++ +
Sbjct: 223 GSKIDNLVQLGHNVQVGENCILVSQVGIAGSTKLGRNVIIAGQVGVAGHLEIGEGCRVGA 282

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLR 332
           KSGV + +P G    G+PA     +L+
Sbjct: 283 KSGVGRSLPPGTDVSGIPAMDHATFLK 309


>gi|332673037|gb|AEE69854.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori 83]
          Length = 336

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 185/332 (55%), Gaps = 28/332 (8%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILY------PQAMHMEASSFEGGISPQAFLGED 128
                +PK++  L+ D P ++FA A           P+ M+           P+ F    
Sbjct: 61  KESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPENMN----------EPKHF---- 106

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNS 187
               + V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++
Sbjct: 107 ----EKVTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDN 162

Query: 188 VILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
           V +H+G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E 
Sbjct: 163 VTIHAGSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEG 222

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
            KIDN VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  K
Sbjct: 223 VKIDNLVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGK 282

Query: 307 SGVLKDIPAGQQY-GGMPARPIGEYLRHMVML 337
           S V KD+P    + G +PA  I E+   +  L
Sbjct: 283 SAVGKDLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|46580774|ref|YP_011582.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|60390040|sp|Q729I2|LPXD_DESVH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|46450194|gb|AAS96842.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Desulfovibrio vulgaris str. Hildenborough]
 gi|311234483|gb|ADP87337.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio vulgaris RCH1]
          Length = 344

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/342 (36%), Positives = 187/342 (54%), Gaps = 34/342 (9%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC-- 72
           L ++A  +G  L  E+   R +  ++ +  A   +IS++ + +++  +   +A A+I   
Sbjct: 5   LSEIAGLLGLELRGED---REVSGVNTLEAAGPDEISFLANPRYMGQLSTTRAGAVIVAA 61

Query: 73  --SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
             +QD+          L+S  P   F    ++   +    E  S +  + P+A +GE   
Sbjct: 62  EHAQDVA-------VALVSANPYFDFGRTLALFARKQGSFEGVSEQAVVHPEAVVGEG-- 112

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
                       VYP V IG +  +G G+V+  G  IG +C +G G ++Y ++       
Sbjct: 113 ----------CAVYPHVYIGPRARIGAGTVLFPGCYIGEDCVVGGGCTLYPNVVLMAGVE 162

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG+  ILH+GV +G DGFG+AR    I KI  +G V I   VEIGAN+ IDR  +  T +
Sbjct: 163 IGDDCILHAGVVLGADGFGFARTEFGIQKIPQVGTVRIGSDVEIGANTTIDRSVLGVTTV 222

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G+ TKIDN V +GHNV +G  C+IVSQVGI+GST +GD+V + GQ G+AG+L IG  V I
Sbjct: 223 GDGTKIDNLVMLGHNVEMGRNCLIVSQVGISGSTKVGDDVTMAGQVGVAGHLSIGSGVTI 282

Query: 304 ASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYK 344
             KSGV KDIPAG+  GG PA     Y+R + ++ K P  YK
Sbjct: 283 GPKSGVAKDIPAGETVGGAPAVDKSTYMRTLTVMPKLPDMYK 324


>gi|308183996|ref|YP_003928129.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori SJM180]
 gi|308059916|gb|ADO01812.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori SJM180]
          Length = 336

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 183/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKSMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|317177010|dbj|BAJ54799.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori F16]
          Length = 336

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 183/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + RA+  DISYI   ++L  ++  +A A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDRATPNDISYIDQARYLKLLKDSQAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPKSVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|308182368|ref|YP_003926495.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori PeCan4]
 gi|308064553|gb|ADO06445.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori PeCan4]
          Length = 336

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F          
Sbjct: 61  KESSKVPKSMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------KK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++L+ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTLLEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|210134398|ref|YP_002300837.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori P12]
 gi|210132366|gb|ACJ07357.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Helicobacter pylori P12]
          Length = 336

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 125/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELNKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK +  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKRMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|224437163|ref|ZP_03658144.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter cinaedi CCUG 18818]
 gi|313143628|ref|ZP_07805821.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter cinaedi CCUG 18818]
 gi|313128659|gb|EFR46276.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter cinaedi CCUG 18818]
          Length = 325

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/311 (38%), Positives = 177/311 (56%), Gaps = 17/311 (5%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           ++P+  A+   ISYI   K+++++   +A A++  +++   +P +I  L+   P ++FA+
Sbjct: 30  IAPLESATHTQISYIDQDKYISSLADSQAGAVLIRKELESQVPSHIQPLIVTNPHLAFAL 89

Query: 99  AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPG 158
              +        +    +G I P             V +AP   +     IG+ + + PG
Sbjct: 90  LSHLFASSDFSQQT---QGSIHPS------------VKLAPNVSIGENSSIGQDSSLMPG 134

Query: 159 SVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHI 216
            VIG  VRIG+NC I     IY ++ IG++VI+H+G  IG DGFGYA      H KI H 
Sbjct: 135 VVIGDNVRIGKNCKIYPNVVIYGNTHIGDNVIIHAGSIIGCDGFGYAHTDKGEHIKITHN 194

Query: 217 GRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS 276
           GRV+I+D VEIGAN+ IDR    +TII +  KIDN VQIGHN  IG   I+VSQVG+AGS
Sbjct: 195 GRVVIEDDVEIGANNTIDRAVFGETIIKKGAKIDNLVQIGHNCVIGEHSILVSQVGLAGS 254

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVM 336
           T  G NV+ GGQ G  G++ IGD VQ+A +  V K++PA  ++GG P   + E+++  V 
Sbjct: 255 TTTGRNVIFGGQAGTGGHIHIGDFVQVAGRGAVGKNLPANTKWGGHPLMELDEWMKFYVS 314

Query: 337 LSKPSKYKIKR 347
           L +  K    R
Sbjct: 315 LRRMLKKSTPR 325


>gi|317010474|gb|ADU84221.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori SouthAfrica7]
          Length = 336

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 184/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISY+   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLNAYSIETEFSNDFEVHALAELDKATPNDISYVDQARYLKFLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK +  L+ D P ++FA A S  +         S  G   P+ F        + 
Sbjct: 61  KESSKVPKRMQALVVDNPHLAFAKA-SHAFKVPFFKNPESVSG---PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVIIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|94987463|ref|YP_595396.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Lawsonia intracellularis PHE/MN1-00]
 gi|119371941|sp|Q1MPK2|LPXD_LAWIP RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|94731712|emb|CAJ55075.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Lawsonia intracellularis PHE/MN1-00]
          Length = 341

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 187/315 (59%), Gaps = 26/315 (8%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           ++ +  AS  +IS++ + K+++ +   +A AII S++    +P+    L+S +P   F  
Sbjct: 27  VNTLQDASPNEISFLANAKYIHQLVLSQAGAIILSKEYASRVPR---ALISTEPYRDFGR 83

Query: 99  AGSIL-YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGP 157
             S+   PQ        F+G IS QA++    ++      +  A +YP V IG  T +  
Sbjct: 84  VLSLFSIPQG------CFDG-ISHQAYIHPTAQV------SKTATIYPFVFIGSHTVIEE 130

Query: 158 GSVIGAGVRIGRNCSIGAGSSIY-------SSLIGNSVILHSGVRIGNDGFGYARGVSDI 210
            + +  GV IG +C IG   +IY       ++ IGN  I+H+GV +G+DGFG+A    + 
Sbjct: 131 NTTLFPGVYIGEHCHIGKNCTIYPNTVLMANTSIGNDCIIHAGVVLGSDGFGFAL-TEEK 189

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  +G VII+DKVEIGAN+ +DRGT+  T I ENTKIDN VQIGH V +G   +IVSQ
Sbjct: 190 QKIPQVGNVIIKDKVEIGANTTVDRGTLGTTTINENTKIDNLVQIGHGVTVGKNTVIVSQ 249

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
           VGI+GST IGDN ++ GQ GI+G+L IG+NV I  +SG+ K+IP  Q  GG PA     +
Sbjct: 250 VGISGSTSIGDNCILAGQAGISGHLTIGNNVTIGPQSGIGKNIPDNQILGGSPAVDRQTF 309

Query: 331 LRHMVMLSK-PSKYK 344
           L+  V++ + P  +K
Sbjct: 310 LKTSVLMPRFPELFK 324


>gi|307611831|emb|CBX01544.1| hypothetical protein LPW_32311 [Legionella pneumophila 130b]
          Length = 343

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 182/331 (54%), Gaps = 9/331 (2%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA+  GA+L +       +  L+ ++ A+T ++  +  +K+L  ++   A A I   
Sbjct: 15  LAELAEISGATLYEGKGEAFTVSGLAKLSEATTHNLVMLHQKKYLKELKNTAARACIIGP 74

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
           + V F P ++  L+   P  +FA+     YP        +    I   A +G    I  G
Sbjct: 75  EYVKFAPDSMYLLVHPNPYKAFALIAQAFYPSEKPAGFIASSAVIETSAVIGSSCYIAHG 134

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGV 194
             I   A +  G +IG  TY      IG GV IG +C I    SI  ++IG  V+++ G 
Sbjct: 135 TYIGNNAKIGSGCQIGVNTY------IGDGVTIGDDCLIEDNVSIRHAVIGKHVVIYPGA 188

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
           RIG DGFG+A   S  +KI H G VII + VEIGAN+ IDRG++D+T+I +  ++DN VQ
Sbjct: 189 RIGQDGFGFASDASGHYKIPHAGGVIIGNHVEIGANTCIDRGSLDNTVIEDWCRLDNLVQ 248

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           +GHNV IG G IIV+QVGIAGST +G+ V + GQ G+ G+LKIG    + +   V K++ 
Sbjct: 249 VGHNVKIGKGSIIVAQVGIAGSTELGEYVTLAGQAGVIGHLKIGKGATVLASGKVYKNVK 308

Query: 315 AGQQYGGMPARPIGEYLRHMVMLS---KPSK 342
           AG + GG PA  I ++ + +  L    KP K
Sbjct: 309 AGDRVGGHPAVSISDWQKQIRFLKTAIKPKK 339


>gi|152990559|ref|YP_001356281.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitratiruptor sp. SB155-2]
 gi|151422420|dbj|BAF69924.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitratiruptor sp. SB155-2]
          Length = 323

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 185/332 (55%), Gaps = 19/332 (5%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  +A   G  L+ EN   + I  L  + +A   ++S++ ++K+++ ++K KA AII 
Sbjct: 5   IDLQSIADRFGFELVGEN---KTITRLQSLDKAREDELSFLENKKYIHELQKTKAGAIIL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            ++ + ++P  +  LLSD+P ++ A    +     M         G  P+  +GE+ +I 
Sbjct: 62  KKEHLSYLPTGVSALLSDEPYLALAFVSRLFAKPPMQTS------GKPPK--IGENCQIA 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILH 191
             V I   +V      IG    + PG VIG  V IG N  +    ++Y   +IGN+ I+H
Sbjct: 114 QNVSIGYDSV------IGDNVTLMPGVVIGDNVTIGSNTILYPNVTVYRDCVIGNNCIIH 167

Query: 192 SGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           +G  IG+DG+G+A      H KI   G VII+D VEIGAN  IDR   D T+I   TK+D
Sbjct: 168 AGTVIGSDGYGFAHTKEGKHVKIYQNGNVIIEDDVEIGANCTIDRAVFDSTVIKSGTKLD 227

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N +QI HN  IG   ++ SQVGI+GS+ +G NV++GGQ   AG+L+IGD   IA++ GV 
Sbjct: 228 NLIQIAHNCEIGENVLMASQVGISGSSKLGRNVVMGGQSATAGHLEIGDFAVIAARGGVT 287

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           K IP GQ Y G P     E+L+   +L++  K
Sbjct: 288 KSIPGGQTYAGFPLMLHKEWLKLQALLARLVK 319


>gi|261839058|gb|ACX98823.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Helicobacter pylori 52]
          Length = 336

 Score =  202 bits (514), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 183/326 (56%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  +A A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAKLDKATPNDISYIDQTRYLKLLKDSQAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|298736862|ref|YP_003729392.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori B8]
 gi|298356056|emb|CBI66928.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori B8]
          Length = 336

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK +  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKRMQALIVDNPHLAFAKASHAFKIPFFKNPQSVSE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVMIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|317009846|gb|ADU80426.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori India7]
          Length = 336

 Score =  202 bits (514), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK +  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKRMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVMIGEGVEIGENSLIHPGVVIADGVKIGKNCILYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|297379419|gb|ADI34306.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori v225d]
          Length = 336

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAQLDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P   +  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVTIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|308063058|gb|ADO04945.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori Sat464]
          Length = 336

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F          
Sbjct: 61  KESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------KK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVIIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|297171249|gb|ADI22256.1| hypothetical protein [uncultured Gemmatimonadales bacterium
           HF0200_36I24]
 gi|297171368|gb|ADI22372.1| hypothetical protein [uncultured nuHF2 cluster bacterium
           HF0500_02A10]
          Length = 352

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 118/332 (35%), Positives = 185/332 (55%), Gaps = 9/332 (2%)

Query: 9   SHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKAS 68
            H G  L KLA  +   ++     +  I  ++ +A A   ++  +  RK+L  +    A 
Sbjct: 4   DHMGHTLEKLASLVDGRVVGN--ADLHIKGIATLAHAKPDELGLLSDRKYLKGLSNSNAG 61

Query: 69  AIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGED 128
           A++ S+DI P    +   L+ D P  + A+     +P+   +       GI P A +GE 
Sbjct: 62  ALLVSRDIDPEAIGSPNRLVVDDPRNALAVLIEHFHPEPDRIP------GIHPTAVIGER 115

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
           V+    + + P  VV   V IG +  +    V+    RIG + ++     +Y  + +GN 
Sbjct: 116 VQFGVNISVGPYVVVGNDVVIGDRVTLHAHVVVQQRARIGNDSTLHPHVVLYPEVQLGNR 175

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
           VILH+GVR+G DGFGY     ++ KI H+G  +I D VEIGANS +DRGTI +T IG  T
Sbjct: 176 VILHAGVRVGVDGFGYTPSDGEMKKIPHVGLCLIGDDVEIGANSCVDRGTIGNTEIGNQT 235

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           K+DN V I HNV +G   ++ + VGIAGST IGD+ + GGQ G  G+L+IGD +++A+++
Sbjct: 236 KLDNLVHIAHNVKVGSHNLMAAMVGIAGSTVIGDDTMWGGQSGAMGHLEIGDGIKVAAQA 295

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           G+  D+ +G +  G PARPI ++L+   +L +
Sbjct: 296 GLTNDVSSGSKVAGFPARPIKDFLKANAVLYR 327


>gi|78356419|ref|YP_387868.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78218824|gb|ABB38173.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 347

 Score =  202 bits (513), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 126/345 (36%), Positives = 194/345 (56%), Gaps = 29/345 (8%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            +MK++   GA  L     +R I  ++ +  A   +IS++ + K++  +   +A+A+I S
Sbjct: 4   TVMKVSDIAGALGLKLKGPDREISGVNTLEAAGPEEISFLANPKYIPMLAGTRAAAVIVS 63

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEAS---SFEGGISPQAFLGEDVK 130
           ++    +      L+S  P   F         + +H+ A    SF G IS  A++  + +
Sbjct: 64  EEYAGQVET---ALISANPYFDFG--------RTLHLFARPQGSFSG-ISDMAYIHPEAE 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-------SSL 183
           I  G  I      YP V IG +  +G G+ +  G  +G +C++G    +Y       ++ 
Sbjct: 112 IGGGCTI------YPHVYIGARARIGEGTTLFPGCYVGEDCAVGENCLLYPNVTLMAATT 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           +G+  +LHSGV +G DGFG+AR    I KI  IGRV + + VEIGAN+AIDR  +  T I
Sbjct: 166 VGDDCVLHSGVVLGADGFGFARTEYGIQKIPQIGRVHVGNDVEIGANTAIDRAVLGVTTI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G+ TK+DN VQ+GHNV IG  C+IV+QVGI+GST++GD V + GQ G+AG+L IGD+V +
Sbjct: 226 GDGTKMDNLVQVGHNVTIGNDCLIVAQVGISGSTHVGDRVTMAGQVGVAGHLTIGDDVTV 285

Query: 304 ASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYKIKR 347
             KSG+ + I  G+  GG PA     Y+R + ++ K P  YK  R
Sbjct: 286 GPKSGIARSIEPGKTMGGQPAVERDVYMRTLTVMPKLPDMYKRLR 330


>gi|308061486|gb|ADO03374.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori Cuz20]
          Length = 336

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAQLDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F          
Sbjct: 61  KESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------KK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVIIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|317179407|dbj|BAJ57195.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori F30]
          Length = 336

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L  + +A+  DISYI   ++L  ++  +A A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALVELDKATPNDISYIDQTRYLKLLKDSQAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|119371931|sp|Q312H3|LPXD_DESDG RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
          Length = 342

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 126/343 (36%), Positives = 193/343 (56%), Gaps = 29/343 (8%)

Query: 16  MKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           MK++   GA  L     +R I  ++ +  A   +IS++ + K++  +   +A+A+I S++
Sbjct: 1   MKVSDIAGALGLKLKGPDREISGVNTLEAAGPEEISFLANPKYIPMLAGTRAAAVIVSEE 60

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEAS---SFEGGISPQAFLGEDVKIE 132
               +      L+S  P   F         + +H+ A    SF G IS  A++  + +I 
Sbjct: 61  YAGQVET---ALISANPYFDFG--------RTLHLFARPQGSFSG-ISDMAYIHPEAEIG 108

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-------SSLIG 185
            G  I      YP V IG +  +G G+ +  G  +G +C++G    +Y       ++ +G
Sbjct: 109 GGCTI------YPHVYIGARARIGEGTTLFPGCYVGEDCAVGENCLLYPNVTLMAATTVG 162

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           +  +LHSGV +G DGFG+AR    I KI  IGRV + + VEIGAN+AIDR  +  T IG+
Sbjct: 163 DDCVLHSGVVLGADGFGFARTEYGIQKIPQIGRVHVGNDVEIGANTAIDRAVLGVTTIGD 222

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TK+DN VQ+GHNV IG  C+IV+QVGI+GST++GD V + GQ G+AG+L IGD+V +  
Sbjct: 223 GTKMDNLVQVGHNVTIGNDCLIVAQVGISGSTHVGDRVTMAGQVGVAGHLTIGDDVTVGP 282

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYKIKR 347
           KSG+ + I  G+  GG PA     Y+R + ++ K P  YK  R
Sbjct: 283 KSGIARSIEPGKTMGGQPAVERDVYMRTLTVMPKLPDMYKRLR 325


>gi|77918857|ref|YP_356672.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pelobacter carbinolicus DSM 2380]
 gi|119371949|sp|Q3A555|LPXD_PELCD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|77544940|gb|ABA88502.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pelobacter carbinolicus DSM 2380]
          Length = 343

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 189/334 (56%), Gaps = 15/334 (4%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L +LA+ IG  ++ +  G  ++  ++PI  A  GDI+++ + K+L  ++   ASA+I  
Sbjct: 3   TLNELAELIGGEVVGD--GSVVLNRMAPIESAGPGDITFVANPKYLAKLKDTTASAVIVK 60

Query: 74  QDI-VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             I  P     +  L+   P ++FA   + L+ Q    +       + P A LG DV + 
Sbjct: 61  AGIECP----GVNLLICANPYLAFAKVLTALHAQRPAPQGVMDGAWVDPSAELGADVTVH 116

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
            G V+         V +GR T + PG V+   V++G +C + AG  +     +GN V++ 
Sbjct: 117 PGCVVGK------NVRVGRGTILYPGVVLYDDVQVGEDCLVHAGVLVREQCRLGNRVVVQ 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
            G  IG+DGFG+A      +KI  +G V I+D VE+GAN  IDR  +  T+I   TKIDN
Sbjct: 171 PGAVIGSDGFGFAPDGKSYYKIPQVGIVAIEDDVEVGANVCIDRAAMGVTLIKRGTKIDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQI HNV IG   I+V+QVGIAGS+ +GD+  +GGQ G++G+LKIGDN  + ++SG++ 
Sbjct: 231 LVQIAHNVSIGEDTILVAQVGIAGSSKVGDHCTLGGQVGVSGHLKIGDNTMVGAQSGIIS 290

Query: 312 DIPAGQQYGGMPARPIGEYLRHMV-MLSKPSKYK 344
           D+PAGQ + G P  P  E+L+    M S P+  K
Sbjct: 291 DLPAGQVFSGTPTMPHREWLKASASMRSLPAMRK 324


>gi|317013614|gb|ADU81050.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori Gambia94/24]
          Length = 336

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 123/327 (37%), Positives = 188/327 (57%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DI YI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDIGYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK++  L+ D P ++FA ++ +   P   + ++ +      P+ F        +
Sbjct: 61  KESSKVPKSMQALIVDNPHLAFAKVSHAFKIPFFKNPQSVN-----EPKHF--------E 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ +SVI+H+
Sbjct: 108 KVTIMPNVMIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILEDSVIIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|119371909|sp|Q5ZRD8|LPXD2_LEGPH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
          Length = 343

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 187/331 (56%), Gaps = 8/331 (2%)

Query: 15  LMKLAQSIGASLLDENFGERMIYS-LSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L +LA+  GA+L  E  GE    S L+ ++ A++ D+  +  +K++  ++   A   I  
Sbjct: 15  LFELAKISGATLY-EGKGETFTVSGLAKLSEATSNDLVMLHQKKYVKELKHTAARVCIIG 73

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            D V + P ++  L+   P  +FA+     YP        +    I   A +G D  I  
Sbjct: 74  PDYVKYAPDSMYLLVHPNPYKAFALIAQAFYPSEKPPGFIATSAMIESSAIIGVDCFIAH 133

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSG 193
           G  I         V+IG +  +G  + IG  V IG +C I    SI  ++IGN+V+++SG
Sbjct: 134 GAYIGNQ------VKIGNRCKIGVNTYIGDTVTIGDDCLIEDNVSIRHAVIGNNVVIYSG 187

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            RIG DGFG+A   +  +KI H G VII + VEIGAN+ IDRG++D+T+I +  ++DN V
Sbjct: 188 ARIGQDGFGFASDANGHYKIPHAGGVIIGNDVEIGANTCIDRGSLDNTVIEDWCRLDNLV 247

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QIGHNV IG G ++V+QVGIAGST +G++V + GQ G+ G+LKIG    + + + V K++
Sbjct: 248 QIGHNVKIGKGSVLVAQVGIAGSTELGEHVTLAGQVGVIGHLKIGKGATVLASAKVYKNV 307

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            +G + GG PA  I ++ + +  L    K K
Sbjct: 308 KSGDRVGGHPAVSISDWQKQIRFLKTAIKSK 338


>gi|317180000|dbj|BAJ57786.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori F32]
          Length = 336

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 123/326 (37%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  +A A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQTRYLKLLKDSQAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P   +  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVTIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|295689588|ref|YP_003593281.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Caulobacter segnis ATCC 21756]
 gi|295431491|gb|ADG10663.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Caulobacter segnis ATCC 21756]
          Length = 341

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 125/347 (36%), Positives = 191/347 (55%), Gaps = 9/347 (2%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    FF S    +L +LA+   A L D   G+R I   +P+  A    +++    K  +
Sbjct: 1   MPDPRFFDSLGPASLSELARVGAAELADATSGDRQIVRAAPLDSADVQAVTFFSDAKRKD 60

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
                +A A     +    +P     L++  P+ ++A A + L+    H  +S   G + 
Sbjct: 61  AAAATRAGACFVRPEHRDLLPATCAALITRHPQAAWAAAAARLHAPRRHEPSS---GAVH 117

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A L      EDGV+++P A +     +GR T +GPG+V+G GV IGR+C IG  + I 
Sbjct: 118 ADAVL------EDGVLLSPGATIGQDARVGRGTRIGPGAVVGPGVVIGRDCVIGPNAVIG 171

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            +L+G+ V + +G  IG  GFG A G   +  +  +GRV+IQD V IGANS +DRG   D
Sbjct: 172 FALVGDRVSISAGAVIGEAGFGAAAGPRGMVDLPQLGRVVIQDNVTIGANSCVDRGAFAD 231

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T IGENTKIDN V + HNV IG  C++ +  G++GST +GD V  GG+ G+A +L IG  
Sbjct: 232 TTIGENTKIDNLVHVAHNVRIGRNCVLAAFTGVSGSTTVGDGVAFGGKAGVADHLNIGSG 291

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
             + + + V K++PAG+ + G PARP+ ++LR    LS+ +  ++ R
Sbjct: 292 ASVGAAASVFKNVPAGETWTGFPARPLKKWLRETAWLSRRAGGRVTR 338


>gi|217034021|ref|ZP_03439443.1| hypothetical protein HP9810_891g25 [Helicobacter pylori 98-10]
 gi|216943529|gb|EEC22980.1| hypothetical protein HP9810_891g25 [Helicobacter pylori 98-10]
          Length = 336

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 123/326 (37%), Positives = 182/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  +A A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSQAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P ++FA A             S  E    P+ F        + 
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKASHAFKIPFFKNPESVNE----PKHF--------EK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P   +  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVTIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|108562615|ref|YP_626931.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori HPAG1]
 gi|119371939|sp|Q1CUW5|LPXD_HELPH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|107836388|gb|ABF84257.1| UDP-3-0-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Helicobacter pylori HPAG1]
          Length = 336

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 183/327 (55%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ +    ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSTYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK +  L+ D P ++FA A      P   + E+ S      P+ F         
Sbjct: 61  KESSKVPKRMQALIVDNPHLAFAKASHAFKIPFFKNPESVS-----EPKHF--------K 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+
Sbjct: 108 KVTIMPNVMIGEGVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVTIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|188527001|ref|YP_001909688.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori Shi470]
 gi|188143241|gb|ACD47658.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori Shi470]
          Length = 336

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 181/326 (55%), Gaps = 16/326 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +PK++  L+ D P + FA A             S  E    P+ F          
Sbjct: 61  KESSKVPKHMQALIVDNPHLVFAKASHAFKIPFFKNPESVNE----PKHF--------KK 108

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+G
Sbjct: 109 VTIMPNVIIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILEDNVTIHAG 168

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN 
Sbjct: 169 SVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDNL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V KD
Sbjct: 229 VQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKD 288

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVML 337
           +P    + G +PA  I E+   +  L
Sbjct: 289 LPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|52843138|ref|YP_096937.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52630249|gb|AAU28990.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 345

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 187/331 (56%), Gaps = 8/331 (2%)

Query: 15  LMKLAQSIGASLLDENFGERMIYS-LSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L +LA+  GA+L  E  GE    S L+ ++ A++ D+  +  +K++  ++   A   I  
Sbjct: 17  LFELAKISGATLY-EGKGETFTVSGLAKLSEATSNDLVMLHQKKYVKELKHTAARVCIIG 75

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            D V + P ++  L+   P  +FA+     YP        +    I   A +G D  I  
Sbjct: 76  PDYVKYAPDSMYLLVHPNPYKAFALIAQAFYPSEKPPGFIATSAMIESSAIIGVDCFIAH 135

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSG 193
           G  I         V+IG +  +G  + IG  V IG +C I    SI  ++IGN+V+++SG
Sbjct: 136 GAYIGNQ------VKIGNRCKIGVNTYIGDTVTIGDDCLIEDNVSIRHAVIGNNVVIYSG 189

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            RIG DGFG+A   +  +KI H G VII + VEIGAN+ IDRG++D+T+I +  ++DN V
Sbjct: 190 ARIGQDGFGFASDANGHYKIPHAGGVIIGNDVEIGANTCIDRGSLDNTVIEDWCRLDNLV 249

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QIGHNV IG G ++V+QVGIAGST +G++V + GQ G+ G+LKIG    + + + V K++
Sbjct: 250 QIGHNVKIGKGSVLVAQVGIAGSTELGEHVTLAGQVGVIGHLKIGKGATVLASAKVYKNV 309

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            +G + GG PA  I ++ + +  L    K K
Sbjct: 310 KSGDRVGGHPAVSISDWQKQIRFLKTAIKSK 340


>gi|85860093|ref|YP_462295.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine [Syntrophus aciditrophicus
           SB]
 gi|119371979|sp|Q2LVL5|LPXD_SYNAS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|85723184|gb|ABC78127.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine [Syntrophus aciditrophicus
           SB]
          Length = 363

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 178/312 (57%), Gaps = 20/312 (6%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           +I ++  I  A  GDI+++ + ++   + +  ASA++ ++D      +N+  +  D P V
Sbjct: 23  LIKAVRGIDEAGPGDITFVANPQYEKKLNETGASAVLVTRD-TERPGENVTLIQVDDPYV 81

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           S     +I YP+         + GIS QA       +E+G  I+P A VYPGV I     
Sbjct: 82  SLGKLLTIFYPEERE------KPGISAQAI------VEEGAEISPSATVYPGVYISSGAG 129

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSS-------LIGNSVILHSGVRIGNDGFGYARGV 207
           +G G V+  GV +GR+  IG  S +Y +       LIG  VILH+G  +G+DGFG+A   
Sbjct: 130 IGAGVVLYPGVFVGRDAVIGENSILYPNVCVYRRCLIGKRVILHAGAVVGSDGFGFANPG 189

Query: 208 SDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
            D  KI  IG V I D VEIGAN+ IDR T+  T I    KIDN VQI HNV IG   II
Sbjct: 190 RDNIKIPQIGIVQIDDDVEIGANTTIDRATLGRTWIQRGVKIDNLVQIAHNVVIGEKSII 249

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           VSQVGI+GST +G +V++GGQ G+ G+L+IGD   + ++SGV +D+PA     G P +P 
Sbjct: 250 VSQVGISGSTRLGRSVILGGQAGLVGHLQIGDFAMVGAQSGVHEDVPANSVVSGSPCQPH 309

Query: 328 GEYLRHMVMLSK 339
             +LR M  L +
Sbjct: 310 RNWLRSMSCLPR 321


>gi|109946989|ref|YP_664217.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter acinonychis str. Sheeba]
 gi|109714210|emb|CAJ99218.1| UDP-3-O-[3-hydroxymyristol] glucosamine N-acyltransferase
           [Helicobacter acinonychis str. Sheeba]
          Length = 336

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 185/327 (56%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ +    ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLNTYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKFLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK++  L+ D P ++FA ++ +   P   + E+ S      P+ F        +
Sbjct: 61  KESSKVPKHMQALVVDNPHLAFAKVSHAFKVPFFKNPESVS-----EPKHF--------E 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P   +   VEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++VI+H+
Sbjct: 108 KVTIMPNVTIGESVEIGENSLIYPGVVIADGVKIGKNCVLYPRVILYQNTILEDNVIIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIG N+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGVNTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|58040251|ref|YP_192215.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconobacter oxydans 621H]
 gi|58002665|gb|AAW61559.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gluconobacter oxydans 621H]
          Length = 242

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 143/222 (64%)

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
           P A++ ED +I + V I P AV+  GV IGR + V   + IG  V IG  C IGA ++I 
Sbjct: 17  PSAWIAEDAEIGENVEIGPFAVIGSGVRIGRDSIVASHASIGQSVEIGERCRIGAHAAIS 76

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDD 240
            + IG+ V L+ GVRIG DGFG+A G      +  +G V+++D VE+GANS IDRG++ D
Sbjct: 77  HARIGDRVTLYPGVRIGQDGFGFAVGPEGFETVPQLGLVVLEDGVEVGANSTIDRGSMRD 136

Query: 241 TIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDN 300
           T+IG  T+IDN VQIGHN  +G  CI+VSQ GI+GST +GD V +  Q G+ G++KIG  
Sbjct: 137 TLIGAGTRIDNLVQIGHNARLGRCCIVVSQAGISGSTELGDFVTVAAQAGLIGHIKIGTK 196

Query: 301 VQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
            +I ++ GV+ D+ AG    G PA P  E+ R++  L K S+
Sbjct: 197 ARIGAQCGVMSDVDAGADVIGSPAMPFREFFRNVATLRKLSR 238


>gi|54298948|ref|YP_125317.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Legionella pneumophila str. Paris]
 gi|81601612|sp|Q5X0T1|LPXD2_LEGPA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|53752733|emb|CAH14168.1| hypothetical protein lpp3015 [Legionella pneumophila str. Paris]
          Length = 343

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 189/334 (56%), Gaps = 14/334 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYS-LSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L +LA+  GA+L  E  GE    S L+ ++ A++ D+  +  +K++  ++   A + I  
Sbjct: 15  LSELAKISGATLY-EGKGETFTVSGLAKLSEATSNDLVMLHQKKYVKELKNTAARSCIIG 73

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSF---EGGISPQAFLGEDVK 130
            D V F P ++  L+   P  +FA+     YP     ++SSF      I   A +G D  
Sbjct: 74  PDYVKFAPDSMYLLVHPNPYKAFALIAQAFYPSE---KSSSFIAPSAKIESTALIGSDCS 130

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVIL 190
           I  G  +   A       IG++  +G  + IG GV IG NC I    SI  ++IG++V++
Sbjct: 131 IAHGAYVGNHA------RIGKRCKIGVNTYIGDGVTIGDNCIIEDNVSIRHAVIGSNVVV 184

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           + G RIG DGFG+A      +KI H G VII + VEIGAN+ IDRG++ +T+I +  ++D
Sbjct: 185 YPGARIGQDGFGFASDAEGHYKIPHAGGVIIGNDVEIGANTCIDRGSLGNTVIEDWCRLD 244

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGHNV IG G IIV+QVGIAGST +G++V + GQ G+ G+LKIG    + + S VL
Sbjct: 245 NLVQIGHNVKIGKGSIIVAQVGIAGSTELGEHVTLAGQVGVIGHLKIGKGATVLTCSKVL 304

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           +++  G +  G PA  I ++ + +  L    K K
Sbjct: 305 RNVQPGDRVIGYPAISISDWQKQIRFLKTAIKSK 338


>gi|319956235|ref|YP_004167498.1| UDP-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Nitratifractor salsuginis DSM 16511]
 gi|319418639|gb|ADV45749.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitratifractor salsuginis DSM 16511]
          Length = 320

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 187/333 (56%), Gaps = 20/333 (6%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L ++ + IG     E+   R +  L+ +A A+  ++S++ S K+L ++E+ +A+A++  
Sbjct: 4   SLKEICKKIGVEYSGED---RSVTGLNTLADATPEELSFLHSEKYLRDLERTRAAAVLVE 60

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +     +P+ +  L++++P +  A+A ++            F   +SP +   E   + +
Sbjct: 61  ERFAERLPEGVIPLVTEEPYLKLALATAL------------FAHRVSPAS---EPPVVGE 105

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
           G  I P       V+IG  T +  GS IG  V IG NC I    +IY     GN  I HS
Sbjct: 106 GCEIDPTVRFGRNVKIGSNTVILAGSYIGDDVVIGENCLIHPNVTIYHGCSAGNGCIFHS 165

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG+DG+G+A      H KI  +G V I D+VEIGAN+ IDRG + DT+IG  TKIDN
Sbjct: 166 GAVIGSDGYGFAHTRDGRHVKIHQLGAVRIGDEVEIGANTTIDRGALGDTLIGSGTKIDN 225

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           QVQIGHN  IG  C+IV+Q GIAGST +G NV++GGQ   AG+L+IGD   +A++    K
Sbjct: 226 QVQIGHNCIIGENCLIVAQTGIAGSTRLGRNVVMGGQSATAGHLEIGDFATLAARCAATK 285

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            +   + Y G+PA  I  + R    L + +K K
Sbjct: 286 SLEGHKVYAGVPAMDIRLWRRQQAALMRLAKGK 318


>gi|15611252|ref|NP_222903.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori J99]
 gi|6685622|sp|Q9ZMN6|LPXD_HELPJ RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|4154701|gb|AAD05766.1| UDP-3-O-[3-hydroxymyristoyl [Helicobacter pylori J99]
          Length = 336

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 188/327 (57%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI    +L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQVCYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK++  L+ D P ++FA ++ +   P   + ++ +      P+ F        +
Sbjct: 61  KESSKVPKSMQALIVDNPHLAFAKVSHAFKIPFFKNPQSVN-----EPKHF--------E 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P  V+  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++VI+H+
Sbjct: 108 KVTIMPNVVIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILEDNVIIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|258592400|emb|CBE68709.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [NC10
           bacterium 'Dutch sediment']
          Length = 359

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 128/329 (38%), Positives = 185/329 (56%), Gaps = 13/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA+ +   L+ +  GE  +  L+P+  A  GD++++   + L  +E  KASA+I 
Sbjct: 1   MQLRELAEKLNCRLVGD--GEIEVRHLAPLHEACEGDLAFVAHARDLPKLETSKASAVIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +   P    + P LL++ P ++F  A  + Y         S   GI P + + E V++ 
Sbjct: 59  PEGSPPC---SKPALLTNDPYLAFVGALRLFY------TPDSPTPGIHPSSIVREGVRLA 109

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
             V I P++VV   V IGR T VG    IG G RIG +C +     I   + IG+ VI+H
Sbjct: 110 MDVAIGPLSVVEADVTIGRGTVVGAQVYIGKGSRIGADCWLYPQVMIREGAEIGDRVIVH 169

Query: 192 SGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  IG+DGFGY R    I  K+  +GRVII+D VEIGAN  IDR TI  T I   TKID
Sbjct: 170 SGTVIGSDGFGYLRDGQGIRIKVPQVGRVIIEDDVEIGANVTIDRATIGATRIKHGTKID 229

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQI HNV +G   +IV+  GI+GS  IGD V + GQ GI  +++IGD+V + +++GV 
Sbjct: 230 NLVQIAHNVVVGADTVIVALTGISGSATIGDRVTLAGQVGIVDHIEIGDDVTVGAQAGVA 289

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           K +P+G    G PA P   + R +   ++
Sbjct: 290 KSLPSGSVVLGSPAVPHLAFKRSVAAANR 318


>gi|207092353|ref|ZP_03240140.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pylori HPKX_438_AG0C1]
          Length = 336

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 124/327 (37%), Positives = 184/327 (56%), Gaps = 18/327 (5%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ + A  ++  F     +++L+ + +A+  DISYI   ++L  ++  KA A+   +
Sbjct: 1   MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARYLKLLKDSKAGAVFIRK 60

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +PK++  L+   P ++FA A      P   + E+ S      P+ F         
Sbjct: 61  KESSKVPKHMQALVVPNPHLAFAKASHAFKIPFFKNPESVS-----EPKHF--------K 107

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHS 192
            V I P  ++  GVEIG  + + PG VI  GV+IG+NC +     +Y ++++ ++V +H+
Sbjct: 108 KVTIMPNVMIGEGVEIGENSLIHPGVVIADGVKIGKNCILYPRVILYQNTILEDNVTIHA 167

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFGYA      H KI H+G V IQ  VEIGAN+AIDR    +T+I E  KIDN
Sbjct: 168 GSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETLIKEGVKIDN 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G   I+VSQVG++GST  G NV+ GGQ GI G+L +G+  QI  KS V K
Sbjct: 228 LVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGK 287

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVML 337
           D+P    + G +PA  I E+   +  L
Sbjct: 288 DLPPNTNFAGAIPAMEIHEWHHFLAHL 314


>gi|317486629|ref|ZP_07945446.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bilophila wadsworthia 3_1_6]
 gi|316922012|gb|EFV43281.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bilophila wadsworthia 3_1_6]
          Length = 344

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 173/308 (56%), Gaps = 23/308 (7%)

Query: 45  ASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY 104
           A   ++S++ + K+ + +   +A A+I   +    + +    L+S+ P   F   G +L 
Sbjct: 33  AGPDEVSFLANPKYADQLAATRAGAVIVRPEHAGDVRR---ALISENPYQDF---GRVL- 85

Query: 105 PQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAG 164
            +       SF G ISP AF+  D ++ DGV       VYP V IG    VG G  +  G
Sbjct: 86  -ELFAAPQGSFSG-ISPLAFIHPDAELGDGVT------VYPFVYIGPHATVGSGVKLFPG 137

Query: 165 VRIGRNCSIGAGSSIYSSLI-------GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIG 217
           V +G N  IG G+++Y + +       G   ILH G  +G DGFG+AR  + I KI  +G
Sbjct: 138 VYVGENVRIGKGTTVYPNAVLMAGTHVGEGCILHPGSVLGADGFGFARTPAGIQKIPQVG 197

Query: 218 RVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGST 277
           +V I + VE+GAN+AIDR  +D T IG+ TKIDN  QIGHNV IG    +VSQVGI+GST
Sbjct: 198 KVTIGNAVEVGANAAIDRAVLDATRIGDGTKIDNLAQIGHNVQIGRNGFVVSQVGISGST 257

Query: 278 YIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
            +GDN    GQ GIAG+L IGDNV I  +SGV KDIP+    GG P      Y+R + ++
Sbjct: 258 TVGDNCTFAGQVGIAGHLHIGDNVTIGPQSGVAKDIPSDVVVGGTPTVDQRTYMRTLALM 317

Query: 338 SK-PSKYK 344
            + P  +K
Sbjct: 318 PRFPELFK 325


>gi|116751165|ref|YP_847852.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Syntrophobacter fumaroxidans MPOB]
 gi|167008891|sp|A0LPR5|LPXD_SYNFM RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|116700229|gb|ABK19417.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Syntrophobacter fumaroxidans MPOB]
          Length = 355

 Score =  199 bits (505), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 191/345 (55%), Gaps = 27/345 (7%)

Query: 9   SHKGIALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKA 67
           S K  +L +LA+ +GA++  D     R + SL     A   ++S+I   ++   + KC+A
Sbjct: 9   SRKSYSLSELAEILGAAVRGDPAIRIRGVNSLED---ALPDELSFITDVRYKPLLSKCRA 65

Query: 68  SAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGE 127
           +AII S  +        P L++++P V FA A  +        E      G+ P A++G 
Sbjct: 66  AAIIVSPALAEL---EFPLLVAERPYVVFARAAQLF------AEPPFLAPGVHPGAYIGP 116

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVI------GAGVRIGRNCSIGAGSSIYS 181
           +V + +GV + P A       IG    VGPG+ I      G GVR+G NC +  G+ I  
Sbjct: 117 NVHLGEGVSVGPQA------HIGEDCVVGPGTRIYGSAYLGPGVRVGENCMLYPGAVILD 170

Query: 182 S-LIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
             L+GN V +HSG  +G+DGFGYA+     H KI   G V I D VEIGAN  +DR T  
Sbjct: 171 RCLLGNRVTVHSGTVVGSDGFGYAQDEKGRHVKIPQTGIVQIDDDVEIGANCTVDRATFG 230

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            T +    KIDNQVQI HNV IG   I+V+QVGI+GST +G +V++ GQ G+AG+++IGD
Sbjct: 231 RTWVRRGAKIDNQVQIAHNVVIGEHAILVAQVGISGSTTLGSHVVLAGQVGVAGHIEIGD 290

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
             ++ +KSGV   + AG+   G+P  P  E+ R    + + ++++
Sbjct: 291 RARVGAKSGVHHSVGAGEDILGIPGVPAREWKRTYANIQRLARFR 335


>gi|91206004|ref|YP_538359.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia bellii RML369-C]
 gi|119371969|sp|Q1RH94|LPXD_RICBR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|91069548|gb|ABE05270.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia bellii RML369-C]
          Length = 342

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 177/304 (58%), Gaps = 5/304 (1%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS+ DIS++ + K+   ++  KA+A I  +D    +  N   L   + E S
Sbjct: 37  IHDIKILQEASSNDISFLSNIKYSRFLKNTKAAACIVPKDFTGEVNPNTVLL---RAENS 93

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +   G ++     +    S+   I   A++ E   I     +   AV+   V IG  + +
Sbjct: 94  YFAYGKLI--DFFYAPVKSYPAKIMKSAYVAESATIGKNCYVGHNAVIEDNVVIGDDSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I +  SI  S+IG+ V++ SG +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGTGVVIGRNARIESNVSINYSVIGDDVVILSGAKIGQDGFGFSTEKGMHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
            G V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH+V IG G IIV+Q GIAG
Sbjct: 212 TGIVKIGNNVEIGANTTIDRGSLQDTIIEDLCRIDNLVQIGHSVKIGKGSIIVAQAGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           S+ IG    +GGQ G+AG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R  +
Sbjct: 272 SSVIGKYCALGGQVGVAGHLYIGDGAQVAAQGGVAQNIEAGKIVGGSPAVPIMDWHRQSI 331

Query: 336 MLSK 339
           ++ +
Sbjct: 332 IMKQ 335


>gi|39997364|ref|NP_953315.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter sulfurreducens PCA]
 gi|60390055|sp|Q74AT5|LPXD_GEOSL RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|39984255|gb|AAR35642.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Geobacter
           sulfurreducens PCA]
 gi|298506301|gb|ADI85024.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Geobacter sulfurreducens KN400]
          Length = 347

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 192/334 (57%), Gaps = 18/334 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G +L+ +  G R I  ++ +  A+   I+++ + ++   +   +A A+I   
Sbjct: 7   LQELADYLGGTLVGD--GSRQIVGVASLDDATDSQITFLANPRYAPKVASTRAGAVI--- 61

Query: 75  DIVPFIPK-NIPCLLSDKPEVSFAIAGSILY--PQAMHMEASSFEGGISPQAFLGEDVKI 131
            + P   + N   ++   P ++FA   ++ Y  P+A          G+   A +G +VK+
Sbjct: 62  -LPPGAERHNHNAIMVPNPYLAFARLLTLFYVAPRAAR--------GVMDGAHVGRNVKL 112

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
              + I P AVV   V IG +  + PG V+  GV +G + ++ A  ++Y    IGN V +
Sbjct: 113 GSEITIHPGAVVGDNVTIGDRVTLHPGVVLYEGVTVGDDVTLHANVTVYQGCRIGNRVTI 172

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           H G  IG+DGFGYA      +KI  +G V+I+D VEIGAN+AIDR  +  T+IG+ TK+D
Sbjct: 173 HGGTIIGSDGFGYAPDGDGWYKIPQLGNVVIEDDVEIGANAAIDRAALASTVIGKGTKVD 232

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N V I HN  IG  C+IVSQVGI+GST +G  V +GGQ G+AG+L+IGDN  I +KSGV 
Sbjct: 233 NLVMIAHNCVIGENCMIVSQVGISGSTKLGRRVTLGGQVGVAGHLEIGDNAMIGAKSGVP 292

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            ++P+G    G+PA    E+LR   ++ K  + K
Sbjct: 293 GNVPSGTIMSGIPAFDHREWLRASAVVPKLPEMK 326


>gi|292493491|ref|YP_003528930.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitrosococcus halophilus Nc4]
 gi|291582086|gb|ADE16543.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitrosococcus halophilus Nc4]
          Length = 347

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 186/336 (55%), Gaps = 10/336 (2%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L ++A+ +G  +  E  GE +I  ++P+ +A   D+S+  +RK+++     KA+A + 
Sbjct: 3   IRLWEIARFLGCVI--EGDGETLIRGVAPLDQAQADDLSFYTNRKYISRARLSKAAAFVV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D     P + P L+SD P   FA      + +           G+ P A +GE V+I 
Sbjct: 61  GADDREQFPGH-PLLISDNPYRDFARVVDKWFNRPYRPAP-----GVHPTAIVGEGVQIA 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           +G  I    V+  G  I   T + P   +GA   +G +C +    ++   + IG+ VILH
Sbjct: 115 EGCSIGAYCVIENGATIKAHTVLFPFCYVGAKATLGEHCLLYPRVTLLERVSIGHRVILH 174

Query: 192 SGVRIGNDGFGYARGVSD-IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SGV IG DGFG+A        K+  +GRV I D VE+  N+AIDRG +  T IG  TKID
Sbjct: 175 SGVIIGGDGFGFAPDPQQGYFKVPQVGRVEIADDVEVQCNTAIDRGALGATRIGRGTKID 234

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGHNV IG   IIVSQVGI+GST IG+ V + GQ G+ G++++GD   + ++SGV 
Sbjct: 235 NLVQIGHNVEIGEHSIIVSQVGISGSTKIGNWVTLAGQVGLVGHIQVGDGAIVTAQSGVA 294

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           KD+P      G PA+P+ E  R +  +++ S  + K
Sbjct: 295 KDVPPKAIVTGSPAQPMIENRRALAEMNRLSSLRKK 330


>gi|157826632|ref|YP_001495696.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia bellii OSU 85-389]
 gi|157801936|gb|ABV78659.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia bellii OSU 85-389]
          Length = 327

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/304 (39%), Positives = 177/304 (58%), Gaps = 5/304 (1%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS+ DIS++ + K+   ++  KA+A I  +D    +  N   L   + E S
Sbjct: 22  IHDIKILQEASSNDISFLSNIKYSRFLKNTKAAACIVPKDFTGEVNPNTVLL---RAENS 78

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +   G ++     +    S+   I   A++ E   I     +   AV+   V IG  + +
Sbjct: 79  YFAYGKLI--DFFYAPVKSYPAKIMKSAYVAESATIGKNCYVGHNAVIEDNVVIGDDSII 136

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I +  SI  S+IG+ V++ SG +IG DGFG++      HKI H
Sbjct: 137 EAGSFIGTGVVIGRNARIESNVSINYSVIGDDVVILSGAKIGQDGFGFSTEKGMHHKIFH 196

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
            G V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH+V IG G IIV+Q GIAG
Sbjct: 197 TGIVKIGNNVEIGANTTIDRGSLQDTIIEDLCRIDNLVQIGHSVKIGKGSIIVAQAGIAG 256

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           S+ IG    +GGQ G+AG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R  +
Sbjct: 257 SSVIGKYCALGGQVGVAGHLYIGDGAQVAAQGGVAQNIEAGKIVGGSPAVPIMDWHRQSI 316

Query: 336 MLSK 339
           ++ +
Sbjct: 317 IMKQ 320


>gi|291277542|ref|YP_003517314.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter mustelae 12198]
 gi|290964736|emb|CBG40591.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter mustelae 12198]
          Length = 320

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 183/337 (54%), Gaps = 27/337 (8%)

Query: 16  MKLAQSIG----ASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           MKL+Q +     ++ L  +F    +  ++P+  A+   +SYI  +++L ++   KA A++
Sbjct: 1   MKLSQILSKINISATLTHDF---ELMGIAPLQEANEKQLSYIEQKQYLKDLNDSKAGAVL 57

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL--GEDV 129
             Q+    +P +I  +++  P ++FA        Q  H  A           FL  GED 
Sbjct: 58  IRQEFSNLVPTHIQAIITPNPHLAFA--------QISHFFAKG--------EFLDEGEDA 101

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSV 188
            I     I P   +   + IG  + + PG VI   V IG +C I     IY  ++IGN V
Sbjct: 102 CIHPSAKIMPNVYLGKNIRIGANSLIMPGVVISDHVIIGEDCKIYPNVVIYRDTIIGNRV 161

Query: 189 ILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            +H+G  IG+DGFGYA      H KI H G V+I+D VEIGAN+ IDR    +T I +  
Sbjct: 162 NIHAGSVIGSDGFGYAHTTDGKHVKIEHNGCVVIEDDVEIGANNTIDRAVFGETKIQKGA 221

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           KIDN VQIGHN  IG   I+VSQVG+AGST  G NV++GGQ G  G++ IGD VQ+A + 
Sbjct: 222 KIDNLVQIGHNCVIGPHSILVSQVGLAGSTTTGRNVVMGGQAGTGGHIHIGDFVQVAGRG 281

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            V K++P   ++GG P   + E+++  V L +  K K
Sbjct: 282 AVGKNLPPNTKWGGHPLMELDEWMKFYVNLRRMLKKK 318


>gi|206602502|gb|EDZ38983.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Leptospirillum sp. Group II '5-way CG']
          Length = 350

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 124/326 (38%), Positives = 181/326 (55%), Gaps = 12/326 (3%)

Query: 15  LMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L ++A  +G  L   E+  ++ I  +  +  A   D++++ + K+   + K +A AI+ S
Sbjct: 3   LSEIASLVGGHLTGPESAFDKQILGVRSMLEAGPQDLTFLANPKYRGELSKIQAGAILLS 62

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +   P    +IP ++   P ++ A    + YP        S   G+ PQA +  +V IED
Sbjct: 63  E---PSPGLSIPQIVVPDPYLALARVMQVFYP------LPSPRQGVHPQAHISGNVFIED 113

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
            V + P AV+  G  IG  T +GPG  IGA V IG+ C +  G  +     IGN VI+  
Sbjct: 114 PVEVGPAAVILEGSRIGAGTVIGPGVFIGARVVIGKGCYLHPGVVVREDCRIGNRVIIQP 173

Query: 193 GVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
              IG+DGFGYA       HKI  IGRV I D VEIGAN+ IDR T  +T+IG  TKIDN
Sbjct: 174 NAVIGSDGFGYAADPQGHRHKIPQIGRVTIGDDVEIGANTTIDRATFGETVIGAGTKIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQI HNV IG  C+IV+Q GI+GS+ +G  V++ GQ G+ G+++IG +  I ++SGV +
Sbjct: 234 LVQIAHNVRIGEDCVIVAQAGISGSSRLGHRVILAGQAGVVGHIEIGSDSMIGAQSGVAR 293

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVML 337
            +P   +  G PA     +LR   +L
Sbjct: 294 SLPEKSRVSGSPAISHKLWLRIQTIL 319


>gi|109897584|ref|YP_660839.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pseudoalteromonas atlantica T6c]
 gi|119371955|sp|Q15WF3|LPXD_PSEA6 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|109699865|gb|ABG39785.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pseudoalteromonas atlantica T6c]
          Length = 344

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 180/336 (53%), Gaps = 12/336 (3%)

Query: 10  HKGIALMKLAQSIGASL--LDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKA 67
           ++ ++L +LA  IGASL   D + GE  I+SLS +A A  G IS++ + ++ + +EK  A
Sbjct: 2   NQTVSLQQLADKIGASLHLTDGDSGETQIHSLSTLASAGNGQISFLSNSRYRSQLEKTAA 61

Query: 68  SAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGE 127
            A+I   + +         L+ D P V FA+A  +L       +      GISP A + +
Sbjct: 62  QAVILKSEDLSHC--QCSALVMDNPYVGFALAAQLLDSTPRSAD------GISPLAVIAD 113

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GN 186
           DV++ D V I   AV+  GV++     +GPG  IG  V +G N  + A  ++Y  ++ G 
Sbjct: 114 DVELGDNVSIGAHAVIESGVKLADNVQIGPGCFIGKEVSVGANTKLWANVTLYHRVVLGQ 173

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
             ++ S   IG DGFGYA       KI  +G VI+ D+VE+GA+S IDRG +DDTIIG  
Sbjct: 174 DCLIQSATVIGADGFGYANDKGRWVKIPQLGTVILGDRVEVGASSTIDRGALDDTIIGNG 233

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
             IDNQ Q+ HNV IG    I     +AGS  IG N  IGG   I G+++I DNV I   
Sbjct: 234 VIIDNQCQVAHNVIIGENTAIAGCTVVAGSVTIGRNCTIGGMVAINGHMEICDNVYITGM 293

Query: 307 SGVLKDIPA-GQQYGGMPARPIGEYLRHMVMLSKPS 341
           S V K I   G    GMPA    E+ ++ V L   S
Sbjct: 294 SMVTKAIDKPGVYSSGMPAIENREWRKNAVALRNLS 329


>gi|298529241|ref|ZP_07016644.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298510677|gb|EFI34580.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 343

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 188/334 (56%), Gaps = 25/334 (7%)

Query: 18  LAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           L   I A L  E  GE + I  ++ + +A   ++S++   ++L  +E   A A+I   + 
Sbjct: 2   LLSEIAARLKLEYTGEDLDITGVNTLEQAGPDELSFLSDSRYLPRLETTSAGAVIVPPEK 61

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
              + + I    S  P + FA    + + PQ M             ++F G++  I    
Sbjct: 62  AEMVSRAIK---SPNPYLDFARVMQLFHEPQGMQ------------ESFPGQE-GIHSTA 105

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGS------VIGAGVRIGRNCSIGAGSSIYSSL-IGNSV 188
            I P A+++P V IG    +GPG        IG  V +GR+C +    SI +   I + V
Sbjct: 106 TIDPTAIIHPMVFIGANARIGPGCRIFPHCYIGENVVLGRDCLVYPQVSIMAGCRINDRV 165

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           I+H G  IG+DGFG+ +   +  KI  +GRV+I+D VEIG+ + IDR T+ +T IG+ TK
Sbjct: 166 IIHPGAVIGSDGFGFIQDGEERVKIPQVGRVVIEDDVEIGSCTTIDRATLGETRIGKGTK 225

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQI HNV  G  C+++SQVGI+GS  +G NV++GGQ G+AG+L+I DN ++A+KSG
Sbjct: 226 IDNLVQIAHNVQTGENCVLISQVGISGSVRLGSNVILGGQVGVAGHLEIEDNCRVAAKSG 285

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           V K +PA    GG+PA     +LR+ V+L + S+
Sbjct: 286 VGKSLPANTDAGGIPAMDHTTFLRNAVLLPRLSQ 319


>gi|217967208|ref|YP_002352714.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Dictyoglomus turgidum DSM 6724]
 gi|217336307|gb|ACK42100.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Dictyoglomus turgidum DSM 6724]
          Length = 329

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 123/328 (37%), Positives = 190/328 (57%), Gaps = 18/328 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIE-KCKASAIICS 73
           L ++A+ I   L+ E+     I  ++    A+  D+ ++ + K ++ IE K KA +++  
Sbjct: 3   LSEIAKIIEGELIGEDMD---IEKVAEWEIATEKDLIFVFNSKDIDKIEGKTKARSLV-- 57

Query: 74  QDIVPFIPK-NIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
              +P   K N   +  + P ++ A             +   +  G+   A LG++V++ 
Sbjct: 58  ---IPLDGKSNKTHIKVENPRLAMA-------KLLKFFDFRIYPSGVHDTAILGKNVELG 107

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILH 191
           + + I    VV   V+IG+ T + PG VIG  + IG NC I    +IY  +I GN+VI+H
Sbjct: 108 EDIGIGAYVVVGNNVKIGKGTKIFPGVVIGNNIEIGENCIIYPRVTIYDHVIVGNNVIIH 167

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG DGFGY     +  KI HIG+V+I+D VEIG N+ I+R T+ +T IG+ TKI +
Sbjct: 168 SGCSIGVDGFGYVWNGKEHFKITHIGKVVIEDNVEIGGNTVIERATLGETKIGKGTKIGS 227

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            + IGHNV IG  C+IVSQ GIAGS+ +G+NV++ GQ G++ ++++G+NV I +KSGV K
Sbjct: 228 LIMIGHNVKIGENCVIVSQSGIAGSSELGNNVVMAGQSGVSDHVRVGNNVVILAKSGVTK 287

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           DIP      G PARP  E ++   +L K
Sbjct: 288 DIPDNMVVSGFPARPHREEMKIQAILKK 315


>gi|124514696|gb|EAY56208.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leptospirillum rubarum]
          Length = 350

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 181/326 (55%), Gaps = 12/326 (3%)

Query: 15  LMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L ++A  +G  L   E+  ++ I  +  +  A   D++++ + K+   + K +A AI+ +
Sbjct: 3   LSEIASLVGGHLTGPESAFDKQILGVRSMQEAGPQDLTFLANPKYRPELPKIQAGAILLA 62

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +   PF   + P ++   P ++ A    + YP        S   G+ PQA +  +V +E+
Sbjct: 63  E---PFPGLSTPQVVVSDPYLALARVMQVFYP------LPSPRQGVHPQAHISGNVSLEE 113

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
            V + P AV+  G  IG  T +GPG  IGA V IG+ C +  G  +     IGN VI+  
Sbjct: 114 PVEVGPAAVIQEGSRIGAGTVIGPGVFIGARVVIGKGCFLHPGVVVREDCRIGNRVIIQP 173

Query: 193 GVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
              IG+DGFGYA       HKI  IGRV I D VEIGAN+ IDR T  +T+IG  TKIDN
Sbjct: 174 NAVIGSDGFGYAADPQGHRHKIPQIGRVTIGDDVEIGANTTIDRATFGETVIGAGTKIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQI HNV IG  C+IV+Q GI+GS+ +G  V++ GQ G+ G+++IG +  I ++SGV +
Sbjct: 234 LVQIAHNVRIGEDCVIVAQAGISGSSRLGHRVILAGQAGVVGHIEIGSDSMIGAQSGVAR 293

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVML 337
            +P   +  G PA     +LR   +L
Sbjct: 294 SLPEKSRVSGSPAISHKLWLRIQTIL 319


>gi|188997472|ref|YP_001931723.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932539|gb|ACD67169.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 326

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 135/331 (40%), Positives = 196/331 (59%), Gaps = 22/331 (6%)

Query: 16  MKLAQSIGASLLD---ENFGE-RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           MK+++   A LL+   ENF + + I +L  I  A+  DI+++ ++K   +++K KA A+I
Sbjct: 1   MKISEI--ARLLNGKLENFTQDKEIKNLKSIETAAEDDITFLKNKK---DLDKIKAGAVI 55

Query: 72  CSQDIVPFIPK-NIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
                  FIP+ NIP ++ DKP ++F     I YP          EG IS  A +G++V+
Sbjct: 56  VGS----FIPELNIPQIVVDKPNIAFYKLIDIFYPDEKK------EGFISNLAIVGKNVE 105

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVI 189
           IE    I    V+   V+IG+   + P   IG   +IG NC +     IY  + IGN+VI
Sbjct: 106 IEKSSQIHEYVVIKDNVKIGKNCIIHPFCYIGENTQIGDNCILYPNVVIYKDTAIGNNVI 165

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           +H+   I  DGFGY +      KI HIG+VII+D VEIGAN+ IDR  +D+T+I + TKI
Sbjct: 166 IHANSVIAADGFGYYQEDGKHKKIKHIGKVIIEDDVEIGANTTIDRAMLDETVIKKGTKI 225

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V IGHN  +G   I+VSQVGIAGS+ IG+NV++ GQ G+A ++ IGDNV + +KSGV
Sbjct: 226 DNLVMIGHNCKVGQNTILVSQVGIAGSSKIGNNVILAGQVGVADHITIGDNVIVTAKSGV 285

Query: 310 LKDIPAGQQYG-GMPARPIGEYLRHMVMLSK 339
             D+P    YG  + A    ++ R + +L K
Sbjct: 286 GSDLPPNGIYGSSINAIEWKKWKRVIAILPK 316


>gi|154173969|ref|YP_001408225.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter curvus 525.92]
 gi|166199084|sp|A7GYD3|LPXD_CAMC5 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|112802194|gb|EAT99538.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter curvus 525.92]
          Length = 317

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/323 (37%), Positives = 182/323 (56%), Gaps = 21/323 (6%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++AQ  GAS   E+     I++L+ +  A+  ++SY    K    I    A AI+ 
Sbjct: 1   MKLSEIAQKTGASFSGEDI---EIFALNSLKNANKAELSYCDGEKNAKFIAGSNAGAILI 57

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           SQ++  F+P+ +  L+ + P ++FAI  S  + + +  E               +   I 
Sbjct: 58  SQNLTSFVPEGMSALVCENPHLAFAIL-SKDFAKPLFCEP--------------KPSNIA 102

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILH 191
           +   I   A +   V +G  + V  G  +G  V+IG+NC I     IY+  +IG+   L 
Sbjct: 103 ESATIMSNAYIGSNVSVGEGSIVMAGVFLGDNVKIGQNCIIHPNVVIYNDCVIGDECHLL 162

Query: 192 SGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           +   IG+DGFGYA   +  H KI H G V++ D VE+GA + IDRG  + T+I   TKID
Sbjct: 163 ANCVIGSDGFGYAHTKTGEHVKIYHNGNVVLGDFVEVGACTTIDRGVFESTMIASYTKID 222

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGHN  +G GC+IVSQ G+AGST +G NV++GGQ G AG++++GD  QIA++ GV 
Sbjct: 223 NLVQIGHNCELGNGCLIVSQTGLAGSTTLGRNVVMGGQSGSAGHVRVGDFAQIAARGGVS 282

Query: 311 KDIPAGQQY-GGMPARPIGEYLR 332
           KD+ AG++Y G  P  P+ E+ +
Sbjct: 283 KDLDAGKKYAGAYPIMPLDEFFK 305


>gi|171909601|ref|ZP_02925071.1| UDP-3-O- [Verrucomicrobium spinosum DSM 4136]
          Length = 350

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 115/304 (37%), Positives = 168/304 (55%), Gaps = 9/304 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           +I   + +  A  GD+S+    ++   +E+ +A+A++   D   F P+N+ CL    P V
Sbjct: 29  LISGFASLKEAGPGDLSFFSDMRYRRLLEQTQATAVLMPMDWTVF-PENVVCLGVQNPSV 87

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE-DGVVIAPMAVVYPGVEIGRKT 153
           +F         +   ++   F  G+   A +G  V    D + I P AV+  GV IG  +
Sbjct: 88  AFETV-----TERFGLQPEPFTPGVHASAVVGNCVDTNLDKIKIGPNAVIEDGVHIGDGS 142

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHK 212
            VG G  +G GV +G +C + A S+++    +G+ V+LHS   IG DGFGY        K
Sbjct: 143 EVGAGCFVGRGVSMGEDCRMHANSTVHEGCQLGDRVVLHSSSVIGADGFGYVFKDGRHRK 202

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           +   G V + D VEIGA+S +DR     T IGE TKIDNQVQI HNV +G  CII++  G
Sbjct: 203 VRQSGIVQLDDDVEIGASSTVDRARFGRTWIGEGTKIDNQVQIAHNVVVGKHCIIIAGCG 262

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQ-QYGGMPARPIGEYL 331
           IAGS+ +GD V+I  Q G+AG++ IG    +A+++ V KD+P G   Y G PA P+ E  
Sbjct: 263 IAGSSRVGDYVVIAAQSGVAGHVSIGSQCTLAARTVVTKDLPPGSGTYMGFPATPVMEER 322

Query: 332 RHMV 335
           R MV
Sbjct: 323 RRMV 326


>gi|196232685|ref|ZP_03131536.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chthoniobacter flavus Ellin428]
 gi|196223145|gb|EDY17664.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chthoniobacter flavus Ellin428]
          Length = 349

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 187/338 (55%), Gaps = 10/338 (2%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
             + ++A  +G  L+  +  E  ++ ++ ++ A  G+I++  + K++  ++  +A+A++ 
Sbjct: 3   FTVQEIAALVGGRLVSNSGLETKVHGVASLSEAEPGEITFFGNAKYITQLKTTRATAVLV 62

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D    I     C+  + P ++FA       P+ +      F  G+ P A LG++V + 
Sbjct: 63  PADFAETISALAICV--ENPSLAFAQLLQKFAPEPIR-----FLPGVHPTAVLGKNVVLG 115

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           + V I P  V+  GV+IG  T +G    IG    IG++C      ++ +   +GN VILH
Sbjct: 116 ENVSIQPYVVIEEGVQIGANTLIGAHGYIGHETHIGQDCQFAPRVTVGARCQVGNRVILH 175

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SGV +G+DGFG+        KI   G V + D VEIGAN+ IDR     T I + TKIDN
Sbjct: 176 SGVVLGSDGFGFEFAEGKHVKIPQTGIVQVDDDVEIGANTTIDRARFGRTWIQQGTKIDN 235

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQI HNV +G  CI+VSQ G++GST +G+ V + GQ GI G+++IGD   IA+KSGV K
Sbjct: 236 LVQIAHNVVVGKHCILVSQAGVSGSTKLGNYVTLAGQVGIVGHIEIGDQAIIAAKSGVSK 295

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKY-KIKR 347
            +P  + + G PA  I E    +  +++ P  Y ++K+
Sbjct: 296 SVPPKEIFFGYPATQIQEQKEQLACIARLPKLYARVKK 333


>gi|157164571|ref|YP_001466737.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter concisus 13826]
 gi|166199083|sp|A7ZD79|LPXD_CAMC1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|112800170|gb|EAT97514.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter concisus 13826]
          Length = 317

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 185/335 (55%), Gaps = 30/335 (8%)

Query: 16  MKLAQSIGASLLDENF-GERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           MKL++   A  +D  F GE + I++L+ +  A+  +++Y    K    I    A AI+ +
Sbjct: 1   MKLSEI--ALKVDATFSGEDLEIFALNSLKNANKAELTYCDGEKNAKFISTSNAGAILVT 58

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           + ++  +P  +  L+ D P ++FAI   I Y + +  E               +   I  
Sbjct: 59  KSLLDLVPAGMVALVCDNPHLAFAILSKI-YAKPLFCEP--------------KPSNIAQ 103

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHS 192
              I P   +   V +G  T V  G+ +G  V IG+NC I     IY+  +IGN   L +
Sbjct: 104 SATIMPNVYIGSNVSVGENTIVMAGAFLGDNVTIGKNCIIHPNVVIYNDCVIGNECHLLA 163

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
              IG+DGFGYA   +  H KI H G V++ D VEIGA + IDRG  + T+I   TKIDN
Sbjct: 164 NCVIGSDGFGYAHTKTGEHVKIYHNGNVVLGDFVEIGACTTIDRGVFESTMIANYTKIDN 223

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G GC+IVSQ G+AGST +G NV++GGQ G AG++K+GD  QIA++ GV K
Sbjct: 224 LVQIGHNCELGNGCLIVSQTGLAGSTVLGRNVVMGGQSGSAGHVKVGDFAQIAARGGVSK 283

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           D+P G++Y G  A PI E       LS+  K++ K
Sbjct: 284 DLPGGKKYAG--AYPIME-------LSEQFKFQAK 309


>gi|262277272|ref|ZP_06055065.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (Protein
           FirA) (Rifampicin resistance protein) [alpha
           proteobacterium HIMB114]
 gi|262224375|gb|EEY74834.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (Protein
           FirA) (Rifampicin resistance protein) [alpha
           proteobacterium HIMB114]
          Length = 317

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 174/309 (56%), Gaps = 23/309 (7%)

Query: 29  ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLL 88
           E    + + ++S +  A  GD++++ + KFLN++   KAS  +  +  + ++  +   ++
Sbjct: 26  EKLKNQKVKNISNLQDAQKGDLTFLENSKFLNDLIATKASYCLIDKKYIKYVNNSTIPII 85

Query: 89  SDKPEVSFAIAGSILYPQA-----MHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVV 143
           S++P + F +A  + YP+A        +   ++       F+   VKI +G  I      
Sbjct: 86  SEQPLLDFILAAKMFYPEADKDNYKFKQNLKYKNLTKNSTFIDASVKISNGFKI------ 139

Query: 144 YPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGY 203
                       G  S I   V IG+N SIG+   + +S+IG++V ++ G  IG  GFG+
Sbjct: 140 ------------GINSTIKKNVIIGKNVSIGSNCVVSNSIIGDNVTINDGSVIGKIGFGF 187

Query: 204 ARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGC 263
                 ++ I HIG V I++ V IG+N  IDRG+   T++G+NT IDNQV I HNV IG 
Sbjct: 188 KYIKEKLYFIPHIGYVEIENNVYIGSNCTIDRGSFSKTLVGQNTMIDNQVHIAHNVKIGS 247

Query: 264 GCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMP 323
            C I  QVGIAGS ++G++ +IGGQ GI+G+LKIG+NVQI   SGVLK++    +  G P
Sbjct: 248 SCFITGQVGIAGSAFLGNHCMIGGQAGISGHLKIGNNVQIGGGSGVLKNLDDNAKVIGYP 307

Query: 324 ARPIGEYLR 332
           AR I ++L+
Sbjct: 308 ARSIKDFLK 316


>gi|46447362|ref|YP_008727.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Protochlamydia amoebophila UWE25]
 gi|60390022|sp|Q6MAE7|LPXD_PARUW RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|46401003|emb|CAF24452.1| putative UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 349

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 175/313 (55%), Gaps = 10/313 (3%)

Query: 34  RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIP-KNIPCLLSDKP 92
           ++I S++ +  AS  D S+  + ++L ++++ +A  +       P I  KN   LLS+ P
Sbjct: 26  QIIKSVADLENASEEDASFFANNRYLQSLKESQAGVVFVDLQ-TPLIEGKNY--LLSENP 82

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
             SF      LYPQ  H   S F G I   A +    +I + V I P AV+  GV+IG  
Sbjct: 83  SRSFQHLIDTLYPQKKH--PSGFTG-IHTSAVIHPTAEIGNKVTICPQAVIDEGVKIGSG 139

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           +++G G  IG+   IG +C+I     I     +GN VIL  GV IG+ GFGY       H
Sbjct: 140 SFIGAGVYIGSYSEIGEDCTIHPRVVIREKCYLGNRVILQPGVVIGSCGFGYTTNQQGQH 199

Query: 212 -KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            K+  +G V +++ VEIGAN+ IDR     T IG+ TKIDN VQI H V IG   IIVSQ
Sbjct: 200 IKLNQVGNVWVENDVEIGANTTIDRARFKSTRIGQGTKIDNLVQIAHGVTIGSYNIIVSQ 259

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAGST  G  V+I GQ  IAG+L + D+V +A KSGV K +  G +Y G+PA PI +Y
Sbjct: 260 TGIAGSTTTGKYVVIAGQAAIAGHLHLKDHVVVAGKSGVTKSLNTG-KYSGIPAMPIKDY 318

Query: 331 LRHMVMLSKPSKY 343
            R+ V L K   Y
Sbjct: 319 NRNQVFLRKIEIY 331


>gi|195952580|ref|YP_002120870.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hydrogenobaculum sp. Y04AAS1]
 gi|195932192|gb|ACG56892.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 324

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 145/224 (64%), Gaps = 2/224 (0%)

Query: 118 GISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGS 177
           GIS +AF+ E V I+  V I P + +   V +G    + P + +G    IG N  + +G 
Sbjct: 90  GISDKAFIEESVHIDKDVYIGPFSYIGKNVSLGEGVLIYPFTYVGDNTIIGDNSILYSGV 149

Query: 178 SIY-SSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRG 236
            IY +++IG +VI+HSG  IG DGFGYA G   I K+ HIG VII+D VEIGAN+ IDR 
Sbjct: 150 HIYKNTVIGKNVIIHSGAVIGADGFGYAIGPEGIKKLNHIGNVIIEDNVEIGANTTIDRS 209

Query: 237 TIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLK 296
            +D TIIG++TKIDN V +GHN  IG  C +VSQVG++GS  IGDN ++ GQ G+A ++ 
Sbjct: 210 LLDSTIIGKSTKIDNLVMVGHNCKIGQNCFLVSQVGLSGSVNIGDNSILAGQVGVADHVN 269

Query: 297 IGDNVQIASKSGVLKDIPAGQQYGG-MPARPIGEYLRHMVMLSK 339
           IG NVQ+A+KSGV  D+P+   YG  +P+    ++ R  V L K
Sbjct: 270 IGSNVQVAAKSGVAYDLPSNNTYGANLPSIEWNKWKRIYVSLLK 313


>gi|251771051|gb|EES51635.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leptospirillum ferrodiazotrophum]
          Length = 356

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 179/322 (55%), Gaps = 12/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L ++A  +G +L+  + G   I S+ P+  A   D++++ + K+   +   KA AI+ 
Sbjct: 2   ITLAQIASQVGGTLIGSD-GSLEIRSIRPMNEAGPHDLTFLSNPKYRKAVPHLKAGAILV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            + +      +IP ++   P ++ AI     +P        S + GISP A +    +I 
Sbjct: 61  PEILAE---ASIPQIVVASPYLAMAILLQHFFP------LPSPKAGISPHAVVDPSARIG 111

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           DGV I    VV    EIG  T + PG VIG G +IG+NC +    S+   + +G+ VI+ 
Sbjct: 112 DGVEIRAGCVVEAEAEIGAGTLLFPGCVIGTGAKIGKNCVLYPRVSLLDRVRLGDRVIIQ 171

Query: 192 SGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  IG+DGFG+A G      KI   G V+++D VEIGAN  IDR T  +T+IG  TKID
Sbjct: 172 SGAVIGSDGFGFAEGPEGRRVKIPQTGTVVLEDDVEIGANVTIDRATFGETVIGRGTKID 231

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQI HNV  G  C+IV+Q G++GST +GD V++ GQ G+ G++++G    + ++SG+ 
Sbjct: 232 NLVQIAHNVRTGSDCVIVAQAGVSGSTKLGDRVVLAGQVGVVGHIEVGSGSMVGAQSGIA 291

Query: 311 KDIPAGQQYGGMPARPIGEYLR 332
             +    +  G PA P   +LR
Sbjct: 292 HSLEPNSRVSGSPALPHTLWLR 313


>gi|262039005|ref|ZP_06012339.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leptotrichia goodfellowii F0264]
 gi|261746915|gb|EEY34420.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leptotrichia goodfellowii F0264]
          Length = 334

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 129/317 (40%), Positives = 176/317 (55%), Gaps = 25/317 (7%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFI---PKNIP-CLLSDKPEV 94
           LSP  +A   +I++    K L  IE+CKA A+I     VPF+   P+N    ++ + P  
Sbjct: 26  LSPFFQAKENEITFAADEKMLKKIEECKAGAVI-----VPFVEGLPENKTYIVVKNNPRE 80

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG--VEIGRK 152
              I  S   P+    E S             +  +I +G  I+P+   Y G  V+IG+ 
Sbjct: 81  LMPILLSYFKPEIKPFEKSR-----------EDSAQISEGANISPINT-YIGHNVKIGKN 128

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           T V P   I  G  IG NC I +  +I   + IGN  I+  G  IG+DGFG+ +   +  
Sbjct: 129 TVVYPNVSIFEGAEIGDNCIIYSNVTIREFTKIGNGSIIQPGAVIGSDGFGFIKVNGNNV 188

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  IG+VII+++VEIGAN+ +DRGTI DT+I + TKIDN V I HN  IG  C IV+Q 
Sbjct: 189 KIEQIGKVIIEEEVEIGANTCVDRGTIGDTVIKKGTKIDNLVHIAHNDIIGENCFIVAQT 248

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GI+GS  +G+N  + GQ G+AG+LKIG+NV IA++SGV  D+P G+Q  G P R   E L
Sbjct: 249 GISGSVEVGNNTTLAGQVGVAGHLKIGNNVVIAARSGVTNDVPDGKQMSGYPLRDHMEDL 308

Query: 332 R-HMVMLSKPSKYKIKR 347
           R  M M   P   K  R
Sbjct: 309 RIKMAMGKVPELVKKFR 325


>gi|223940437|ref|ZP_03632289.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [bacterium Ellin514]
 gi|223890882|gb|EEF57391.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [bacterium Ellin514]
          Length = 346

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 176/306 (57%), Gaps = 10/306 (3%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           ++   +P  RA  GD+++  +  +    E   ASAI+ S D   F  K    +      V
Sbjct: 23  VLKGFAPADRAQPGDLTFAENDTYFARAETSAASAILVSGD---FSSKLKTIIRVVNARV 79

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           +FA    + +P+       +F  GI   A +    +++    I P  V+  GV IG +T 
Sbjct: 80  AFAKVLPLFFPE------PTFAAGIHSTAIVAPSAQVDATAHIGPYCVIGEGVRIGARTV 133

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           +  G+ +GA  ++G + +     +IYS + IG+ V +HSG  IG+DGFGY        K+
Sbjct: 134 LQGGNHVGAASQLGEDNNFFPNVTIYSRTQIGSRVRIHSGTVIGSDGFGYVFDEGAHRKV 193

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             IG VII D VEIGAN  +DRG +  T+IG+ TKIDN VQI HNV IG   ++V+QVG+
Sbjct: 194 PQIGNVIIGDDVEIGANVTVDRGALGPTVIGKGTKIDNLVQIAHNVSIGEHSLLVAQVGV 253

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           AGS  +G+ V++GGQ GIAG+LKIG+ V +A+++GV+ DI  G+++ G PA+P  +  R 
Sbjct: 254 AGSCKLGNYVILGGQVGIAGHLKIGNRVTVAAQAGVMHDIKDGEKWIGSPAQPDRQGKRQ 313

Query: 334 MVMLSK 339
           MV + +
Sbjct: 314 MVAVHQ 319


>gi|86157510|ref|YP_464295.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|119371915|sp|Q2IPX9|LPXD_ANADE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|85774021|gb|ABC80858.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 354

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 180/330 (54%), Gaps = 17/330 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G  +  +  G+  +  ++P+  A+  +IS+  +RK+    E  +A A++   
Sbjct: 6   LAELAARVGGQV--DGDGKLRLEGIAPLEEATAAEISFFSNRKYRKAFEASRAGAVVVEP 63

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +P   P L      ++FA   ++ +P    M        ++P A +    ++   
Sbjct: 64  G--EKVPAGRPVLRVVNAYLAFAKISTLFHPPREAMPE------VAPTAVIHPTARVHPS 115

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
             + P+A V P  ++G +T + PG  +  G R+G +C +     +     +GN VIL  G
Sbjct: 116 AQVMPLACVGPDAQVGARTILFPGVHVADGARVGEDCVLYHNVVVRERCAVGNRVILQPG 175

Query: 194 VRIGNDGFGYA-----RGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
             +G+DGFG+A      G    H K+  +G V+I+D VE+GAN+ +DR T+  T IG   
Sbjct: 176 CVVGSDGFGFAFDPDGEGKGPRHYKVPQVGNVVIEDDVEVGANTCVDRATLGSTRIGRGA 235

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           KIDN VQI HNV +G   ++VSQVG+AGST +G  V+ GGQ GI G+L+IGD V+I ++S
Sbjct: 236 KIDNLVQIAHNVQVGPLSLLVSQVGVAGSTKLGMGVVAGGQAGIVGHLEIGDGVRIGAQS 295

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
           GV+ D+ AG+   G PA P G +L+ M  L
Sbjct: 296 GVMADVEAGETVSGSPAVPHGNWLKAMASL 325


>gi|209543234|ref|YP_002275463.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530911|gb|ACI50848.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 345

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/344 (33%), Positives = 188/344 (54%), Gaps = 13/344 (3%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEK 64
            FF S     L  +AQ++G +L      E ++  L+ +  A    +S++ SR+ +  ++ 
Sbjct: 11  RFFASSGPHMLSAIAQAVGCALPSR---ELVLTGLAGLENARPEHVSFLGSRRLVMQLDH 67

Query: 65  CKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY--PQAMHMEASSFEGGISPQ 122
            +A A++  +++   +P +   L+   P V++A   ++ +  PQ +         G+ P 
Sbjct: 68  TRAGAVLVREEMASHVPDSSIALVVADPFVAWAQVAALFHAKPQVV--------AGVHPT 119

Query: 123 AFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS 182
           A +  D  ++    I P  V+    EIG +  +G G+VIG GV +G +C I    +I  +
Sbjct: 120 AVIAADAVVDASAQIGPHVVIGARAEIGARCQLGAGTVIGDGVVLGTDCRIHTHVNISHA 179

Query: 183 LIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTI 242
           L+G+ V L  GV++G +GFG+            +G V I + VEIGAN+ IDRG + +T+
Sbjct: 180 LLGSRVTLFPGVQVGQEGFGFTMTEHGFLTTPQLGIVEIGNDVEIGANTTIDRGAMSNTV 239

Query: 243 IGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQ 302
           IG+ T+IDN VQ+GH V IG  C I   VG++GS  + D V IGGQ G+A ++ +G   Q
Sbjct: 240 IGDGTRIDNLVQVGHGVRIGRYCAISGHVGLSGSCVLDDYVTIGGQAGLADHVHVGAKAQ 299

Query: 303 IASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           I +K+GV+ DI AG    G PA+P+ E+ R + ML + ++   K
Sbjct: 300 IGAKAGVMSDIAAGMAVLGAPAQPVKEFFREVAMLRRLTRRNGK 343


>gi|189467995|ref|ZP_03016780.1| hypothetical protein BACINT_04389 [Bacteroides intestinalis DSM
           17393]
 gi|189436259|gb|EDV05244.1| hypothetical protein BACINT_04389 [Bacteroides intestinalis DSM
           17393]
          Length = 346

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 172/309 (55%), Gaps = 10/309 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I + KAS ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYTSYIYETKASIVLVNKDFVPEQEIKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+    A     GI P AF+ E  KI   V IAP A +    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRA-----GIDPLAFVAETAKIGKDVYIAPFACIGEYA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P + +G+G ++G +C + A ++IY    IGN  ILHSG  IG DGFG+A  
Sbjct: 130 EVGDNTMIHPHATVGSGAKVGSDCILYANTTIYHDCRIGNHCILHSGSVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG VI++D VEIGAN+ +DR T+  TI+ +  K+DN +Q+ HN  IG   +
Sbjct: 190 PEGYEKIPQIGIVILEDNVEIGANTCVDRATMGATIVHKGVKLDNLIQVAHNDEIGANTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST IG+  + GGQ GIAG++ IG+ V + ++SGV  +I  G Q  G P   
Sbjct: 250 MAAQVGIAGSTKIGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPSNIKDGSQLIGTPPMD 309

Query: 327 IGEYLRHMV 335
             +Y R  V
Sbjct: 310 PKQYFRASV 318


>gi|322418269|ref|YP_004197492.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Geobacter sp. M18]
 gi|320124656|gb|ADW12216.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Geobacter sp. M18]
          Length = 346

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 187/332 (56%), Gaps = 12/332 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++A+ +G ++  +  GE +I  L+ +  A  G ++++ + K+   +    ASA++  
Sbjct: 4   TLREIAEYLGGTVSGD--GEILIGGLATLDDAGEGQLTFLANPKYAGKVATTNASAVLMG 61

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
              V         +    P ++FA   ++ Y       A     G  P +F+    KI  
Sbjct: 62  ---VGGNTHGKNAIFHTNPYLAFAKLLTLFY------TAPPPRLGALPGSFVAPGAKIGQ 112

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
            V I P A V PGV +G +  + PG V+  G  +G + ++ A  SI     IGN V +H 
Sbjct: 113 DVTIYPGASVGPGVTVGDRVTLYPGVVLYPGASVGDDVTLYANVSIRERCRIGNRVTIHD 172

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           G  IG+DGFGYA   S  +KI  IG V+I+D VEIG+N+ IDR  ++ T I   TKIDN 
Sbjct: 173 GTVIGSDGFGYAPDGSSWYKIPQIGIVVIEDDVEIGSNTVIDRAALEVTRIKRGTKIDNL 232

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQIGHN  IG  C+IVSQVGI+GST +G++V++GGQ G+AG++K+GDNV I +KSGV  +
Sbjct: 233 VQIGHNCVIGEDCMIVSQVGISGSTQLGNHVILGGQVGVAGHIKVGDNVMIGAKSGVAGN 292

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           +   Q   G+P  P  E+L+   ++ K  +++
Sbjct: 293 VEPNQVLSGIPVMPHREWLKSSGLVPKLPEFR 324


>gi|206901689|ref|YP_002250534.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dictyoglomus thermophilum H-6-12]
 gi|206740792|gb|ACI19850.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dictyoglomus thermophilum H-6-12]
          Length = 337

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 126/327 (38%), Positives = 186/327 (56%), Gaps = 16/327 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIE-KCKASAIICS 73
           L ++A+ IG  L  E+     I  ++    A+  D+ ++   K +  IE K +A +++  
Sbjct: 3   LSEIAKIIGGELTGEDM---EIEKVAEWESATERDLVFVFKSKDVAEIEDKTRARSLVIP 59

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            D      K     + D P+++ A    IL       +   +  GI   A LG +V++ +
Sbjct: 60  SD---GKAKKTHIKVED-PKLAMA---KIL----KFFDFRVYPSGIHNTAVLGNNVELGE 108

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHS 192
              I    V+   V+IG  T + PG VIG  V IG NC I   ++IY   +IGN+VI+HS
Sbjct: 109 NTGIGAYVVIGNNVKIGAGTKIFPGVVIGNNVEIGENCIIYPRNTIYDHVIIGNNVIIHS 168

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           G  IG DGFGY     +  KI HIG+VII+D VEIG N+ I+R T+ +T IG+ TKI + 
Sbjct: 169 GCSIGVDGFGYVWDGKEHFKITHIGKVIIEDNVEIGGNTVIERATLGETRIGKGTKIGSL 228

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           + IGHNV IG  C+IVSQ GIAGS+ +G+ V++ GQ G++ ++K+G+NV I +KSGV KD
Sbjct: 229 IMIGHNVKIGENCVIVSQSGIAGSSILGNGVIMAGQSGVSDHVKVGNNVVILAKSGVTKD 288

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +P      G PARP  E ++   +L K
Sbjct: 289 VPDNTVVSGFPARPHSEEMKVQAILRK 315


>gi|224538306|ref|ZP_03678845.1| hypothetical protein BACCELL_03197 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520091|gb|EEF89196.1| hypothetical protein BACCELL_03197 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 346

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 172/309 (55%), Gaps = 10/309 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I + KAS ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYTSYIYETKASIVLVNKDFVPEQEIKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI P AF+ E  KI   V IAP A +    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRV-----GIDPLAFVAETAKIGKDVYIAPFACIGEYA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P + IG+G +IG +C + A ++IY    IGN  ILHSG  IG DGFG+A  
Sbjct: 130 EVGDNTMIHPHATIGSGAKIGSDCILYANTTIYHDCRIGNHCILHSGCVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG VI++D VEIGAN+ +DR T+  TI+ +  K+DN +Q+ HN  IG   +
Sbjct: 190 PEGYEKIPQIGIVILEDNVEIGANTCVDRATMGATIVHKGVKLDNLIQVAHNDEIGANTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST +G+  + GGQ GIAG++ IG+ V + ++SGV  +I  G Q  G P   
Sbjct: 250 MAAQVGIAGSTKVGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPSNIKDGSQLIGTPPME 309

Query: 327 IGEYLRHMV 335
           + +Y +  V
Sbjct: 310 LKQYFKASV 318


>gi|32266598|ref|NP_860630.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter hepaticus ATCC 51449]
 gi|60390073|sp|Q7VH68|LPXD_HELHP RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|32262649|gb|AAP77696.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter hepaticus ATCC 51449]
          Length = 326

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 118/311 (37%), Positives = 173/311 (55%), Gaps = 17/311 (5%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           ++P+  A+   ISYI   K+L+N+   +A A+     ++  +P +I  L+ + P ++FA+
Sbjct: 30  IAPLESATPTQISYIDQDKYLSNLTDSQAGAVFIRPHLLDKVPSHIQPLVVENPHLAFAL 89

Query: 99  AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPG 158
              +         A  F   ++ Q     +++I   VVI         V IG  + + P 
Sbjct: 90  LSQLF-------AAPCFT--LTTQNPRTNNIQIGANVVIGD------NVSIGEHSIIMPN 134

Query: 159 SVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHI 216
            VIG  V IG +C I     IY  S+IGN V +H+G  IG DGFGYA      H KI H 
Sbjct: 135 VVIGDNVSIGEHCKIYPNVVIYRDSIIGNRVNIHAGSIIGCDGFGYAHTAEGKHIKIEHN 194

Query: 217 GRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS 276
           GRV+I+D VEIGAN+ IDR     T+I +  KIDN VQIGHN  +G   ++VSQVG+AGS
Sbjct: 195 GRVVIEDDVEIGANNTIDRAVFGQTLIKQGAKIDNLVQIGHNCVVGEHTLLVSQVGLAGS 254

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVM 336
           T  G NV++GGQ G  G++ IGD VQ+A +  V K++P   ++GG P   + E+++  V 
Sbjct: 255 TTTGRNVIMGGQAGTGGHIHIGDFVQVAGRGAVGKNLPPHTKWGGHPLMELNEWMKFYVS 314

Query: 337 LSKPSKYKIKR 347
           L +  K   K+
Sbjct: 315 LRRLIKKDSKK 325


>gi|257465893|ref|ZP_05630204.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917049|ref|ZP_07913289.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium gonidiaformans ATCC 25563]
 gi|313690924|gb|EFS27759.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium gonidiaformans ATCC 25563]
          Length = 333

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 165/311 (53%), Gaps = 30/311 (9%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           L+P   A  G++++    KFL  +++CKA  II     +P        ++ D P      
Sbjct: 27  LAPFFHAEEGEVTFAAEEKFLTKLQECKAKVIIVPDVDLPMNLGKTYIVVRDNPR----- 81

Query: 99  AGSILYPQAMHM---EASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
              IL P+ +H         E  I   A +GE+V I             P V IG    +
Sbjct: 82  ---ILMPKLLHFFKRPLKKMEKMIEDSAKIGENVSIA------------PNVYIGHDAVI 126

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYARGVS 208
           G   V+   V IG    IGAGS +YS++       IG   I   G  IG+DGFG+ +   
Sbjct: 127 GDHVVLYPNVFIGEGVEIGAGSILYSNVSIREFVKIGKECIFQPGAVIGSDGFGFVKVQG 186

Query: 209 DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
           +  KI  IG VII+D VEIGAN+ +DRG I +T+I + TKIDN VQI HN  IG  C+IV
Sbjct: 187 NNMKIDQIGSVIIEDFVEIGANTTVDRGAIGNTVIKKYTKIDNLVQIAHNDRIGENCLIV 246

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQVGIAGST IG+NV + GQ G+AG++KIGDN+ I SKSGV  D+ + Q   G P     
Sbjct: 247 SQVGIAGSTEIGNNVTLAGQTGVAGHIKIGDNIIIGSKSGVSGDVKSNQILSGYPLVDHK 306

Query: 329 EYLRHMVMLSK 339
           E L+  V + K
Sbjct: 307 EDLKIKVSMKK 317


>gi|222055193|ref|YP_002537555.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Geobacter sp. FRC-32]
 gi|254810172|sp|B9M8V8|LPXD_GEOSF RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|221564482|gb|ACM20454.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Geobacter sp. FRC-32]
          Length = 348

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 124/338 (36%), Positives = 196/338 (57%), Gaps = 20/338 (5%)

Query: 12  GIALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           G  L ++A+ +G  ++ DEN    ++  L  +  A  G I+++ + K+   +   +A+A+
Sbjct: 2   GKTLKEVAEYLGGRVIGDEN---AVVGGLGTLDDAGEGQITFLANPKYAQKVATTRATAV 58

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY---PQAMHMEASSFEGGISPQAFLGE 127
           I      P   +N+  +    P ++FA   ++ Y   P+A+         G+   A +G+
Sbjct: 59  ILPPG-APGHGRNV--IEVSNPYLAFAKLLTLFYVAPPKAL---------GVMDGAVIGQ 106

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGN 186
            V +   + I P A V  GV++G +  + PG V+  GV +G + ++ A   +     IGN
Sbjct: 107 GVAMGKDISIYPGAHVADGVKMGDRVTLYPGVVLYPGVELGSDVTLHANVVVRERCRIGN 166

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
            V +HSG  IG DGFGYA    D +KI  IG VI++D VEIG+N+ IDR  ++ TIIG  
Sbjct: 167 RVTVHSGTVIGTDGFGYAPDGKDWYKIPQIGIVILEDDVEIGSNAVIDRAALEATIIGRG 226

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
           TKIDN VQI HN  IG  C+IVSQVGI+GST +G++V +GGQ G+AG+++IGDNV + +K
Sbjct: 227 TKIDNLVQIAHNCVIGENCMIVSQVGISGSTKVGNHVTMGGQVGVAGHIQIGDNVMVGAK 286

Query: 307 SGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           SGV  +IPA Q   G+PA    ++L+   +  +  +++
Sbjct: 287 SGVPGNIPANQIVSGIPAFAHRDWLKASSVFPRLPEHR 324


>gi|257452316|ref|ZP_05617615.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_5R]
 gi|317058859|ref|ZP_07923344.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_5R]
 gi|313684535|gb|EFS21370.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_5R]
          Length = 333

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 165/311 (53%), Gaps = 30/311 (9%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           L+P   A  G++++    KFL  +++CKA  II     +P        ++ D P      
Sbjct: 27  LAPFFHAEEGEVTFAAEEKFLTKLQECKAKVIIVPDIDLPMNLGKTYIVVRDNPR----- 81

Query: 99  AGSILYPQAMHM---EASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
              IL P+ +H         E  I   A +GE+V I             P V IG    +
Sbjct: 82  ---ILMPKLLHFFKRPLKKMEKMIEDSAKIGENVSIA------------PNVYIGHDAVI 126

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYARGVS 208
           G   V+   V IG    IGAGS +YS++       IG   I   G  IG+DGFG+ +   
Sbjct: 127 GDHVVLYPNVFIGEGVEIGAGSILYSNVSIREFVKIGKECIFQPGAVIGSDGFGFVKVQG 186

Query: 209 DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
           +  KI  IG V+I+D VEIGAN+ +DRG I +T+I + TKIDN VQI HN  IG  C+IV
Sbjct: 187 NNMKIDQIGSVVIEDFVEIGANTTVDRGAIGNTVIKKYTKIDNLVQIAHNDRIGENCLIV 246

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQVGIAGST IG+NV + GQ G+AG++KIGDN+ I SKSGV  D+ + Q   G P     
Sbjct: 247 SQVGIAGSTEIGNNVTLAGQTGVAGHIKIGDNIVIGSKSGVSGDVKSNQILSGYPLVDHK 306

Query: 329 EYLRHMVMLSK 339
           E L+  V + K
Sbjct: 307 EDLKIKVSMKK 317


>gi|229586240|ref|YP_002844741.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia africae ESF-5]
 gi|259495030|sp|C3PM38|LPXD_RICAE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|228021290|gb|ACP52998.1| UDP-3-O-3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia africae ESF-5]
          Length = 346

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 173/315 (54%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++       N   L +  P  +
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLLHAQNPYFA 96

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +       Y         S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 97  YGKLIDFFY-----TPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGRGVNIGRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R   
Sbjct: 272 SSTIGKYCTLGGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLLKTSNSKLKK 346


>gi|197117233|ref|YP_002137660.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter bemidjiensis Bem]
 gi|226740725|sp|B5EEW8|LPXD_GEOBB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|197086593|gb|ACH37864.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Geobacter bemidjiensis Bem]
          Length = 345

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 185/320 (57%), Gaps = 12/320 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L ++AQ +G ++  +  GE +I  L+ +  A  G ++++ + K+   +   KASA++  
Sbjct: 4   SLNEIAQYLGGTVSGD--GEVLIGGLATLDDAGEGTLTFLANPKYAAKVATTKASAVLMG 61

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                   KN   +    P ++FA   ++ Y       A +   G+ P AF+ + VK+  
Sbjct: 62  TGGNTH-GKN--AIFHPNPYLAFAKLLTLFY------TAPAKPVGVLPGAFVADGVKLGA 112

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
            V + P A +  G  IG +  + PG V+  GV +G + ++ A  S+     IGN V +H 
Sbjct: 113 DVSVYPGAYIGAGAVIGDRVVLHPGVVLYPGVVVGNDVTLHANVSVRERCRIGNRVTIHD 172

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           G  IG+DGFGYA   +  +KI  IG VI++D VEIG+N  IDR  ++ T I   TKIDN 
Sbjct: 173 GTVIGSDGFGYAPDGASYYKIPQIGIVIVEDDVEIGSNCVIDRAALEATRIRRGTKIDNL 232

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI HNV IG  CIIVSQVGI+GST +G++V +GGQ G+AG++KIGDNV I +KSGV  +
Sbjct: 233 VQIAHNVVIGEDCIIVSQVGISGSTQLGNHVTLGGQVGVAGHIKIGDNVMIGAKSGVAGN 292

Query: 313 IPAGQQYGGMPARPIGEYLR 332
           +   Q   G+P  P  ++LR
Sbjct: 293 VEPNQVLSGIPVMPHRDWLR 312


>gi|291614104|ref|YP_003524261.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sideroxydans lithotrophicus ES-1]
 gi|291584216|gb|ADE11874.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sideroxydans lithotrophicus ES-1]
          Length = 347

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 171/318 (53%), Gaps = 16/318 (5%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           +  +  +  +  A+ G I+++ + K+ + +E  KASA+I S+  V      +P ++ D P
Sbjct: 24  DTRVQQIGTLEHATAGQIAFLANAKYRSQLEGSKASAVILSRADVD--ATGLPRIVCDNP 81

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
              FA   + L P A ++       G+ P A +G+DV+I     I P+  +  G  IG  
Sbjct: 82  YSYFARLSAFLNPLARYVP------GVHPSAIIGKDVQISAQAYIGPLVTIGDGAVIGEG 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIH 211
             V  G  IG GV +GRN  +    +IY   LIG+ VI+HSG  IG DGFG A       
Sbjct: 136 AVVMAGCCIGEGVTLGRNTRLYPRVTIYHGCLIGSDVIVHSGAVIGADGFGIAMDEGRWL 195

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  IGRV+I D VEIGAN+ IDRG +DDT+I E  K+DNQ+Q+ HNV IG    I   V
Sbjct: 196 KIPQIGRVVIGDHVEIGANTTIDRGALDDTVIEEGAKLDNQIQVAHNVRIGAHTAIAGCV 255

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGM-------PA 324
           GIAGS  IG    IGG  GI G+L+I DNV++AS + V K I     Y G+         
Sbjct: 256 GIAGSATIGKYCRIGGSAGILGHLQIADNVEVASFTLVGKSISEPGSYAGIYPFSKNDEW 315

Query: 325 RPIGEYLRHMVMLSKPSK 342
           R    +LRH+  L K  K
Sbjct: 316 RNNAVHLRHLGDLVKRVK 333


>gi|288941768|ref|YP_003444008.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Allochromatium vinosum DSM 180]
 gi|288897140|gb|ADC62976.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Allochromatium vinosum DSM 180]
          Length = 348

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 185/338 (54%), Gaps = 18/338 (5%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L +LA  +G SL  +  GE ++  ++ +  A  G +S++    +  ++ +  ASA+I 
Sbjct: 3   IRLGELAVRLGVSLRGD--GEVVVDHVAQLDSAGAGSLSFLGDPAYRAHLARTHASAVIL 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +         +P LLSD P ++FA A  +L+PQ          GGI P A +    +++
Sbjct: 61  KESDAA--DARVPVLLSDNPYLTFARAVRLLHPQ------PEVVGGIHPSAVVDPGAQVD 112

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
               I P+ V+  GV +G + +VGPG ++G GV +G +  + A  ++ + + +G   ++H
Sbjct: 113 PTAWIGPLTVLEAGVVVGPRVFVGPGCILGEGVEVGADSRLTARVTLCAGTRVGQRALIH 172

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
            G  IG +GFG+A+      +I  +GR ++ D VEIGAN+++DRG I DT+IG   K+DN
Sbjct: 173 PGAVIGREGFGFAKDGERWVRIPQVGRALLGDDVEIGANTSVDRGAIGDTVIGHGVKLDN 232

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            +QIGHNV +G    + +  GI+GST IG N  I G  G+AG+L+IGDNV     + V +
Sbjct: 233 HIQIGHNVVVGDNTAMAANTGISGSTRIGRNCTIAGAVGMAGHLEIGDNVHFTGMAMVTR 292

Query: 312 DIPAGQQY-GGMPARPIGEY------LRHMVMLSKPSK 342
                  Y  G+PA P  ++       RH+  L++  K
Sbjct: 293 SFKEPGVYSSGIPAMPNADWRRNAARFRHLDELTRRVK 330


>gi|146300653|ref|YP_001195244.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Flavobacterium johnsoniae UW101]
 gi|146155071|gb|ABQ05925.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Flavobacterium johnsoniae UW101]
          Length = 347

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 173/306 (56%), Gaps = 8/306 (2%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           LS I     G ++++ + K++N I   KA+  I +     FIP+        K E ++A 
Sbjct: 27  LSKIEEGEEGSLTFLANPKYINYIYSTKATVTIVNDS---FIPEQEITTTLIKVEDAYAA 83

Query: 99  AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPG 158
              +L+    + +    + GI PQ+F+ E  K  + + +   + V   V +G    + P 
Sbjct: 84  FSKLLH---FYNQVKLNKNGIEPQSFMSEGTKYGENLYLGSFSYVGQNVVLGDNVKIYPN 140

Query: 159 SVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHI 216
           S IG  V IG N  I AG+ IYS ++IGN+  +HSG  IG DGFG+      ++ K+  I
Sbjct: 141 SFIGDNVTIGDNVFIFAGAKIYSETVIGNNCTIHSGTIIGADGFGFVPNEEGVYSKVPQI 200

Query: 217 GRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS 276
           G VII+D V+IGAN+ IDR T+  TII +  K+DNQ+Q+ HNV IG   +I +Q G+AGS
Sbjct: 201 GNVIIEDNVDIGANTTIDRATLGSTIIRQGVKLDNQIQVAHNVEIGKNTVIAAQSGVAGS 260

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVM 336
           T IG+N +IGGQ GIAG+L IG+NV++ ++SGV ++I   +   G P+    ++ +  V 
Sbjct: 261 TKIGENCMIGGQVGIAGHLTIGNNVRLQAQSGVARNIKDDEVLQGTPSLGYTDFNKSYVH 320

Query: 337 LSKPSK 342
                K
Sbjct: 321 FKNLPK 326


>gi|15891933|ref|NP_359647.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia conorii str. Malish 7]
 gi|20138653|sp|Q92JQ7|LPXD_RICCN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|15619042|gb|AAL02548.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia conorii str. Malish 7]
          Length = 346

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 173/315 (54%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++       N   L +  P  +
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLLHAQNPYFA 96

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +       Y         S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 97  YGKLIDFFYA-----PIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGRGVNIGRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKISH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R   
Sbjct: 272 SSTIGKYCTLGGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLLKTSNSKLKK 346


>gi|291278539|ref|YP_003495374.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Deferribacter desulfuricans SSM1]
 gi|290753241|dbj|BAI79618.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Deferribacter desulfuricans SSM1]
          Length = 324

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 189/332 (56%), Gaps = 14/332 (4%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCK--ASAIIC 72
           MKL++ I   L  +  GE + +  ++ +       I++I     ++ ++K     +AI+ 
Sbjct: 1   MKLSE-IAKHLKADFCGEDVEVLDVASVDFPKDKSITFIGKSNLIDKLDKNSGFVAAIVD 59

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           ++     IP  +P +  D  + +      + YP        + E  IS  A LG D+ +E
Sbjct: 60  AKLKEAKIP--LPYIFVDDLKFAIKTVIDLFYPD------ENVEHYISNHAILG-DIFVE 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
             V I     +  GV+IG+ +++  G  IG  VRIG+NC I +   IYS + IG++VI+H
Sbjct: 111 SPVYIGDFTKIDDGVKIGKNSFIDGGVKIGKNVRIGKNCKIYSNVVIYSDVQIGDNVIIH 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           +G  IG+DGFGY    +   KI  +G V+I+D VEIGAN  IDRGT+ +TIIGE TKIDN
Sbjct: 171 AGSVIGSDGFGYVNTPTGHLKIKQVGSVLIEDDVEIGANCTIDRGTLGNTIIGEGTKIDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHNV IG  CIIVSQ GIAGS+ IGD V+IGGQ G+A ++KI     IAS++GV  
Sbjct: 231 LVQIGHNVKIGKYCIIVSQAGIAGSSEIGDFVIIGGQSGVADHVKIPSGTIIASRAGVPG 290

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSKPSKY 343
           ++     Y G P     ++L+  V+L    KY
Sbjct: 291 NVKKPGVYSGSPIMEHKKWLKMNVILKNLDKY 322


>gi|220916317|ref|YP_002491621.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254810167|sp|B8JFW7|LPXD_ANAD2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|219954171|gb|ACL64555.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 354

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 115/330 (34%), Positives = 178/330 (53%), Gaps = 17/330 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G ++  E  G   +  +SP+  AS  +IS+  +RK+    E  +A A++   
Sbjct: 6   LAELAARVGGAV--EGDGSLRLDGISPLEEASASEISFFSNRKYRKAFEASRAGAVVVEP 63

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
           D    +      L      ++FA   ++ +P    +        ++P A +    ++   
Sbjct: 64  D--EQVAAGRTVLRVANAYLAFAKISTLFHPPREAVPE------VAPTAVIHPTARVHPS 115

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
             + P+A V P  ++G +T + PG  +  G R+G +C       +     +GN VIL  G
Sbjct: 116 AQVMPLACVGPDAQVGARTILFPGVHVADGARVGEDCVFYHNVVVRERCAVGNRVILQPG 175

Query: 194 VRIGNDGFGYA-----RGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
             IG+DGFG+A      G    H K+  +G V+I+D VE+GAN+ +DR T+  T IG   
Sbjct: 176 CVIGSDGFGFAFDPEGEGKGPRHYKVPQVGNVVIEDDVEVGANTCVDRATLGTTRIGRGA 235

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           KIDN VQI HNV +G   ++VSQVG+AGST +G  V+ GGQ GI G+L+IGD V+I ++S
Sbjct: 236 KIDNLVQIAHNVQVGPLSLLVSQVGVAGSTKLGMGVVAGGQAGIVGHLEIGDGVRIGAQS 295

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
           GV+ D+ AG+   G PA P G +L+ M  L
Sbjct: 296 GVMADVEAGETVSGSPAVPHGNWLKAMASL 325


>gi|253702012|ref|YP_003023201.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter sp. M21]
 gi|259495024|sp|C6E5B9|LPXD_GEOSM RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|251776862|gb|ACT19443.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Geobacter sp. M21]
          Length = 345

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 188/331 (56%), Gaps = 12/331 (3%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L ++A+ +G ++  +  GE +I  L+ +  A  G ++++ + K+   +   KASA++   
Sbjct: 5   LREIAEYLGGTVSGD--GEVLIGGLATLDDAGEGTLTFLANPKYAAKVATTKASAVLMGT 62

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                  KN   +    P ++FA   ++ Y       A +   G+ P AF+ + VK+   
Sbjct: 63  GGNTH-GKN--AIFHPNPYLAFAKLLTLFY------TAPAKPVGVLPGAFVADGVKLGAD 113

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V + P A +  G  IG +  + PG V+  GV +G + ++ A  S+     IGN V +H G
Sbjct: 114 VSVYPGASIGAGAVIGDRVVLHPGVVLYPGVVVGNDVTLHANVSVRERCRIGNRVTIHDG 173

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG+DGFGYA   +  +KI  IG VII+D VEIG+N  IDR  ++ T I   TKIDN V
Sbjct: 174 TVIGSDGFGYAPDGASYYKIPQIGIVIIEDDVEIGSNCVIDRAALEATRIRRGTKIDNLV 233

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HNV IG  CIIVSQVGI+GST +G++V +GGQ G+AG++KIGDNV I +KSGV  ++
Sbjct: 234 QIAHNVVIGEDCIIVSQVGISGSTQLGNHVTLGGQVGVAGHIKIGDNVMIGAKSGVAGNV 293

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
              Q   G+P  P  ++LR   +  K  + K
Sbjct: 294 EPNQVLSGIPVMPHRDWLRSAGIAPKLPEMK 324


>gi|189218760|ref|YP_001939401.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylacidiphilum infernorum V4]
 gi|226740729|sp|B3E0P9|LPXD_METI4 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|189185618|gb|ACD82803.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylacidiphilum infernorum V4]
          Length = 351

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 180/333 (54%), Gaps = 22/333 (6%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           ++ +LA  +G  +  E   E  I  +S I  A  G I+++ + ++   +EK +ASAI+ S
Sbjct: 5   SVKQLASLVGGIV--EGEPEIEITGISDILDAKKGQITFLSNPRYEAAVEKTQASAIVVS 62

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +      P  I  +  D P ++F+   S+  PQ       S+E GI P A +G +V+I  
Sbjct: 63  KSYKSSSP--ITLIRVDSPSLAFSQIISLFSPQPF-----SYEPGIHPTALIGREVEIGK 115

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-------SSLIGN 186
            V I P AV+   V+IG       G VIGA V IGR   IG  S  Y        S IG 
Sbjct: 116 EVSIQPYAVIEDKVKIGD------GCVIGAYVFIGRESIIGEKSFFYPHVTIRERSRIGK 169

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
            VILH G  IG+DGFGY +      KI  +G V I D VEIGAN+ +DRG    T I E 
Sbjct: 170 RVILHPGAVIGSDGFGYEQTNGRHEKIPQVGIVQIDDDVEIGANTTVDRGRFGKTWIQEG 229

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
            KIDN VQI HNV IG   II +Q GI+GST +G++V + GQ GIAG++ IGD   I ++
Sbjct: 230 CKIDNLVQIAHNVIIGKNSIIAAQTGISGSTSLGEHVTLAGQVGIAGHIHIGDGATITAQ 289

Query: 307 SGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           SGV KD+P      G  ARPI    +  V+ +K
Sbjct: 290 SGVTKDVPPRAVLSGRHARPINLTHKLEVLYNK 322


>gi|301123809|ref|XP_002909631.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Phytophthora infestans T30-4]
 gi|262100393|gb|EEY58445.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Phytophthora infestans T30-4]
          Length = 202

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 133/195 (68%), Gaps = 1/195 (0%)

Query: 149 IGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVS 208
           IG+ + +G  S++G  V IG + +IGA  ++ +  IGN V++H GVRIG DGFG+    S
Sbjct: 4   IGKSSRIGEFSIVGEDVFIGDSTTIGANVTLQNCTIGNHVVVHPGVRIGQDGFGFMLDTS 63

Query: 209 DIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             H K     RV I D VEIGANS +DRG+  +T++G+  K+DN +QIGHNV +G GC+I
Sbjct: 64  GKHAKKPQELRVEIHDHVEIGANSTVDRGSWRNTVVGKGCKLDNLIQIGHNVQLGTGCVI 123

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
            +Q GIAGST +G+NV IGGQ G+A +LKIGDNV+IA+KSGV+ D+     YGG PA PI
Sbjct: 124 AAQTGIAGSTTLGNNVHIGGQVGVAQHLKIGDNVRIAAKSGVMNDLEPNATYGGSPAVPI 183

Query: 328 GEYLRHMVMLSKPSK 342
            EY R M  L +  K
Sbjct: 184 MEYRRQMAHLRRLGK 198


>gi|255007719|ref|ZP_05279845.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fragilis 3_1_12]
 gi|313145418|ref|ZP_07807611.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313134185|gb|EFR51545.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 346

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 175/317 (55%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + +AS ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGIPGAISFLSNPKYTPYIYETEASIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    M     +   GI P+A++ E  KI   V 
Sbjct: 65  TPEQEVKATLIKVDNAYESLA---KLLNLYEMSKPKRT---GIDPRAYVAETAKIGKDVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           IAP A +    E+G  T + P + +G G +IG NC + A +++Y    +GN+ ILH+G  
Sbjct: 119 IAPFACIGDHAEVGDNTVIHPHATVGGGAKIGSNCILYANATVYHDCRVGNNCILHAGCV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A       KI  IG VI++D VE+GAN+ IDR T+  T+I    K+DN +QI
Sbjct: 179 IGADGFGFAPTPQGYEKIPQIGIVILEDNVEVGANTCIDRATMGATVIHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +QVGIAGST +G+  + GGQ GIAG+LKIG+ V + ++SGV  +I +
Sbjct: 239 AHNDEIGSHTVMAAQVGIAGSTKVGEWCMFGGQVGIAGHLKIGNQVNLGAQSGVPGNIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + +Y +
Sbjct: 299 GSQLIGTPPMELKQYFK 315


>gi|254455874|ref|ZP_05069303.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082876|gb|EDZ60302.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 326

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 174/327 (53%), Gaps = 8/327 (2%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF +H  + +  + Q++     DE +    +  +  +  ++  DI++  S K+       
Sbjct: 5   FFKNHGPLKICDILQTLNLKS-DEKYSNVNVNDIKDLITSNKNDITFFHSNKYKELANNT 63

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KAS  I ++++   +P     ++     ++ +   +  YP A++    S    I    + 
Sbjct: 64  KASFCITNENLKEILPDTCTPVIVKNVLLATSTITAKFYPSAINDNFDSTANFIDKTIY- 122

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                 +D V      ++   V IG    +G  +VI   V IG  C+IG+ S I ++LIG
Sbjct: 123 ------KDKVKFGHNVLIGDNVSIGSNCMIGHNTVIERNVSIGDYCTIGSNSVIRNTLIG 176

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N V +     +G  GFG+        +  HIG VII++  EIG  S IDRG++ +TIIG 
Sbjct: 177 NDVKILDNCVVGKHGFGFFPDKKTNVRYPHIGIVIIENHCEIGCGSTIDRGSMSNTIIGR 236

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
           NT +DNQ+ I HNV IG  CII  QVGIAGST +G N+ IGGQ GI+G+LKIGDNV IA 
Sbjct: 237 NTYLDNQIHIAHNVKIGENCIIAGQVGIAGSTILGKNIKIGGQAGISGHLKIGDNVDIAG 296

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLR 332
            SGV++DIP   +  G PA+ I ++L+
Sbjct: 297 GSGVIRDIPDNSKVMGYPAKNIRDFLK 323


>gi|257463662|ref|ZP_05628053.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. D12]
 gi|317061211|ref|ZP_07925696.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. D12]
 gi|313686887|gb|EFS23722.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. D12]
          Length = 333

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 121/308 (39%), Positives = 165/308 (53%), Gaps = 24/308 (7%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           L+P   A   +IS+    KFL  + +CKA  II     +P     +  ++ D P      
Sbjct: 27  LAPFFHAEEDEISFAAEEKFLTKLGECKAKVIIVPDIDLPMDLGKMYIVVRDNPR----- 81

Query: 99  AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPG 158
              IL P+ +H     F+  +     +     IED   I     + P V IG    +G  
Sbjct: 82  ---ILMPKLLHF----FKRPLKKMEKM-----IEDSAKIGKNVSIAPNVYIGHDAVIGDN 129

Query: 159 SVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYARGVSDIH 211
            V+   V IG    IG GS +YS++       +G   I  SG  IG+DGFG+ +   +  
Sbjct: 130 VVLYPHVFIGEGAVIGEGSILYSNVSIREFVEVGRECIFQSGAVIGSDGFGFVKVQGNNM 189

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  IG V+I+D VEIGAN+ +DRGTI +T+I + TKIDN VQ+ HN  IG  C+IVSQV
Sbjct: 190 KIEQIGSVVIEDFVEIGANTTVDRGTIGNTLIKKYTKIDNLVQVAHNDRIGENCLIVSQV 249

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GIAGST IG+NV + GQ G+AG++KIGDN+ I SKSGV  D+ + Q   G P     E L
Sbjct: 250 GIAGSTEIGNNVTLAGQTGVAGHIKIGDNIVIGSKSGVSGDVKSNQILSGYPLVDHKEDL 309

Query: 332 RHMVMLSK 339
           +  V + K
Sbjct: 310 KIKVSMKK 317


>gi|15618222|ref|NP_224507.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pneumoniae CWL029]
 gi|15835837|ref|NP_300361.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pneumoniae J138]
 gi|16752737|ref|NP_445004.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pneumoniae AR39]
 gi|33241646|ref|NP_876587.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pneumoniae TW-183]
 gi|20138803|sp|Q9Z8N6|LPXD_CHLPN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|4376578|gb|AAD18451.1| UDP Glucosamine N-Acyltransferase [Chlamydophila pneumoniae CWL029]
 gi|7189379|gb|AAF38294.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Chlamydophila pneumoniae AR39]
 gi|8978676|dbj|BAA98512.1| UDP glucosamine N-acyltransferase [Chlamydophila pneumoniae J138]
 gi|33236155|gb|AAP98244.1| UDP glucosamine N-acyltransferase [Chlamydophila pneumoniae TW-183]
 gi|269303177|gb|ACZ33277.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pneumoniae LPCoLN]
          Length = 360

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 171/305 (56%), Gaps = 11/305 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV---PFIPKNIPCLLS 89
           E  I  +  I++A    I+++ + K+ + ++  KA AII S+        + KN   + +
Sbjct: 25  ETPISGVEDISQAQPHHIAFLDNEKYSSFLKNTKAGAIILSRSQAMQHAHLKKNF-LITN 83

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           + P ++F     +          S F G I P A +    +IE  V I P  V+     I
Sbjct: 84  ESPSLTFQKCIELFIEPV----TSGFPG-IHPTAVIHPTARIEKNVTIEPYVVISQHAHI 138

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVS 208
           G  TY+G GSVIGA   +G NC I     I    L+GN V++  G  +G+ GFGY     
Sbjct: 139 GSDTYIGAGSVIGAHSVLGANCLIHPKVVIRERVLMGNRVVVQPGAVLGSCGFGYITNAF 198

Query: 209 DIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             HK + H+G VI+ D VEIGAN+ IDRG   +T+I E TKIDNQVQ+ H+V IG   II
Sbjct: 199 GHHKPLKHLGYVIVGDDVEIGANTTIDRGRFKNTVIHEGTKIDNQVQVAHHVEIGKHSII 258

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K I +   YGG PARP 
Sbjct: 259 VAQAGIAGSTKIGEHVIIGGQTGITGHISIADHVIMIAQTGVTKSITSPGIYGGAPARPY 318

Query: 328 GEYLR 332
            E  R
Sbjct: 319 QETHR 323


>gi|288818079|ref|YP_003432427.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Hydrogenobacter thermophilus TK-6]
 gi|288787479|dbj|BAI69226.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Hydrogenobacter thermophilus TK-6]
 gi|308751681|gb|ADO45164.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Hydrogenobacter thermophilus TK-6]
          Length = 324

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 126/336 (37%), Positives = 183/336 (54%), Gaps = 19/336 (5%)

Query: 13  IALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           + L  +A+ +G  L  D+NF    I  +S +       + +  S++ +  ++  K  A++
Sbjct: 1   MKLGDVAKLLGGRLEGDKNF---EIEGVSSVENPKPKTLVFCSSKRDVERVKDIKQVALV 57

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
               +     ++  C++ +  + + A+   I YP+           G+S +A++GE+V I
Sbjct: 58  VHTPV-----QDANCVVVEDVKYAMAMFLRIFYPE-------EHPSGVSEKAYIGEEVII 105

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVIL 190
            +GV IAP   +   V IG    + P S IG    IG    I +G  IY   +IG  V +
Sbjct: 106 GEGVYIAPFTYIGNKVVIGNHVKIYPFSYIGDQCLIGDETVIFSGVHIYPRCVIGKRVRI 165

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           HSG  IG DGFGY  G   I K+ HIG V+I+D VEIGAN+ IDR  ID TIIG  TKID
Sbjct: 166 HSGAVIGADGFGYYIGKEGITKLHHIGSVVIEDDVEIGANTTIDRALIDRTIIGRGTKID 225

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N V IGHN  IG   I VSQVG+AGS   G NV++ GQ G+A ++ IGDNVQ+ +KSGV 
Sbjct: 226 NLVMIGHNCKIGENNIFVSQVGLAGSVKTGKNVVLAGQVGVADHVSIGDNVQVVAKSGVA 285

Query: 311 KDIPAGQQYGG-MPARPIGEYLR-HMVMLSKPSKYK 344
            D+ A   YG  +P+     + R ++ +L  P  +K
Sbjct: 286 NDLEANGTYGANLPSIEWSRWKRIYLYLLKLPELFK 321


>gi|315453809|ref|YP_004074079.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter felis ATCC 49179]
 gi|315132861|emb|CBY83489.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter felis ATCC 49179]
          Length = 339

 Score =  189 bits (480), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 172/319 (53%), Gaps = 15/319 (4%)

Query: 27  LDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPC 86
           L  NF +  +  ++P+  A+   +SY+  + +L  ++  KA AI    +    IP +   
Sbjct: 16  LPSNFKDFEVAGIAPLEDATPNHLSYVDQKSYLKKLKDTKAGAIFIRAEHAGKIPAHSLA 75

Query: 87  LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG 146
           L +  P ++FA             +   F   ISP        K+ +GVV+ P  V+  G
Sbjct: 76  LTTPNPHLAFARVSETF-------KTDMFVRPISPTP-----PKLGEGVVLMPGVVLGEG 123

Query: 147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYAR 205
           VE+G+ + +    V+G GV+IG +C I    +IY ++ IGN V +H+   IG+DGFGYA 
Sbjct: 124 VEVGQGSVLMANVVVGDGVKIGAHCKIYPNVTIYQNTQIGNHVYIHANSVIGSDGFGYAH 183

Query: 206 GVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCG 264
                H KI H G V I D VEIGAN+ IDR     T I E  K+DN VQ+GHN  +G  
Sbjct: 184 TPEGTHVKIEHTGIVRIDDHVEIGANTTIDRAVFGVTHIQEGVKVDNLVQVGHNCVLGAH 243

Query: 265 CIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GGMP 323
            IIV+QVG++GST +G NV++GGQ G  G++ IG+  QI  K  V KD+P    Y G +P
Sbjct: 244 SIIVAQVGLSGSTTMGRNVVLGGQVGTGGHMHIGEFTQIGGKGAVGKDLPPHTNYAGAIP 303

Query: 324 ARPIGEYLRHMVMLSKPSK 342
           A  I E+   +  L + +K
Sbjct: 304 AMEIHEWHHFLATLRRYAK 322


>gi|149278209|ref|ZP_01884347.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Pedobacter sp. BAL39]
 gi|149230975|gb|EDM36356.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Pedobacter sp. BAL39]
          Length = 357

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 178/321 (55%), Gaps = 10/321 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +  LS I   + G + ++ + K+ N +   +AS +I   + +P  P     +
Sbjct: 19  DEN---AKVTELSKIENGTVGSLCFLSNPKYENYLYSTQASVVIVGSEFIPAQPVASTLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D P  +F++   +L      M   + + GI   +F+    KI   V I   + +  GV
Sbjct: 76  KVDDPYSAFSV---LLEKYNEFMNQMNVQSGIEQPSFIHPSAKIGKNVYIGAFSYISEGV 132

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYA-R 205
           EIG  T +     IG   +IG NC    G  IY+  ++GN+V++H+   IG+DGFG+A +
Sbjct: 133 EIGDDTKIQTQVFIGTDTKIGSNCQFFPGVKIYNRCVLGNNVVIHANTVIGSDGFGFAPQ 192

Query: 206 GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
                 KI  IG V+I+D VEIGAN++IDR T+  T+IG+  K+DN +QI HNV +G   
Sbjct: 193 ADRSYSKIAQIGNVVIEDDVEIGANTSIDRATMGSTVIGKGVKLDNLIQIAHNVEVGAHT 252

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP-AGQQYGGMPA 324
           ++ +Q GI+GST +G+  ++GGQ GIAG+L +    QI +++G+   I    +Q+ G PA
Sbjct: 253 VVAAQSGISGSTKLGEMSVVGGQVGIAGHLSLAKGTQIGAQAGINFSITDENKQWHGSPA 312

Query: 325 RPIGEYLRHMVMLSK-PSKYK 344
           +P+ +++R  V+  + PS  K
Sbjct: 313 QPLRDWMRASVIFKQLPSVEK 333


>gi|53712200|ref|YP_098192.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fragilis YCH46]
 gi|60389933|sp|Q64XW8|LPXD_BACFR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|52215065|dbj|BAD47658.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fragilis YCH46]
          Length = 346

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 116/317 (36%), Positives = 174/317 (54%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + KAS ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGIPGAISFLSNPKYTPYIYETKASIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    M     +   GI  +A++ E  KI   V 
Sbjct: 65  TPEQEVKATLIKVDNAYESLA---KLLNLYEMSKPKRT---GIDERAYVAETAKIGKDVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           IAP A +    EIG  T + P + +G G +IG NC + A S++Y    +GN+ ILH+G  
Sbjct: 119 IAPFACIGDHAEIGDNTVIHPHATVGGGAKIGSNCILYANSTVYHDCRVGNNCILHAGCV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A       KI  IG VI++D VE+GAN+ IDR T+  T+I    K+DN VQI
Sbjct: 179 IGADGFGFAPTPQGYEKIPQIGIVILEDNVEVGANTCIDRATMGATVIHSGVKLDNLVQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +QVGIAGST +G+  + GGQ GIAG+LKIG+ V + ++SGV  +I +
Sbjct: 239 AHNDEIGSHTVMAAQVGIAGSTKVGEWCMFGGQVGIAGHLKIGNQVNLGAQSGVPGNIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + ++ +
Sbjct: 299 GSQLIGTPPMELKQFFK 315


>gi|153003989|ref|YP_001378314.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Anaeromyxobacter sp. Fw109-5]
 gi|166232076|sp|A7H9D4|LPXD_ANADF RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|152027562|gb|ABS25330.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Anaeromyxobacter sp. Fw109-5]
          Length = 352

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 179/334 (53%), Gaps = 17/334 (5%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
             L +LA  +G  ++ +  G  ++  ++P+  A   D+S+  +RK+    E  +A  ++ 
Sbjct: 3   FTLAELASRVGGEVVGD--GALVVEGVAPLEDAGPHDVSFFSNRKYRKAFEASRAGVVVV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D    IP     L +    ++FA   ++ +P    +        I+P+A +    ++ 
Sbjct: 61  EPDA--EIPAGRTVLRARNAYLAFAKISTLFHPPQEPLPE------IAPEAVIHPSARVH 112

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILH 191
               + P+A + P   IG +T V PG  +  G R+G +C +     I    ++GN VIL 
Sbjct: 113 PSAQVMPLASIGPDAVIGARTIVHPGVHVCEGARVGEDCLLYPNVVIRERCVVGNRVILQ 172

Query: 192 SGVRIGNDGFGYA-----RGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
            G  IG+DGFG+A      G    H K+   G  +++D VEIGAN+ IDR T+  T +G 
Sbjct: 173 PGCVIGSDGFGFAFDPDGEGHGPRHFKVPQAGIAVVEDDVEIGANACIDRATLGATRVGR 232

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQ+GHNV +G  C+IV+QVGIAGST +G  V+  GQ GI G+L IGD V++ +
Sbjct: 233 GTKIDNLVQLGHNVELGPLCLIVAQVGIAGSTKLGMGVVAAGQVGIIGHLNIGDGVKMGA 292

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +SG+  D+ AG    G PA+P  ++LR    L +
Sbjct: 293 QSGIAGDVAAGDTVSGTPAQPHADWLRSQAALRQ 326


>gi|60680380|ref|YP_210524.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fragilis NCTC 9343]
 gi|253563761|ref|ZP_04841218.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_2_5]
 gi|265765533|ref|ZP_06093808.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_16]
 gi|81316550|sp|Q5LH14|LPXD_BACFN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|60491814|emb|CAH06572.1| putative UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fragilis NCTC 9343]
 gi|251947537|gb|EES87819.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_2_5]
 gi|263254917|gb|EEZ26351.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_16]
 gi|301161914|emb|CBW21458.1| putative UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fragilis 638R]
          Length = 346

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 174/317 (54%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + KAS ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGIPGAISFLSNPKYTPYIYETKASIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    M     +   GI  +A++ E  KI   V 
Sbjct: 65  TPEQEVKATLIKVDNAYESLA---KLLNLYEMSKPKRT---GIDERAYVAETAKIGKDVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           IAP A +    E+G  T + P + +G G +IG NC + A S++Y    +GN+ ILH+G  
Sbjct: 119 IAPFACIGDHAEVGDNTVIHPHATVGGGAKIGSNCILYANSTVYHDCRVGNNCILHAGCV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A       KI  IG VI++D VE+GAN+ IDR T+  T+I    K+DN VQI
Sbjct: 179 IGADGFGFAPTPQGYEKIPQIGIVILEDNVEVGANTCIDRATMGATVIHSGVKLDNLVQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +QVGIAGST +G+  + GGQ GIAG+LKIG+ V + ++SGV  +I +
Sbjct: 239 AHNDEIGSHTVMAAQVGIAGSTKVGEWCMFGGQVGIAGHLKIGNQVNLGAQSGVPGNIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + ++ +
Sbjct: 299 GSQLIGTPPMELKQFFK 315


>gi|238650222|ref|YP_002916072.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia peacockii str. Rustic]
 gi|259495031|sp|C4K0C3|LPXD_RICPU RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|238624320|gb|ACR47026.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia peacockii str. Rustic]
          Length = 346

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 173/315 (54%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++       N   L +     +
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLLHAQNSYFA 96

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           ++      Y         S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 97  YSKLIDFFYA-----PIKSYPTKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGRGVNIGRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R   
Sbjct: 272 SSTIGKYCALGGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLLKTSNSKLKK 346


>gi|239946639|ref|ZP_04698392.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239920915|gb|EER20939.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 346

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 177/315 (56%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS+ DIS++ + K+   ++  KA+A I  ++   F  +  P  L    E S
Sbjct: 37  IHDIKILQEASSNDISFLSNPKYSEFLKTTKAAACIVPKN---FTGEANPNTLLIHAENS 93

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +   G ++     +    S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 94  YFAYGKLI--NFFYAPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDEVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
              S IG GV IGRN  I    SI  ++IG+ +++ +G +IG DGFG++      HKI H
Sbjct: 152 EAESFIGRGVNIGRNARIEQHVSINYAIIGDDIVILAGAKIGQDGFGFSTEKGVHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIG+N+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGSNTTIDRGSLQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R   
Sbjct: 272 SSTIGKYCALGGQVGIAGHLNIGDGTQVAAQGGVTQNIEAGKIVGGSPAVPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLLKTSNSKLKK 346


>gi|330444494|ref|YP_004377480.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pecorum E58]
 gi|328807604|gb|AEB41777.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila pecorum E58]
          Length = 360

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/305 (40%), Positives = 174/305 (57%), Gaps = 11/305 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ---DIVPFIPKNIPCLLS 89
           E +I  +  I  A +  ++++ + K+++ ++K +A AI+ ++   +   ++ KN+  + S
Sbjct: 25  ETLISGVEEIGEAKSHHVTFLDNEKYISFMKKTEAGAIVVAKLHAEKYAYLNKNL-LISS 83

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           D P + F     +    A    +S FEG I P A +     IED V I P AV+     I
Sbjct: 84  DSPSLVFQKCVELFIKPA----SSGFEG-IHPTAVIHPTACIEDNVCIEPYAVICQHAHI 138

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVS 208
              T +G GS IGA   IG NC I     I   + IG  VI+  G  IG+ GFGY     
Sbjct: 139 KSGTSIGAGSFIGAYSTIGENCLIYPKVVIRERVSIGKRVIIQPGAIIGSCGFGYITNAF 198

Query: 209 DIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             HK + H+G VII+D VEIGAN+ IDRG    T++ E +KIDNQVQI H V IG   I+
Sbjct: 199 GQHKHLKHLGVVIIEDDVEIGANTTIDRGRFKRTLVREGSKIDNQVQIAHQVEIGKHGIV 258

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K I +   YGG PARP 
Sbjct: 259 VAQAGIAGSTKIGNHVIIGGQSGITGHISITDHVIMMAQTGVTKPISSPGVYGGAPARPY 318

Query: 328 GEYLR 332
            E  R
Sbjct: 319 QEIHR 323


>gi|157827871|ref|YP_001494113.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932558|ref|YP_001649347.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia rickettsii str. Iowa]
 gi|416990|sp|P32202|LPXD_RICRI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase; AltName: Full=Protein firA; AltName:
           Full=Rifampicin resistance protein
 gi|166199102|sp|A8GQD0|LPXD_RICRS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|189028520|sp|B0BVR5|LPXD_RICRO RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|349106|gb|AAA26384.1| rifampicin resistance protein [Rickettsia rickettsii]
 gi|157800352|gb|ABV75605.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907645|gb|ABY71941.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia rickettsii str. Iowa]
          Length = 345

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 177/315 (56%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++   F  +  P  +    + S
Sbjct: 36  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKN---FTGEANPNTVLLHAQNS 92

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +   G ++     +    S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 93  YFAYGKLI--DFFYAPIKSYPTKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSII 150

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 151 EAGSFIGRGVNIGRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKIFH 210

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 211 IGIVKIGNNVEIGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAG 270

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R   
Sbjct: 271 SSTIGKYCALGGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSI 330

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 331 IMKQLLKTSNSKLKK 345


>gi|325280549|ref|YP_004253091.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Odoribacter splanchnicus DSM 20712]
 gi|324312358|gb|ADY32911.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Odoribacter splanchnicus DSM 20712]
          Length = 344

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/325 (36%), Positives = 180/325 (55%), Gaps = 11/325 (3%)

Query: 24  ASLLD---ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFI 80
           A+LL    E  GE M+ ++S I       ++++ + K+ + I    AS ++ + D  P  
Sbjct: 9   AALLKGVVEGDGEVMVNNVSKIEEGKPNTLAFLANPKYEHYIYTTAASVVLVNHDFSPV- 67

Query: 81  PKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPM 140
            + +PC L   P    AIA S+L    M+    S   GI   +++GE   I +   +   
Sbjct: 68  -QQVPCTLIRVPSAYEAIA-SLL---QMYDSMRSRPTGIEQPSYIGEGAVIGEAPYVGAF 122

Query: 141 AVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGND 199
           A +  G +IG    + P   IG GV IG + +I AG+ IY   +IG+   +H+G  IG D
Sbjct: 123 AYIGKGAKIGNDVKIYPQVYIGEGVVIGDHTTIYAGAKIYYGCVIGSGCTIHAGTVIGAD 182

Query: 200 GFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNV 259
           GFG+A    + +K+  IG V+I+D VEIGAN+ IDR T+  T I +  K+DN VQI HNV
Sbjct: 183 GFGFAPNGDNYNKVPQIGNVVIEDNVEIGANACIDRATMGSTRIKKGVKLDNLVQIAHNV 242

Query: 260 HIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY 319
            +G   ++ +Q GIAG+T +G + + GGQ GIAG+L+I D   +A++SGV  D+P G  +
Sbjct: 243 VVGENTVMAAQCGIAGTTKVGAHCMFGGQVGIAGHLRIEDKTMLAAQSGVTNDVPEGSVF 302

Query: 320 GGMPARPIGEYLRHMVMLSK-PSKY 343
            G PA  + +Y +  V+  K P  Y
Sbjct: 303 MGAPAFDVSKYRKCYVLFRKLPELY 327


>gi|224418621|ref|ZP_03656627.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter canadensis MIT 98-5491]
 gi|253826832|ref|ZP_04869717.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Helicobacter canadensis MIT 98-5491]
 gi|313142147|ref|ZP_07804340.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter canadensis MIT 98-5491]
 gi|253510238|gb|EES88897.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Helicobacter canadensis MIT 98-5491]
 gi|313131178|gb|EFR48795.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter canadensis MIT 98-5491]
          Length = 340

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/319 (36%), Positives = 174/319 (54%), Gaps = 17/319 (5%)

Query: 31  FGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSD 90
           F    I  +    +A+   ++++   K+L +IEK KA  I+  +  V  +PK     +S+
Sbjct: 36  FDSEAITHIESPLKATCDSLTFLEKEKYLADIEKTKAKVILTRKAYVKNLPKTSLAFVSE 95

Query: 91  KPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            P ++ A   +  + + +      F   I P        KI     IA  A +  G EI 
Sbjct: 96  NPYLAMAYL-TKFFAKPL------FSSKIPP--------KIAPNATIAHNATIGNGSEID 140

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSD 209
             + V  G VIG  V+IG+NC +     IY+   IG++V +H+   IG+DGFGYA     
Sbjct: 141 ENSVVMAGVVIGENVKIGKNCILYPNVCIYNDCEIGDNVSIHANSVIGSDGFGYAHTKDG 200

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            H KI H G+V+++ +VEIG+N++IDR     T I + TKIDN VQIGHN  IG   IIV
Sbjct: 201 QHIKIHHNGKVVLESEVEIGSNTSIDRAVFGQTRICKGTKIDNLVQIGHNCEIGEHSIIV 260

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQ GI+GST  G NV++GGQ G AG+L IG+  QI +K+ + K +PA  ++ G P  PI 
Sbjct: 261 SQAGISGSTTTGRNVVLGGQSGSAGHLHIGEFTQIGAKAAIAKSVPAFGKFSGHPLLPIQ 320

Query: 329 EYLRHMVMLSKPSKYKIKR 347
           ++L+   +  K  K + ++
Sbjct: 321 DWLKLQALFKKMLKKESQK 339


>gi|171910895|ref|ZP_02926365.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Verrucomicrobium spinosum DSM 4136]
          Length = 352

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 168/303 (55%), Gaps = 8/303 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           ++     I  A  G I+++ + ++   ++K +AS ++  +D    IP+++  +    P +
Sbjct: 24  LVTGFGSIQEAEPGHITFLGNPRYAPALKKSRASVLLTGEDFQD-IPESMAVIRVANPTL 82

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE-DGVVIAPMAVVYPGVEIGRKT 153
            F+I      P    ++      G+ P A + E  K+  + V I P  V+   VEIG  T
Sbjct: 83  QFSIVIQKFGPPKREIQT-----GVHPTAVISETAKLNPERVYIGPHVVIEDDVEIGDGT 137

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
            +  GS IG G R+G  C + A + I    ++G+ VI+HSG  IG DGFGY        K
Sbjct: 138 AIYAGSFIGHGSRLGEGCLLHAHAVIKDRCILGDRVIIHSGAMIGTDGFGYEFSNGRHLK 197

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  +G V + D VE+G+ + IDR     T IGE +KIDN VQI HNV  G  C+IVSQVG
Sbjct: 198 IDQVGIVQLDDDVEVGSCTTIDRARFGRTWIGEGSKIDNLVQIAHNVITGKHCLIVSQVG 257

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           I+GST +GD V + GQ G+AG+LKIGD + + +KSG+ KD+     Y G PA+P+ E  R
Sbjct: 258 ISGSTRLGDYVTMAGQVGVAGHLKIGDKITVMAKSGITKDLSESGVYTGYPAKPLMEGRR 317

Query: 333 HMV 335
            + 
Sbjct: 318 ALT 320


>gi|332307495|ref|YP_004435346.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174824|gb|AEE24078.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 344

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/333 (37%), Positives = 179/333 (53%), Gaps = 12/333 (3%)

Query: 13  IALMKLAQSIGASL-LDEN-FGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           ++L +LA  IGA+L L +N   +  I+SLS +A A  G IS++ + ++ + +EK  ASA+
Sbjct: 5   VSLQQLADKIGATLHLAQNDSADTKIHSLSTLASAGNGQISFLSNSRYRSQLEKTAASAV 64

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
           I   + +         L+ D P V FA+A  +L       +      GISP A + + V+
Sbjct: 65  ILKSEDLSHC--QCSALVMDNPYVGFALAAQLLDSTPRSAD------GISPLAVIADGVE 116

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVI 189
           + + V I   AV+  GV++     +GPG  IG  V +G N  + A  ++Y  ++ G   +
Sbjct: 117 LGENVSIGAHAVIESGVKLADNVQIGPGCFIGKDVSVGTNTKLWANVTLYHRVVLGQDCL 176

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           + S   IG DGFGYA       KI  +G VI+ D+VE+GA+S IDRG +DDTIIG+   I
Sbjct: 177 IQSATVIGADGFGYANDKGRWVKIPQLGTVILGDRVEVGASSTIDRGALDDTIIGDGVII 236

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DNQ Q+ HNV IG    I     +AGS  IG N  IGG   I G+++I DNV I   S V
Sbjct: 237 DNQCQVAHNVIIGENTAIAGCTVVAGSVTIGRNCTIGGMVAINGHMEICDNVYITGMSMV 296

Query: 310 LKDIPA-GQQYGGMPARPIGEYLRHMVMLSKPS 341
            K I   G    GMPA    E+ ++ V L   S
Sbjct: 297 TKAIDKPGVYSSGMPAIENREWRKNAVALRNLS 329


>gi|34581032|ref|ZP_00142512.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Rickettsia sibirica 246]
 gi|28262417|gb|EAA25921.1| UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase
           [Rickettsia sibirica 246]
          Length = 339

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/304 (38%), Positives = 169/304 (55%), Gaps = 5/304 (1%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++       N   L +  P  +
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTGEANPNTVLLHAQNPYFA 96

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +       Y     +   S+   I   A + +   I     I    V+     IG  + +
Sbjct: 97  YGKLIDFFY-----VPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDAIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGRGVNIGRNARIEQHVSINYAIIGDDVVILAGAKIGQDGFGFSTEKGVHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIVAQTGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R  +
Sbjct: 272 SSTIGKYCTLGGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAIPIMDWHRQSI 331

Query: 336 MLSK 339
           ++ +
Sbjct: 332 IMKQ 335


>gi|197121553|ref|YP_002133504.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Anaeromyxobacter sp. K]
 gi|226740705|sp|B4UGV0|LPXD_ANASK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|196171402|gb|ACG72375.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Anaeromyxobacter sp. K]
          Length = 354

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 179/331 (54%), Gaps = 17/331 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G ++  E  G   +  ++P+  AS  +IS+  +RK+    E  +A A++   
Sbjct: 6   LAELAARVGGAV--EGDGSLRLDGIAPLEEASASEISFFSNRKYRKAFEASRAGAVVVEP 63

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                +P     L      ++FA   ++ +P    +        ++P A +    ++   
Sbjct: 64  R--EQVPAGRTVLRVANAYLAFAKISTLFHPPREAVPE------VAPTAVIHPTARVHPS 115

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
             + P+A V P  ++G ++ + PG  +  G R+G +C +     +     +GN VIL  G
Sbjct: 116 AQVMPLACVGPDAQVGARSILFPGVHVADGARVGEDCVLYHNVVVRERCAVGNRVILQPG 175

Query: 194 VRIGNDGFGYA-----RGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
             IG+DGFG+A      G    H K+  +G V+++D VE+GAN+ +DR T+  T IG   
Sbjct: 176 CVIGSDGFGFAFDPEGEGKGPRHYKVPQVGNVVVEDDVELGANTCVDRATLGTTRIGRGA 235

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           KIDN VQI HNV +G   ++VSQVG+AGST +G  V+ GGQ GI G+L+IGD V+I ++S
Sbjct: 236 KIDNLVQIAHNVQVGPLSLLVSQVGVAGSTKLGMGVVAGGQAGIVGHLEIGDGVRIGAQS 295

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVMLS 338
           GV+ D+ AG+   G PA P G +L+ M  L 
Sbjct: 296 GVMADVQAGETVSGSPAVPHGGWLKAMASLE 326


>gi|300776442|ref|ZP_07086300.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chryseobacterium gleum ATCC 35910]
 gi|300501952|gb|EFK33092.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chryseobacterium gleum ATCC 35910]
          Length = 346

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/339 (35%), Positives = 180/339 (53%), Gaps = 18/339 (5%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFL 59
           MQ + F  S       ++A  I   ++ DEN    +I  +SPI    +G +S+I   +F 
Sbjct: 1   MQNMEFTAS-------QIASFIDGKIIGDEN---ALITGVSPIENGESGHLSFIAQDRFS 50

Query: 60  NNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGI 119
           + ++  K S II S+ ++     N   ++     +SF I         ++ E    + GI
Sbjct: 51  HFLDSSKCSVIIVSEKLLEKNHYNPTLIVVKDAYLSFQIL------MNLYQEMQGRKEGI 104

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
              + + +   I D   I     V    +IG  + + P   IG GV+IG+NC I +G+ I
Sbjct: 105 ENGSSIHDTAVIGDKAYIGAFTYVSEKAKIGEGSQIYPHVYIGKGVKIGKNCKIDSGARI 164

Query: 180 YS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTI 238
           Y   +IG++ ++HS   IG DGFG+        KI  +G VII+D VEIG+N +IDR TI
Sbjct: 165 YDYCIIGDNCVIHSNTVIGGDGFGFQPTADGFKKIPQLGNVIIEDDVEIGSNCSIDRATI 224

Query: 239 DDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIG 298
             T+IG+ TKIDN +QI HNV IG   +I +Q GIAGST IGD   IGGQ G+ G++KIG
Sbjct: 225 GSTVIGKGTKIDNLIQIAHNVKIGQNNVIAAQAGIAGSTTIGDWNQIGGQVGVVGHIKIG 284

Query: 299 DNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
           + V+I ++SGV   +   +   G PA    +YLR  V  
Sbjct: 285 NQVKIQAQSGVNSSVNDKETLYGSPAISYNDYLRSYVHF 323


>gi|300115377|ref|YP_003761952.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitrosococcus watsonii C-113]
 gi|299541314|gb|ADJ29631.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitrosococcus watsonii C-113]
          Length = 347

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 182/337 (54%), Gaps = 12/337 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L ++AQ +G ++  E   + +I  ++P+ +A   D+S+  +RK+       KA A I 
Sbjct: 3   IRLSEIAQFLGCAI--EGDEDTLIQGIAPLDQAQASDLSFYTNRKYAAQARLSKAGAFIV 60

Query: 73  SQDIVPFIPKNIPCLL-SDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
             D     P    CLL SD P   FA   +  + ++          G+ P A +GE V+I
Sbjct: 61  GADHREQFPDR--CLLISDNPYRDFARVVTRWFNRSYRPAP-----GVHPTAIVGEGVQI 113

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
            +   I    V+  GV I   T + P   +GA   +G +C +    ++   + IG+ VIL
Sbjct: 114 AENCSIGAYCVIEDGVIIKAHTVLFPFCYVGAKTILGEHCLLHPRVTLLERVRIGHRVIL 173

Query: 191 HSGVRIGNDGFGYARGVSD-IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           HSGV IG DGFG+A        K+  +G V I D VE+  N+AIDRG +  T IG  TKI
Sbjct: 174 HSGVIIGGDGFGFAPDPPHGYFKVPQVGWVEIADDVEVQCNTAIDRGALGPTRIGRGTKI 233

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQ+GHNV IG   IIVSQVGI+GS+ IG+ V + GQ G+ G+++IGD   I ++SGV
Sbjct: 234 DNLVQVGHNVEIGEHSIIVSQVGISGSSKIGNWVTLAGQVGLVGHIRIGDGAVITAQSGV 293

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
            KD+P      G P +P+ E  R +  L++ S  + K
Sbjct: 294 AKDVPPKAIMTGSPVQPMMENRRALAELNRLSDLRKK 330


>gi|15603890|ref|NP_220405.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia prowazekii str. Madrid E]
 gi|6225639|sp|Q9ZED3|LPXD_RICPR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|3860581|emb|CAA14482.1| UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-ACYLTRANSFERASE (lpxD)
           [Rickettsia prowazekii]
 gi|292571606|gb|ADE29521.1| UDP-3-O-(3-hydroxymyristoyl)glucosamineN-acyltransferase
           [Rickettsia prowazekii Rp22]
          Length = 346

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 173/315 (54%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           IY +  +  AS  DIS++ + K+   ++  KA+A I  ++    + +N   + ++    +
Sbjct: 37  IYDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKNFTEEVNQNTVLIHAENSYFA 96

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           ++      Y         S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 97  YSKLIDFFYA-----PIKSYSTKIMKSAIIADSATIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             G+ IG GV IG+N  I    SI  ++IG+ V++  G +IG DGFG++      HKI H
Sbjct: 152 DAGTFIGRGVNIGKNARIEQHVSINYAIIGDDVVILVGAKIGQDGFGFSTEKGVHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIG+N+ IDRG + DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGSNTTIDRGALQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I  G+  GG PA PI ++ R   
Sbjct: 272 SSAIGKYCALGGQVGIAGHLNIGDGTQVAAQGGVAQNIEEGKIVGGSPAVPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLVKTSNSKLKK 346


>gi|319901249|ref|YP_004160977.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bacteroides helcogenes P 36-108]
 gi|319416280|gb|ADV43391.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bacteroides helcogenes P 36-108]
          Length = 346

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 168/306 (54%), Gaps = 10/306 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I + +AS ++ ++D +P        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYTSYIYETQASIVLVNKDFMPEQEIKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI P AF+ E  KI   V I+P A +    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRV-----GIDPLAFVSETAKIGKDVYISPFACIGDYA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P + IG+G ++G NC I A  +IY    IGN  ILH+G  IG DGFG+A  
Sbjct: 130 EVGDNTVIHPHATIGSGAKVGSNCIIYANVTIYHDCRIGNHCILHAGSVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG VI++D VEIGAN+ +DR T+  TII    K+DN +Q+ HN  IG   +
Sbjct: 190 PQGYEKIPQIGIVILEDNVEIGANTCVDRATMGATIIHSGVKLDNLIQVAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST IG+  + GGQ GIAG++ IGD V + ++SG+   I  G Q  G P   
Sbjct: 250 MAAQVGIAGSTKIGEWCMFGGQVGIAGHIHIGDKVNLGAQSGIPGSIKEGSQLIGTPPME 309

Query: 327 IGEYLR 332
           + +Y +
Sbjct: 310 LKQYFK 315


>gi|253999110|ref|YP_003051173.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylovorus sp. SIP3-4]
 gi|253985789|gb|ACT50646.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylovorus sp. SIP3-4]
          Length = 351

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 116/321 (36%), Positives = 174/321 (54%), Gaps = 12/321 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L ++   +G  L+ +  G+ +I  ++ +A A  G IS+I   K+   +    ASAII S
Sbjct: 6   SLTEIVSRLGGELVGD--GDIVISRVASLANAQAGHISFITDSKYRTQLADTAASAIIIS 63

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +         +P +++D P   FA    +L P+  ++       GISP A +  D  I  
Sbjct: 64  EQHRAL--TTLPRIVTDNPYAYFARVSDLLNPRVEYVP------GISPNASVAPDAVIPA 115

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
              +   AV+ PGVE+G    +GPG V+G  V IG    + +  +IY+   IG   ++ +
Sbjct: 116 SCTVMDYAVIAPGVELGEGVVIGPGCVVGRNVHIGSQTVLQSHVTIYADCQIGERCVMAA 175

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           GV IG DGFGYA       KI  +GRVII+D VEIG N+++DRG +DDTII +  K+DN 
Sbjct: 176 GVVIGADGFGYANDQGRWVKIPQVGRVIIEDDVEIGVNTSVDRGALDDTIIEQGVKLDNL 235

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           +QIGHN  IG   +I   VGIAGS  +G +  IGG   I G+L+I D V I+  S + + 
Sbjct: 236 IQIGHNCRIGAHTVIAGCVGIAGSAIVGKHCRIGGAAMILGHLEIADGVTISPGSMITRS 295

Query: 313 IPAGQQYGG-MPARPIGEYLR 332
           +     Y   MP +  G++L+
Sbjct: 296 LLKTDTYTALMPFQTHGDWLK 316


>gi|323140918|ref|ZP_08075831.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Phascolarctobacterium sp. YIT 12067]
 gi|322414656|gb|EFY05462.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Phascolarctobacterium sp. YIT 12067]
          Length = 340

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 177/331 (53%), Gaps = 19/331 (5%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASA---- 69
           ++ +LA+ +  ++  +N  E  I  ++ +  A   DIS+ +      ++E C  S     
Sbjct: 4   SVQELAEFLKGTVEHDN-PELRITGVNGLVEAGPKDISFAVPP----HVEHCHLSKAGVM 58

Query: 70  IICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           ++ S+D  P +    P +    P  +FA    +  PQ         E  ISP A++ +  
Sbjct: 59  VLSSED--PELDGR-PVIRVANPRAAFAALLELFRPQ------EEVERVISPYAYVSKKA 109

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSV 188
           KI   V I P AVV    EIG    + P + +G  V++G++C+I   ++I    ++G+ V
Sbjct: 110 KIGSNVAIQPFAVVEDDAEIGDGCVIYPHAYVGKRVKMGKDCTIYPNTTIREDCVLGDRV 169

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           IL SG  IG DGFGY        K++  G V++QD VEIG N+ IDR T+D TI+G+ TK
Sbjct: 170 ILQSGSVIGGDGFGYITQNGKHSKVLQTGNVVLQDDVEIGNNTCIDRATVDSTIVGKGTK 229

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN V +GHN  +G  C++V+ VGI+GS  +G+NV   GQ G  G++ IG N     K+G
Sbjct: 230 IDNLVHLGHNDILGENCLVVAHVGISGSVTVGNNVTFAGQVGTVGHITIGSNCVFGGKTG 289

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +  ++P     GG PA P+ E+LR    L K
Sbjct: 290 ITNNVPDNSVMGGFPAMPMKEWLRQEANLRK 320


>gi|313672267|ref|YP_004050378.1| udp-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939023|gb|ADR18215.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 338

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 184/339 (54%), Gaps = 14/339 (4%)

Query: 10  HKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASA 69
            K + L  LA+ +G +L+ E+     + ++S I       +  + +RK+LN ++  +  A
Sbjct: 4   QKEVTLSYLAEKLGGTLVGEDL---TVKTISSIEEPVDSSVVVLTNRKYLNLLKDERIKA 60

Query: 70  IICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           ++    I   I K  P ++  + ++      +I YP+       S    I+  A +G D 
Sbjct: 61  VVVYDTIKEKIEK--PHIIVKEDKLILVKLLNIFYPEKSFTPYISSNASINVSAKVGVDC 118

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSV 188
            I D V I   +      EIG  +Y+  G  IG  VRIG+N  I     IY  S+IG++V
Sbjct: 119 FIGDFVSIGEHS------EIGDNSYISSGVKIGNYVRIGKNVKIYPNVVIYDGSVIGDNV 172

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           I+H+G  IG DGFGY    +   KI  +G VII+D VEIGAN+ IDR  +  TIIG  TK
Sbjct: 173 IIHAGAIIGADGFGYVNLPNGHVKIRQVGNVIIEDDVEIGANTCIDRAALGSTIIGNGTK 232

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQIGHN  IG  CIIVSQVGIAGS  IGD V++ GQ GIA ++KI D   I +++G
Sbjct: 233 IDNLVQIGHNTKIGKNCIIVSQVGIAGSCKIGDYVILAGQVGIADHVKIADGTIIMAQAG 292

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           V+ DI     Y G P      ++++  +  +   Y++K+
Sbjct: 293 VMSDIEEKGVYLGSPVMDARLFMKNSAVFKEL--YEMKK 329


>gi|67458400|ref|YP_246024.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia felis URRWXCal2]
 gi|75537126|sp|Q4UNJ8|LPXD_RICFE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|67003933|gb|AAY60859.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia felis URRWXCal2]
          Length = 346

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 176/315 (55%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++   F  +  P  +    E S
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKN---FTGEANPNTVLIHAENS 93

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +   G ++     +    S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 94  YFAYGKLI--DFFYTPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGRGVTIGRNARIEQHVSINYTIIGDEVVILAGAKIGQDGFGFSTEKGVHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIG+N  IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGSNITIDRGSLQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R   
Sbjct: 272 SSTIGKYCALGGQVGIAGHLNIGDGTQVAAQGGVAQNIEAGKIVGGSPAVPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLVKTSNSKLKK 346


>gi|294776959|ref|ZP_06742420.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides vulgatus PC510]
 gi|294449207|gb|EFG17746.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides vulgatus PC510]
          Length = 346

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 175/313 (55%), Gaps = 10/313 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I   +++ ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGVPGAISFLSNPKYTHYIYDTQSTIVLVNKDFVPEQEVKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A    +L    ++  +   + GI P A++    K+   V IAP A V  G 
Sbjct: 76  KVDNAYESLA---KLL---TLYEMSKPKKTGIDPLAYVAPTAKLGKDVYIAPFACVGDGA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARG 206
           EIG  T + P + +G+  ++G NC++   ++IY   L+GN   LH+G  IG DGFG+A  
Sbjct: 130 EIGDNTSLHPHATVGSHAKVGNNCTLYPHATIYHDCLVGNHCTLHAGCVIGADGFGFAPS 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  II+D VEIGAN+ +DR T+  TI+ +  K+DN +QI HNV +G   +
Sbjct: 190 PEGYEKIPQIGIAIIEDNVEIGANTCVDRATMGATIVHKGVKLDNLIQIAHNVEVGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQVGIAGST +G+  + GGQ G+AG++KIGD V I +++GV  ++ + +Q  G PA  
Sbjct: 250 MASQVGIAGSTKVGEWCMFGGQVGLAGHIKIGDKVGIGAQAGVPGNVKSNEQILGTPAID 309

Query: 327 IGEYLRHMVMLSK 339
           +  +++   +  K
Sbjct: 310 VKNFMKSSAVYKK 322


>gi|323698044|ref|ZP_08109956.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio sp. ND132]
 gi|323457976|gb|EGB13841.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio desulfuricans ND132]
          Length = 346

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 181/343 (52%), Gaps = 27/343 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LA+ +G   L     +R I  ++ + +A  GD+S++++ K+L+ +E  KA  ++ 
Sbjct: 3   IKLSALAEKLG---LAYTGADREIAGVNTLEKAGPGDLSFLVNPKYLHQLETTKAGCVLT 59

Query: 73  SQDIVPFIPKNIPC-LLSDKPEVSFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
           S          +PC L+S+   +  A +      PQ           G+   AF+  D  
Sbjct: 60  SGHYA----DRVPCALVSENVYMDLARVVNVFARPQGCLT-------GVHTLAFVHPDAD 108

Query: 131 IEDGVVIAPMAVVYPGVEIGRKT------YVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI 184
           + D   + P A V  G  +G  T      YVG GSVIG G  +  NC +  G ++     
Sbjct: 109 VADSATVYPFAFVGAGAVVGPDTVIFAGAYVGEGSVIGEGCILYPNCVVMGGLTL----- 163

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G+ VIL  G  +G DG+GYA+      KI  IG V++++ VEIG+NSAIDR  +D T IG
Sbjct: 164 GDHVILQPGAVLGGDGYGYAQTPFGHMKIPQIGTVVVENDVEIGSNSAIDRAALDTTRIG 223

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
             TKIDN VQIGHNV IG  C+I+ Q GI GS+ IG+ V++ GQ G+   ++IGD   +A
Sbjct: 224 RGTKIDNLVQIGHNVEIGEHCLIIGQTGIGGSSVIGNGVVLAGQTGVPDNVRIGDGAMVA 283

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIKR 347
           ++SG+L D+  G +  G PA P   Y + + + +       KR
Sbjct: 284 AQSGILGDVEPGSRLAGSPAIPAKAYFKAVGVCTPKLPELFKR 326


>gi|237751478|ref|ZP_04581958.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter bilis ATCC 43879]
 gi|229372844|gb|EEO23235.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter bilis ATCC 43879]
          Length = 329

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 184/335 (54%), Gaps = 21/335 (6%)

Query: 16  MKLAQSIG------ASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASA 69
           M L+++I       A L +E   + ++  L+P+  A+   +SYI   +++  ++  KA A
Sbjct: 1   MTLSEAINKAFGSNAVLKNEITNDFILEGLAPLESATKNQVSYIQQDQYIQGLQDSKAGA 60

Query: 70  IICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           ++  + I   +P +I  L+ D P ++FA+  S L+ +   +          P A    D 
Sbjct: 61  VLIRESIKDKVPNHIQPLIVDNPHLAFALL-SQLFAKGDFIA--------RPHA----DS 107

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSV 188
           KI+    IA   V+   V IG  T + PG VI   V IG NC I     IY  S+IG+ V
Sbjct: 108 KIDTSASIAANVVLGKNVTIGANTMIMPGVVIADNVSIGANCKIYPNVVIYRESVIGDRV 167

Query: 189 ILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
           ++H+   IG+DGFGYA+     H KI H GR II+D VEIGAN+ IDR    +T + + +
Sbjct: 168 LIHANSVIGSDGFGYAQNALGEHTKIEHNGRTIIEDDVEIGANNVIDRAVFGETRVKKGS 227

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           K+ +   I HN  +G   ++V+QVG+AGST  G NV++GGQ G  G++ IGD VQ+A + 
Sbjct: 228 KVGHSCVIAHNSIVGEHSLLVAQVGLAGSTTTGRNVVLGGQVGTGGHVHIGDFVQVAGRG 287

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
            V K++P   ++GG P   + E+++  V L +  K
Sbjct: 288 AVSKNLPPKSKWGGHPIMQLDEWMKFYVSLRRMLK 322


>gi|157964080|ref|YP_001498904.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia massiliae MTU5]
 gi|167008890|sp|A8F0C5|LPXD_RICM5 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|157843856|gb|ABV84357.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia massiliae MTU5]
          Length = 345

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 178/314 (56%), Gaps = 7/314 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  ++   F  +  P  +    + S
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKN---FTGEANPNTVLLHTQNS 93

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +   G ++     +    S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 94  YFAYGKLI--DFFYAPIKSYPAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             GS IG GV IGRN  I    SI  ++IG+ V++ +G +IG DGFG++      HKI H
Sbjct: 152 EAGSFIGRGVNIGRNARIEQHVSINYTIIGDDVVILAGAKIGQDGFGFSTEKGIHHKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIGAN+ IDRG++ DTII +  +IDN VQIGH V IG G II++Q GIAG
Sbjct: 212 IGIVKIGNNVEIGANTTIDRGSLQDTIIKDLCRIDNLVQIGHGVKIGKGSIIIAQTGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I AG+  GG PA PI ++ R  +
Sbjct: 272 SSTIGKYCTLGGQVGIAGHLNIGDGAQVAAQGGVAQNIEAGKIVGGSPAVPIMDWHRQSI 331

Query: 336 MLSK--PSKYKIKR 347
           ++ +   S  K+K+
Sbjct: 332 IMKQLLTSNSKLKK 345


>gi|242310040|ref|ZP_04809195.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pullorum MIT 98-5489]
 gi|239523337|gb|EEQ63203.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter pullorum MIT 98-5489]
          Length = 333

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 171/316 (54%), Gaps = 17/316 (5%)

Query: 31  FGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSD 90
           F  + I  + P   A    I+++   K+L+ I + KA  I+     +  IPK     + +
Sbjct: 33  FDTQEILHIKPPLEADDSCITFLEKDKYLSEITQSKAKIILTRSVYLQHIPKTALAFICE 92

Query: 91  KPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            P ++ A   +  + + +      F     P        KI     IA  A +  G EIG
Sbjct: 93  NPYLAMAYL-TKFFAKPL------FSSKTPP--------KIATNATIATNATIGNGSEIG 137

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSD 209
               +  G VIG  V+IG+NC +     IY+   IG +VI+H+   IG+DGFGYA   + 
Sbjct: 138 ENAIIMAGVVIGENVKIGKNCILYPNVCIYNDCEIGENVIIHANSVIGSDGFGYAHTKNG 197

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            H KI H G+V+++D+VEIG+N++IDR    +T I + TKIDN VQIGHN +IG   IIV
Sbjct: 198 EHIKIHHNGKVVLEDEVEIGSNTSIDRAVFGETRIKKGTKIDNLVQIGHNCNIGEYSIIV 257

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQ GI+GST  G NV++GGQ G AG+L IG+  QI ++  + K +PA  ++ G P  PI 
Sbjct: 258 SQAGISGSTTTGRNVVLGGQSGSAGHLHIGEFTQIGARGAIAKSVPAYGKFSGHPLLPIQ 317

Query: 329 EYLRHMVMLSKPSKYK 344
           ++LR   +  K  K K
Sbjct: 318 DWLRLQAIFKKMLKNK 333


>gi|114321868|ref|YP_743551.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|119371914|sp|Q0A526|LPXD_ALHEH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|114228262|gb|ABI58061.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 352

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 114/331 (34%), Positives = 179/331 (54%), Gaps = 14/331 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + + +LA+ +GA L+ +    R+I  ++ +  A    I +  +  +L ++    A A+I 
Sbjct: 5   VTVSELAEGLGAELVGKP--TRVIRRVATLCDAGPDAIGFCSNANYLEDLRATGAGAVIV 62

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             + V   P     L+ D P  ++A   + L+P      A     G+ P A + E V + 
Sbjct: 63  RAEHVAECPTT--ALVVDDPYYAYAAVATRLHP------AERPPAGVHPTAVVAEGVTLG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSI-GAGSSIYSSLIGNSVILH 191
           + V + P AVV  G  +G +T VGPG  +G GV IG +  + G  +     ++G  VILH
Sbjct: 115 EAVSVGPHAVVEAGARLGARTIVGPGCHVGTGVEIGEDSHLMGRVTVADRCVVGCRVILH 174

Query: 192 SGVRIGNDGFGYARGV--SDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
            GV +G DGFG+A+G   +   K+  +GRVI+ D V++GAN+ +DRG IDDT++ E  K+
Sbjct: 175 PGVVVGADGFGFAKGPGKAGWRKVPQLGRVILGDDVDLGANTTVDRGAIDDTVLEEGVKL 234

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DNQV IGHNV +G   II     +AGST IG + +IGG   I G++ I D V +   +GV
Sbjct: 235 DNQVHIGHNVRVGARTIIAGNTVVAGSTTIGCDCMIGGSSAITGHISIADGVILMGMTGV 294

Query: 310 LKDIPAGQQYGG-MPARPIGEYLRHMVMLSK 339
              I     Y   +PA+P+ E+ R+ V  ++
Sbjct: 295 TGSIKQPGAYASPLPAKPVREWRRNSVRFTQ 325


>gi|212690978|ref|ZP_03299106.1| hypothetical protein BACDOR_00468 [Bacteroides dorei DSM 17855]
 gi|212666210|gb|EEB26782.1| hypothetical protein BACDOR_00468 [Bacteroides dorei DSM 17855]
          Length = 386

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 177/318 (55%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I   +++ ++ ++D VP        +
Sbjct: 59  DEN---ATVHTFAKIEEGVPGAISFLSNPKYTHYIYDTQSTIVLVNKDFVPEQEVKATLI 115

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A    +L    ++  +   + GI P A++    K+   V IAP A V  G 
Sbjct: 116 KVDNAYESLA---KLL---TLYEMSKPKKTGIDPLAYVAPTAKLGKDVYIAPFACVGDGA 169

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARG 206
           EIG  T + P + +G+  ++G NC++   ++IY   L+GN+  LH+G  IG DGFG+A  
Sbjct: 170 EIGDNTSLHPHATVGSHAKVGNNCTLYPHATIYHDCLVGNNCTLHAGCVIGADGFGFAPS 229

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  II+D VEIGAN+ +DR T+  TI+ +  K+DN +QI HNV +G   +
Sbjct: 230 PEGYEKIPQIGIAIIEDNVEIGANTCVDRATMGATIVHKGVKLDNLIQIAHNVEVGSHTV 289

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQVGIAGST +G+  + GGQ G+AG++KIGD V I +++GV  ++ + +Q  G PA  
Sbjct: 290 MASQVGIAGSTKVGEWCMFGGQVGLAGHIKIGDKVGIGAQAGVPGNVKSNEQILGTPAID 349

Query: 327 IGEYLRHMVMLSK-PSKY 343
              +++   +  K P  Y
Sbjct: 350 AKNFMKSSAVYKKLPEMY 367


>gi|237712534|ref|ZP_04543015.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 9_1_42FAA]
 gi|237726708|ref|ZP_04557189.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D4]
 gi|265752227|ref|ZP_06088020.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_33FAA]
 gi|229435234|gb|EEO45311.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides dorei 5_1_36/D4]
 gi|229453855|gb|EEO59576.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 9_1_42FAA]
 gi|263237019|gb|EEZ22489.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_33FAA]
          Length = 346

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 177/318 (55%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I   +++ ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGVPGAISFLSNPKYTHYIYDTQSTIVLVNKDFVPEQEVKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A    +L    ++  +   + GI P A++    K+   V IAP A V  G 
Sbjct: 76  KVDNAYESLA---KLL---TLYEMSKPKKTGIDPLAYVAPTAKLGKDVYIAPFACVGDGA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARG 206
           EIG  T + P + +G+  ++G NC++   ++IY   L+GN+  LH+G  IG DGFG+A  
Sbjct: 130 EIGDNTSLHPHATVGSHAKVGNNCTLYPHATIYHDCLVGNNCTLHAGCVIGADGFGFAPS 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  II+D VEIGAN+ +DR T+  TI+ +  K+DN +QI HNV +G   +
Sbjct: 190 PEGYEKIPQIGIAIIEDNVEIGANTCVDRATMGATIVHKGVKLDNLIQIAHNVEVGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQVGIAGST +G+  + GGQ G+AG++KIGD V I +++GV  ++ + +Q  G PA  
Sbjct: 250 MASQVGIAGSTKVGEWCMFGGQVGLAGHIKIGDKVGIGAQAGVPGNVKSNEQILGTPAID 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
              +++   +  K P  Y
Sbjct: 310 AKNFMKSSAVYKKLPEMY 327


>gi|281358691|ref|ZP_06245168.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Victivallis vadensis ATCC BAA-548]
 gi|281314817|gb|EFA98853.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Victivallis vadensis ATCC BAA-548]
          Length = 350

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 115/340 (33%), Positives = 178/340 (52%), Gaps = 8/340 (2%)

Query: 8   VSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKA 67
           + H  +   ++A+ +  +L  +   +R+I S+S I  A    +S++ ++K+ + +E  +A
Sbjct: 1   MKHLSLTAGQIAEMVKGTL--KGAADRVITSVSGIKDAKADQLSFVGNKKYQHQLESTEA 58

Query: 68  SAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGE 127
             ++   D+     +N   ++ +  + +FA    +        E  ++E G+ P A +  
Sbjct: 59  GVVLVCADLAGESTENRSLIVCENVDHAFATVVGMFAE-----EPPAWEAGVHPSAVVAA 113

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGN 186
           DVK  +GV +   AV+  G EIG    +G G  IG  V+IG    +    ++ Y   IG 
Sbjct: 114 DVKFGEGVSVGANAVIEAGAEIGNGVRIGAGCYIGHQVKIGDGTMLYPNVTVMYRCTIGR 173

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
             ILH GV IG DGFG+  G   + K+   G V I D VEIGAN+ +DR     T I  N
Sbjct: 174 KCILHPGVVIGGDGFGFIPGKQGLVKVPQTGIVQIDDDVEIGANTTVDRARFGKTWIKSN 233

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
            KIDNQV I HNV IG   I+V+Q GIAGS  IG  V++  + G+ G++ +GD VQ+A  
Sbjct: 234 VKIDNQVMIAHNVVIGESSILVAQCGIAGSAEIGRGVVLAAKAGVNGHITLGDGVQVAGT 293

Query: 307 SGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           SGV+K +PAG    G PA    E++    + S+  K   K
Sbjct: 294 SGVVKSLPAGAIALGTPAESQREFMARFTLPSRFEKLNTK 333


>gi|29653951|ref|NP_819643.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii RSA 493]
 gi|153209990|ref|ZP_01947552.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii 'MSU Goat Q177']
 gi|154706389|ref|YP_001424032.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii Dugway 5J108-111]
 gi|161830128|ref|YP_001596538.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii RSA 331]
 gi|165924225|ref|ZP_02220057.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii RSA 334]
 gi|212212905|ref|YP_002303841.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii CbuG_Q212]
 gi|212218966|ref|YP_002305753.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii CbuK_Q154]
 gi|60390088|sp|Q83DT0|LPXD_COXBU RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|189028515|sp|A9KC34|LPXD_COXBN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|189028516|sp|A9NC98|LPXD_COXBR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|226740716|sp|B6J8K9|LPXD_COXB1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|226740717|sp|B6J168|LPXD_COXB2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|29541214|gb|AAO90157.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii RSA 493]
 gi|120575197|gb|EAX31821.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii 'MSU Goat Q177']
 gi|154355675|gb|ABS77137.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii Dugway 5J108-111]
 gi|161761995|gb|ABX77637.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii RSA 331]
 gi|165916329|gb|EDR34933.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii RSA 334]
 gi|212011315|gb|ACJ18696.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii CbuG_Q212]
 gi|212013228|gb|ACJ20608.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Coxiella burnetii CbuK_Q154]
          Length = 342

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 178/302 (58%), Gaps = 12/302 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L +LA +IGA++  +  G+  I++++ IA+A  G+IS++  RK+   + + KASAI+  
Sbjct: 8   SLTELATAIGATV--QGDGDCKIHNVAAIAQAQPGEISFVTDRKYRKYLTQTKASAILLD 65

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           + +    P N   L+   P++ FA   ++L PQ++        GGI P A +G + +I+ 
Sbjct: 66  EKLASRCPIN--ALVMSNPKLGFAKLLTLLRPQSLPT------GGIHPTAVVGANCQIDP 117

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHS 192
              I    V+   V IG +T +G G+ IG G +IG +C + +  ++YS + IG+  I+HS
Sbjct: 118 SAHIGAHVVIEEDVVIGPRTLIGAGASIGRGSQIGSDCCLHSRVTLYSQTRIGDRSIIHS 177

Query: 193 GVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           G  IG DGFG  +    +  KI  +GRVII D VEIGAN+ IDRG +DDT+IG   KID+
Sbjct: 178 GAVIGADGFGLIQDEKGEWVKIPQVGRVIIGDDVEIGANATIDRGALDDTVIGNGVKIDD 237

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            V I HNV IG   +I    G+AGST +G + +IG   G+ G+++I DNV I     + K
Sbjct: 238 LVMIAHNVRIGDHTVIAGCAGVAGSTTVGRHCMIGASAGLNGHIEICDNVIITGMGMIQK 297

Query: 312 DI 313
            I
Sbjct: 298 SI 299


>gi|223041308|ref|ZP_03611546.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter rectus RM3267]
 gi|222877421|gb|EEF12564.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter rectus RM3267]
          Length = 318

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 118/313 (37%), Positives = 173/313 (55%), Gaps = 18/313 (5%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  I +L+ ++ A   ++ Y  S K    IE  KA AI+ + ++   +      ++ + P
Sbjct: 18  ELEITALNSLSNAGASELGYCDSEKNAKFIENSKAGAILVASNLKELVGAQSRAVVVENP 77

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            ++FAI       + +  E         PQ      V+I     I P   V  G  IG  
Sbjct: 78  HLAFAILSEYFARELLASE---------PQP-----VQISPSAKIMPNVYVGSGAVIGDN 123

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           T V  G+ +G  V+IG +C I     IY+ ++IGN   +++   IG+DGFGYA   +  H
Sbjct: 124 TLVMAGAYVGDNVKIGADCVIHPNVVIYNDTVIGNGCRINANAVIGSDGFGYAHTKTGEH 183

Query: 212 -KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI H G V+++D VEIGA + +DRG  + T++    KIDN VQIGHN  IG G I+VSQ
Sbjct: 184 VKIYHNGNVVLEDFVEIGACTTVDRGVFESTVVKAYAKIDNLVQIGHNCEIGYGSILVSQ 243

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
           VG+AGST +G NV++GGQ G AG+LK+GD  QIA++ GV KDI  G++Y G  A PI E 
Sbjct: 244 VGLAGSTKLGRNVVMGGQSGSAGHLKVGDFAQIAARGGVSKDIAGGKKYAG--AYPIMEL 301

Query: 331 LRHMVMLSKPSKY 343
                + +K +++
Sbjct: 302 ADFFKLQAKIARF 314


>gi|150002705|ref|YP_001297449.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides vulgatus ATCC 8482]
 gi|254882207|ref|ZP_05254917.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 4_3_47FAA]
 gi|319643233|ref|ZP_07997861.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_40A]
 gi|166199072|sp|A6KWL3|LPXD_BACV8 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|149931129|gb|ABR37827.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides vulgatus ATCC 8482]
 gi|254835000|gb|EET15309.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 4_3_47FAA]
 gi|317385137|gb|EFV66088.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_40A]
          Length = 346

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 174/313 (55%), Gaps = 10/313 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+ + I   +++ ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGVPGAISFLSNPKYTHYIYDTQSTIVLVNKDFVPEQEVKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A    +L    ++  +   + GI P A++    K+   V IAP A V  G 
Sbjct: 76  KVDNAYESLA---KLL---TLYEMSKPKKTGIDPLAYVAPTAKLGKDVYIAPFACVGDGA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARG 206
           EIG  T + P + +G+  ++G NC++   ++IY   L+GN   LH+G  IG DGFG+A  
Sbjct: 130 EIGDNTSLHPHATVGSHAKVGNNCTLYPHATIYHDCLVGNHCTLHAGCVIGADGFGFAPS 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  II+D VEIGAN+ +DR T+  TI+ +  K+DN +QI HNV +G   +
Sbjct: 190 PEGYEKIPQIGIAIIEDNVEIGANTCVDRATMGATIVHKGVKLDNLIQIAHNVEVGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQVGIAGST +G+  + GGQ G+AG++KIGD V I +++GV  ++ + +Q  G PA  
Sbjct: 250 MASQVGIAGSTKVGEWCMFGGQVGLAGHIKIGDKVGIGAQAGVPGNVKSNEQILGTPAID 309

Query: 327 IGEYLRHMVMLSK 339
              +++   +  K
Sbjct: 310 AKNFMKSSAVYKK 322


>gi|157825135|ref|YP_001492855.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia akari str. Hartford]
 gi|166199100|sp|A8GLS2|LPXD_RICAH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|157799093|gb|ABV74347.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia akari str. Hartford]
          Length = 346

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 179/316 (56%), Gaps = 8/316 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           +I+ +  +  AS+ DIS++ + K+   ++  KA+A I  ++   F  +  P  +  + E 
Sbjct: 36  VIHDIKILQEASSNDISFLSNHKYSEFLKTTKAAACIVPKN---FTGEANPNTVLIRAEN 92

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           S+   G ++     +    S+   I   A + +   I     I    V+   V IG  + 
Sbjct: 93  SYFAYGKLI--DFFYAPIKSYHAKIMKSAIVADSATIGKNCYIGHNVVIEDDVIIGDDSI 150

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
           +  GS IG GV IG+N  I    SI  ++IG+  ++ +G +IG +GFG++      HKI 
Sbjct: 151 IESGSFIGRGVNIGKNARIEQHVSINYAIIGDDALILAGAKIGQEGFGFSTEKGVHHKIF 210

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
           HIG V I + VEIG+N+ IDRG++ DTII +  +IDN VQIGH V IG G IIV+Q GIA
Sbjct: 211 HIGVVKIGNNVEIGSNTTIDRGSLQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIA 270

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH- 333
           GS+ IG    +GGQ GIAG+L I D VQ+A++ GVL++I A +  GG PA PI ++ R  
Sbjct: 271 GSSTIGKYCALGGQVGIAGHLNICDGVQVAAQGGVLQNIEACKIVGGSPAVPIMDWHRQS 330

Query: 334 --MVMLSKPSKYKIKR 347
             M  L K S  K+K+
Sbjct: 331 VIMKQLVKTSNSKLKK 346


>gi|77163764|ref|YP_342289.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase, LpxD
           [Nitrosococcus oceani ATCC 19707]
 gi|254436155|ref|ZP_05049662.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitrosococcus oceani AFC27]
 gi|119371948|sp|Q3JEI7|LPXD_NITOC RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|76882078|gb|ABA56759.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrosococcus oceani ATCC 19707]
 gi|207089266|gb|EDZ66538.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Nitrosococcus oceani AFC27]
          Length = 347

 Score =  185 bits (470), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 186/337 (55%), Gaps = 12/337 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L ++AQ +G ++  E  GE  I  ++P+ +A   ++S+  +RK+       KA AII 
Sbjct: 3   IRLSEIAQFLGCAI--EGDGEAPIRGIAPLHQAQASELSFYTNRKYAAQARLSKAGAIIV 60

Query: 73  -SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
            ++D   F  + +  L+SD P   FA      + ++          G+ P A +G+DV+I
Sbjct: 61  GAKDREQFAGRRL--LISDNPYRDFARVVDRWFNRSYRPAP-----GVHPTAIVGDDVQI 113

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
            +   I    V+  GV I   T + P   +GA   +G +C +    ++   + IG+ VIL
Sbjct: 114 AENCSIGAYCVIEDGVTIKAHTVLFPFCYVGAKTILGEHCLLYPRVTLLERVRIGHRVIL 173

Query: 191 HSGVRIGNDGFGYARGVSD-IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           H GV IG DGFG+A        K+  +G V I D VE+  N+AIDRG +  T IG+ +KI
Sbjct: 174 HPGVVIGGDGFGFAPDPPQGYFKVPQVGWVEIADDVEVQCNTAIDRGALGPTRIGQGSKI 233

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQ+GHNV IG   IIVSQVGI+GS+ IG+ V + GQ G+ G+++IGD   I ++SGV
Sbjct: 234 DNLVQVGHNVEIGEHSIIVSQVGISGSSKIGNWVTLAGQVGLVGHIRIGDGAVITAQSGV 293

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
            KD+P      G P +P+ E  R +  L++  + + K
Sbjct: 294 AKDVPPKAIMTGSPVQPMMENRRALAELNRLRELRKK 330


>gi|118474099|ref|YP_891993.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter fetus subsp. fetus 82-40]
 gi|118413325|gb|ABK81745.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter fetus subsp. fetus 82-40]
          Length = 315

 Score =  185 bits (469), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 175/318 (55%), Gaps = 29/318 (9%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I +L+ + RA+  ++SY  S K    I++ +A AI+ + ++   +      ++ + P ++
Sbjct: 21  ISALNSLGRANVDELSYCDSEKNSKFIDESRAGAILVTSNLANLVKSR--AVIVENPHLA 78

Query: 96  FAI-----AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
           FAI     +  + YP++  +   S    I P  ++G +VKIE   +I   A +   V IG
Sbjct: 79  FAILSKTFSKPLFYPKSPAVIDESVT--IMPNVYIGNNVKIESRSIIMAGAYIGDNVTIG 136

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDI 210
           +   + P  VI    +IG  C I A          N+VI       G+DGFGYA   +  
Sbjct: 137 QDCIIHPNVVIYNDCKIGNECHINA----------NAVI-------GSDGFGYAHTKTGE 179

Query: 211 H-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVS 269
           H KI H G V ++D VEIGA + IDRG  + TI+ + +KIDN VQIGHN  IG GCIIVS
Sbjct: 180 HIKIYHNGWVELEDNVEIGACTTIDRGVFEPTIVKKYSKIDNLVQIGHNCEIGFGCIIVS 239

Query: 270 QVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGE 329
           Q G+AGST +G NV++GGQ G AG+LKIGD  QIA +  V KD+  G+ Y G P   + E
Sbjct: 240 QTGLAGSTKLGRNVVMGGQSGTAGHLKIGDFAQIAGRGAVSKDLEPGKNYAGYPIMELKE 299

Query: 330 YLRHMVMLSKPSKYKIKR 347
           + +      K  ++ +KR
Sbjct: 300 WFKLQAKFLK--EFGVKR 315


>gi|255322197|ref|ZP_05363343.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter showae RM3277]
 gi|255300570|gb|EET79841.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter showae RM3277]
          Length = 318

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 181/330 (54%), Gaps = 18/330 (5%)

Query: 16  MKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           MKL++      L+ +  E  I +L+ ++ A   ++ Y  S K    IE  KA AI+ + +
Sbjct: 1   MKLSEIYKILGLEFSGEELEITALNSLSNAGASELGYCDSEKNAKFIEGSKAGAILVASN 60

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
           +   +      ++ + P ++FAI       + +  +    +  ISP A            
Sbjct: 61  LKELVGAQSRAVVVENPHLAFAILSEYFAKELLASKPQPAQ--ISPSA------------ 106

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGV 194
            I P   V  G  IG  T V  G+ +G  V+IG NC I     IY+ ++IGN   +++  
Sbjct: 107 KIMPNVYVGSGAVIGDNTLVMAGAYVGDNVKIGANCVIHPNVVIYNDTVIGNGCRINANA 166

Query: 195 RIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            IG+DGFGYA   +  H KI H G V+++D VEIGA + IDRG  + T++    KIDN V
Sbjct: 167 VIGSDGFGYAHTKTGEHVKIYHNGNVVLEDFVEIGACTTIDRGVFESTVVKAYAKIDNLV 226

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QIGHN  IG G I+VSQVG+AGST +G NV++GGQ G AG+LK+GD  QIA++ GV KDI
Sbjct: 227 QIGHNCEIGYGSILVSQVGLAGSTKLGRNVVMGGQSGSAGHLKVGDFAQIAARGGVSKDI 286

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSKPSKY 343
             G++Y G  A PI E      + +K +++
Sbjct: 287 AGGKKYAG--AYPIMELADFFKLQAKIARF 314


>gi|297568840|ref|YP_003690184.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296924755|gb|ADH85565.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 359

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 175/313 (55%), Gaps = 12/313 (3%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP--FIPKNIPCLLS 89
           G+ M+  L+ + RA   +++++   K  + + +C+A A+I S  +     IP  +  +  
Sbjct: 19  GDVMVTGLNDLERAGPQEVTFLADHKLADKLARCRAGALIISPPLAEQCTIPAGMALIKV 78

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFE-GGISPQAFLGEDVKIEDGVVIAPMAVVYPGVE 148
             P ++     + L        A+ F   G+ P A +GED  I + V IA  AV+   V 
Sbjct: 79  SNPYLAATRIQNFLL-------ATPFAPTGVHPGALIGEDCSIPEEVSIAAGAVLGHRVR 131

Query: 149 IGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYARGV 207
           +GR+  +  G V+G    IG +  + A  ++Y  S++GN VI+HSG  +G+DGFGYA   
Sbjct: 132 LGRRVKLEAGVVVGDDSVIGDDVVLHANVTVYPRSVLGNRVIVHSGSVLGSDGFGYATDR 191

Query: 208 S-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
             + HK  H+G V I+D VEIGAN  +DRGT  +T+I    KIDN VQIGHNV +G   +
Sbjct: 192 QGNHHKRAHLGIVRIEDDVEIGANCCVDRGTFGETLIKSGAKIDNLVQIGHNVVVGENTL 251

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           IV+Q GIAGST +   V++GGQ  + G+L+IG  V +A+KSGV  D   G    GMPA  
Sbjct: 252 IVAQAGIAGSTVLDRQVVLGGQVALNGHLRIGAGVMVAAKSGVHNDQEPGAVVSGMPAIE 311

Query: 327 IGEYLRHMVMLSK 339
             ++LR  +   K
Sbjct: 312 HKKWLRASIAFGK 324


>gi|332879974|ref|ZP_08447658.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332681970|gb|EGJ54883.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 339

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 171/306 (55%), Gaps = 8/306 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +Y LS I   + G IS++ + K+ + I    AS +I  +D  P        +  D P  +
Sbjct: 24  VYKLSKIEEGTEGSISFLANPKYKHFIYTTHASVVIVGKDFEPESTLTATLVRVDDPYAA 83

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           F+    +L   A + E    + GI   +F+    K+ + V I   A +   V +G    +
Sbjct: 84  FS---KLL---AFYNEIKLNKTGIEQPSFIATTAKVGENVYIGAFAYIGENVVLGNNVKI 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH-KI 213
            P + IG    IG N +I +G  IYS ++IG +  LHSGV +G DGFG+A     ++ K+
Sbjct: 138 YPNTYIGDNSVIGDNTTIFSGCKIYSETVIGKNCTLHSGVVLGADGFGFAPNEIGVYSKV 197

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             IG V+++D V+IGANS +DR T+  TII +  K+DNQ+QI HNV IG   +I +Q G+
Sbjct: 198 PQIGNVVLEDNVDIGANSTVDRATLGSTIIRQGVKLDNQIQIAHNVEIGKNTVIAAQTGV 257

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           AGST IG+N +IGGQ GI G+L IG+ V+I +++GV +++   +   G PA    EY + 
Sbjct: 258 AGSTKIGENGMIGGQVGIVGHLTIGNRVRIQAQTGVGRNLKDDEVIQGSPALGYAEYNKA 317

Query: 334 MVMLSK 339
            V+  K
Sbjct: 318 YVVFRK 323


>gi|57241912|ref|ZP_00369852.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter upsaliensis RM3195]
 gi|57017104|gb|EAL53885.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter upsaliensis RM3195]
          Length = 317

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 122/334 (36%), Positives = 178/334 (53%), Gaps = 23/334 (6%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           M+L + I   L  E  GE + I +L+ + RAS  +++Y    K   +I    A+AII ++
Sbjct: 1   MRL-REIAEFLSLEYEGEDLEISALNSLLRASFTELTYCDGEKNAKDIPNTGAAAIIVAK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYP---QAMHMEASSFEGGISPQAFLGEDVKI 131
           +    +PK+   L+S  P +SFA    I        +  +  +    I P  +LG ++ I
Sbjct: 60  EYENLVPKDTKALISSNPHLSFAFLSKIFAKPIFSEVKTQNIAKSAKIMPNVYLGNNINI 119

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILH 191
            + VVI   A V   V IG ++ + P  VI    +IG+ C           L+ N VI  
Sbjct: 120 GENVVIMAGAFVGDNVSIGDESVIHPNVVIYNDTKIGKKCH----------LLANCVI-- 167

Query: 192 SGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
                G+DGFGYA   + + HKI H G VI++D VEIGA + IDR     TII   TK+D
Sbjct: 168 -----GSDGFGYAHNKNGEHHKIYHNGNVILEDFVEIGACTTIDRAVFGSTIIKTGTKVD 222

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQ+GHN  IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ GV 
Sbjct: 223 NLVQVGHNCQIGQNCIIVAQTGISGSSELGRNVVMGGQSATSGHLKIGDFSTIAARGGVS 282

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           K +  G+ YGG P     ++L+    ++   K K
Sbjct: 283 KSLEGGRVYGGFPIMLQKDWLKMQAKIALSFKDK 316


>gi|260424702|ref|ZP_05733006.2| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dialister invisus DSM 15470]
 gi|260402894|gb|EEW96441.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dialister invisus DSM 15470]
          Length = 345

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 189/336 (56%), Gaps = 19/336 (5%)

Query: 17  KLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRK-FLNNIEKCKASAIICSQD 75
           +LA+ +G +L    +G+  +      +  S G      +R  +  +IE+ +A  I+   D
Sbjct: 11  ELAKIVGGTL----YGDPAVVIDDVRSAESAGSSHVTFARGLYAEHIEEMQAGVILV--D 64

Query: 76  IVPF-IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
            +P    KN+  ++++    SF     + +P+  H      +G I P A + +   I + 
Sbjct: 65  ALPAKYTKNL--IVTEDCRRSFGKLIELYHPEEQH------DGKIHPTAVVSKTAVIGEH 116

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
           V I P  VV  G EIG  T V P   IG   +IG+NC +  G+ I+ +S++G+ V+L + 
Sbjct: 117 VTIMPYVVVDDGAEIGSGTVVYPYVYIGKNSKIGKNCELNPGAVIHENSILGDRVVLRAH 176

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG  GFG++   +  H  I  +G+ ++QD VE+G+ SA+D G ++DT+IG  TK+DN 
Sbjct: 177 AVIGGQGFGFSTDAAGHHTHIRQLGKAVLQDDVEVGSGSAVDNGAMNDTVIGRGTKVDNL 236

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           V +GHNV IG  C I++QVGIAGST IGD+ ++ GQ GI G++ I D+V +  K+GV+ +
Sbjct: 237 VHLGHNVEIGEDCFIIAQVGIAGSTKIGDSCVLAGQTGITGHVNITDHVVLGGKTGVVGN 296

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYKIKR 347
           I     Y G PARP GE+ R  +M+++ P   K  R
Sbjct: 297 IETPGTYVGYPARPHGEWGREQIMVTRLPELMKKMR 332


>gi|187250497|ref|YP_001874979.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Elusimicrobium minutum Pei191]
 gi|226740724|sp|B2KAU6|LPXD_ELUMP RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|186970657|gb|ACC97642.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Elusimicrobium minutum Pei191]
          Length = 341

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 155/289 (53%), Gaps = 28/289 (9%)

Query: 61  NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGIS 120
           +I   KA   I    I      +   + +D PE +F      L+ +        F+ G+ 
Sbjct: 49  SISSIKAGCFILPSKIKETFKTDKNVIFADNPEWAFT-----LFLRHYDSSKPKFDRGVH 103

Query: 121 PQAFLGEDVK------------IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIG 168
           P A +G++V             IED V +    V+YP V IGR+T+VG   ++   V + 
Sbjct: 104 PTAVIGKNVVLGNNITVGAYSVIEDDVTLGDNTVIYPHVYIGRRTFVGKDCILYPNVVVR 163

Query: 169 RNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIG 228
             C           +I + VI+ +G  IG DGFG+        KI  +G VII+   EIG
Sbjct: 164 EEC-----------IIKDRVIIEAGATIGTDGFGFVLVNYKHEKIPQVGNVIIESDSEIG 212

Query: 229 ANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQ 288
           AN+ IDR  ID T+IG N K+DN  Q+ HNV +G G II+SQVG+AGST IG  V++ GQ
Sbjct: 213 ANTTIDRAKIDSTVIGVNVKVDNLTQLAHNVKVGQGSIIISQVGVAGSTEIGRGVVLAGQ 272

Query: 289 CGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVML 337
            G+AG++KIGD VQ+ ++SG+++DIPAG++  G P R   E L+    L
Sbjct: 273 VGVAGHIKIGDGVQVGAQSGIMQDIPAGKKMFGTPVRDYMETLKLYAAL 321


>gi|315638779|ref|ZP_07893952.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter upsaliensis JV21]
 gi|315481188|gb|EFU71819.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter upsaliensis JV21]
          Length = 317

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 179/335 (53%), Gaps = 25/335 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL + I   L  E  GE + I +L+ + RAS  +++Y    K   +I    A+AII ++
Sbjct: 1   MKL-REIAEFLSLEYEGEDLEISALNSLLRASFTELTYCDGEKNAKDIPNTGAAAIIVAK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE----GGISPQAFLGEDVK 130
           +    +PK+   L+S  P +SFA    I + + +  E  +        I P  +LG ++ 
Sbjct: 60  EYENLVPKDTKVLISPNPHLSFAFLSKI-FAKPLFSEVKTQNIAKSAKIMPNVYLGNNIN 118

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVIL 190
           I + VVI   A V   V IG ++ + P  VI    +IG+ C           L+ N VI 
Sbjct: 119 IGENVVIMAGAFVGDNVSIGDESVIHPNVVIYNDTKIGKKCH----------LLANCVI- 167

Query: 191 HSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
                 G+DGFGYA   +  H KI H G VI++D VEIGA + IDR     TII   TK+
Sbjct: 168 ------GSDGFGYAHNKNGEHYKIYHNGNVILEDFVEIGACTTIDRAVFGSTIIKTGTKV 221

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQ+GHN  IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ GV
Sbjct: 222 DNLVQVGHNCQIGQNCIIVAQTGISGSSELGRNVVMGGQSATSGHLKIGDFSTIAARGGV 281

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            K +  G+ YGG P     ++L+    ++   K K
Sbjct: 282 SKSLEGGRVYGGFPIMLQKDWLKMQAKIALKFKEK 316


>gi|94265742|ref|ZP_01289478.1| transferase hexapeptide repeat:UDP-3-O-(3-hydroxymyristoyl)
           glucosamine N-acyltransferase, LpxD [delta
           proteobacterium MLMS-1]
 gi|93453717|gb|EAT04095.1| transferase hexapeptide repeat:UDP-3-O-(3-hydroxymyristoyl)
           glucosamine N-acyltransferase, LpxD [delta
           proteobacterium MLMS-1]
          Length = 361

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 174/308 (56%), Gaps = 7/308 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNI-PCLLSDKPE 93
           MI  ++ +  A   ++S++ S   L+ +  C+A+A++  Q + P     + P  L    +
Sbjct: 23  MIGGVNDLTLAGPTELSFLTSAAHLDKLTDCRAAALVVPQKLAPAELAGVWPAPLIRVAD 82

Query: 94  VSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKT 153
            + A A      Q   + A     G+ P A LG D  I + V I P AV+   V +G++ 
Sbjct: 83  ANLATA----LIQQFLLSAPFDARGVHPTAVLGSDCLIPEQVSIGPGAVLGERVRLGQRV 138

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH- 211
            +  G VIG  V IG +  +    ++Y  S+IG+ VI+H+G  IG+DGFGYA      H 
Sbjct: 139 QIAAGVVIGDDVTIGDDSRLYPQVTVYDHSIIGSRVIIHAGCVIGSDGFGYATDKQGNHI 198

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           K  H G V I D VEIGAN  IDRGT  +T+IG  +KIDN VQ+ HNV +G  C++V+QV
Sbjct: 199 KRPHQGMVRIGDGVEIGANVCIDRGTFGETVIGSGSKIDNLVQVAHNVEVGENCLLVAQV 258

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GI+GS  +G  V++GGQ  +AG++++GD V IA++SGV  + P G    G PA    ++L
Sbjct: 259 GISGSCKLGRQVVMGGQSALAGHIEMGDGVMIAAQSGVHNNQPPGAVVAGSPAIAHRKWL 318

Query: 332 RHMVMLSK 339
           R    +S+
Sbjct: 319 RASTAVSR 326


>gi|83647906|ref|YP_436341.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Hahella
           chejuensis KCTC 2396]
 gi|119371938|sp|Q2SBQ8|LPXD_HAHCH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|83635949|gb|ABC31916.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Hahella
           chejuensis KCTC 2396]
          Length = 348

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 172/327 (52%), Gaps = 12/327 (3%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L  +A  IGA L  +  G   +  L+ + +A  G IS++ ++ +L +++   ASA+I   
Sbjct: 10  LADIAFRIGAELRGD--GSVEVKGLATLQKAQAGQISFLANKNYLKHLKDTCASAVIIPS 67

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                   N+  L+ +     +A+   +  PQ   M       GISP A + E  K+  G
Sbjct: 68  SFADQCSTNV--LVMENSYFGYALCSQLFSPQWWSMS------GISPSAAISESAKLGAG 119

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I    V+    EIG    +GPG  IGAG  IG    +    ++Y  + IG   ++HSG
Sbjct: 120 VTIGANVVIEEDAEIGEGAVIGPGCYIGAGSIIGAKTQLRPNVTVYHGVNIGARALIHSG 179

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG+DGFG+A    D  KI  +G V+I D VEIGAN+ IDRG +DDT+I    K+DNQ+
Sbjct: 180 AVIGSDGFGFAPNKGDWAKIAQLGGVVIGDDVEIGANTTIDRGALDDTVIETGAKLDNQI 239

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HNV +G   +I + VG++GS+ IG + +IGG  GIAG+L+I D VQI   + V  +I
Sbjct: 240 QIAHNVKVGAYTVIAACVGVSGSSSIGKHCMIGGGVGIAGHLEITDQVQITGMTLVTHNI 299

Query: 314 PA-GQQYGGMPARPIGEYLRHMVMLSK 339
              G    G    P   + +++    +
Sbjct: 300 KEPGVYSSGTAVEPNASWRKNVARFRQ 326


>gi|198276937|ref|ZP_03209468.1| hypothetical protein BACPLE_03142 [Bacteroides plebeius DSM 17135]
 gi|198270462|gb|EDY94732.1| hypothetical protein BACPLE_03142 [Bacteroides plebeius DSM 17135]
          Length = 346

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 172/318 (54%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G +S++ + K+ + I   K+S ++ ++D  P        +
Sbjct: 19  DEN---ATVHTFAKIEEGVPGALSFLSNPKYTHYIYDTKSSIVLVNKDFEPEHELQTTLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A         A++  +   + G+S  AF+ E  KI   V I P A +  G 
Sbjct: 76  KVDNAYESLAKL------MALYEMSIPKKQGVSSLAFIAESAKIGKNVYIGPFACIEEGA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           EIG    + P + IG+ V+IG N  I    +IY    IGN+ ILH+GV IG DGFG+A G
Sbjct: 130 EIGDNVCIHPQATIGSNVKIGMNTIIYPHVTIYQDCRIGNNCILHAGVVIGADGFGFAPG 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG V+++D VEIGAN+ IDR T+  T+I +  K+DN +Q+ HNV IG   +
Sbjct: 190 AEGYEKIPQIGIVVLEDNVEIGANTCIDRATMGHTLIKQGVKLDNLIQVAHNVEIGKHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQVGIAGS  IG+  + GGQ G+AG++K+GD+V + ++SG+  +  +     G PA  
Sbjct: 250 MASQVGIAGSAKIGEWCMFGGQVGVAGHIKVGDHVNVGAQSGIPGNTKSNTTLMGYPAID 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
             ++ R   +  K P  Y
Sbjct: 310 PKQFARSAAIYKKLPDMY 327


>gi|283954144|ref|ZP_06371669.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 414]
 gi|283794423|gb|EFC33167.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 414]
          Length = 321

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 180/336 (53%), Gaps = 25/336 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ I   L  E  GE + I +L+ + +A+  +++Y    K   +I    A+AI+ S+
Sbjct: 1   MKLSE-IAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTKDIPHTGAAAILVSK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE-----GGISPQAFLGEDV 129
           +    +PK+   L++  P + FA    +     M       +       I P  ++GE+V
Sbjct: 60  EYENLVPKDTKVLITQSPHLCFAFLSKLFAKPLMSTAKEKVQNIAKSARIMPNVYIGENV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I + V+I   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G VI++D VE+GA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVILEDFVEVGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN +IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ G
Sbjct: 223 VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVVMGGQSATSGHLKIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           V K++  G+ YGG P     ++L+    ++   K K
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLKLQAKIAMNFKEK 318


>gi|51473223|ref|YP_066980.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia typhi str. Wilmington]
 gi|60389958|sp|Q68XZ4|LPXD_RICTY RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|51459535|gb|AAU03498.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia typhi str. Wilmington]
          Length = 346

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 172/315 (54%), Gaps = 8/315 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+ +  +  AS  DIS++ + K+   ++  KA+A I  +D      +N   + ++    +
Sbjct: 37  IHDIKILQEASPNDISFLSNPKYSEFLKTTKAAACIVPKDFTEESNQNTVLIHAENSYFA 96

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           ++      Y         S+   I   A + +   I     I    V+   V IG  + +
Sbjct: 97  YSKLIDFFYA-----PIKSYSTKIMKSAIIADSAAIGKNCYIGHNVVIEDDVIIGDNSII 151

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
             G+ IG GV IG+N  I    SI  ++IG+ V++  G +IG DGFG+A      +KI H
Sbjct: 152 DAGTFIGRGVNIGKNARIEQHVSINYAIIGDDVVILVGAKIGQDGFGFATEKGVHNKIFH 211

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           IG V I + VEIG+N+ IDRG + DTII +  +IDN VQIGH V IG G IIV+Q GIAG
Sbjct: 212 IGIVKIGNNVEIGSNTTIDRGALQDTIIEDLCRIDNLVQIGHGVKIGKGSIIVAQAGIAG 271

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH-- 333
           S+ IG    +GGQ GIAG+L IGD  Q+A++ GV ++I  G+  GG PA PI ++ R   
Sbjct: 272 SSAIGKYCALGGQVGIAGHLNIGDRTQVAAQGGVAQNIEEGKIVGGSPAVPIMDWHRQSI 331

Query: 334 -MVMLSKPSKYKIKR 347
            M  L K S  K+K+
Sbjct: 332 IMKQLVKTSNNKLKK 346


>gi|313206108|ref|YP_004045285.1| udp-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Riemerella anatipestifer DSM 15868]
 gi|312445424|gb|ADQ81779.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Riemerella anatipestifer DSM 15868]
          Length = 344

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 170/309 (55%), Gaps = 6/309 (1%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           +I  +SPI     G +S++   KF + IE+ K S +I S+ ++         +  +   +
Sbjct: 23  LITGVSPIESGEEGHLSFVAQEKFSHFIEETKCSVLIVSKKLLDKKDYKATIIAVEDAYL 82

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           SF +  + LY + +    S  E G    AF+ +   + + V +     +    ++G  + 
Sbjct: 83  SFQVLMN-LYNEMVQDRKSGVEEG----AFIHQTAVLGENVFVGAFTYISEKTKVGEGSQ 137

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           + P   IG  V+IG+NC I +G+ IY   +IG++ I+HS   IG DGFG+        KI
Sbjct: 138 IAPQVYIGKRVKIGKNCKIDSGARIYDGCVIGDNCIIHSNTVIGGDGFGFQPTAEGFKKI 197

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             +G VII++ VEIG+N +IDR TI  TIIGE TKIDN +QI HNV IG   +I +Q GI
Sbjct: 198 PQLGNVIIENNVEIGSNCSIDRATIGSTIIGEGTKIDNLIQIAHNVKIGKHNVIAAQAGI 257

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           AGST IGD   +GGQ GI G++ IG+ V+I ++SGV   +  G+   G PA    ++ R+
Sbjct: 258 AGSTTIGDWNQVGGQVGIVGHINIGNQVKIQAQSGVNNSVSDGEILYGSPAISASDFRRN 317

Query: 334 MVMLSKPSK 342
            V     +K
Sbjct: 318 YVHFRNFNK 326


>gi|153951223|ref|YP_001398183.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. doylei 269.97]
 gi|166199085|sp|A7H3V3|LPXD_CAMJD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|152938669|gb|ABS43410.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 318

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 178/324 (54%), Gaps = 25/324 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ I   L  E  GE + I +L+ + +A+  +++Y    K   +I    A+AI+ S+
Sbjct: 1   MKLSE-IAEFLSLEYKGEDIEISALNSLLKANFAELTYCDGEKNTKDIPHTGAAAILVSK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE-----GGISPQAFLGEDV 129
           +    +PK+   L++  P +SFA    +     ++      +       I P  ++G++V
Sbjct: 60  EYENLVPKDTKVLITQSPHLSFAFLSKLFAKPLINTAKEKVQNIAKSARIMPNVYIGDNV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I + V+I   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G VI++D VE+GA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVILEDFVEVGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN +IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ G
Sbjct: 223 VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V K++  G+ YGG P     ++L+
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLK 306


>gi|302878994|ref|YP_003847558.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Gallionella capsiferriformans ES-2]
 gi|302581783|gb|ADL55794.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Gallionella capsiferriformans ES-2]
          Length = 349

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 179/336 (53%), Gaps = 18/336 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L ++AQ +G  L  +  GE +I  +S + RA+ G IS++ + K+   +    ASA+I  +
Sbjct: 5   LAQIAQQLGGCLFGD--GEVLIDQISTLERATAGQISFLTNSKYHAQLANTGASAVILGE 62

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                   ++P ++S+ P   FA   ++L P      ++  + G+ P A + E  +I+  
Sbjct: 63  --ADADATDLPRIISENPYAYFARVSALLNP------STEIKPGVHPAAVVSEGAQIDPS 114

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSG 193
             I   AV+  G  IG  T +G G  IG  V IG +  +     IY   +IG+++I HSG
Sbjct: 115 ACICATAVIGAGAVIGAHTLIGEGCSIGENVVIGCHVRLYPRVVIYHDCVIGDNLIAHSG 174

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
           V IG+DGFG A       KI  IGRV+I   VEIGAN+ IDRG +DDT+I +  K+DNQ+
Sbjct: 175 VVIGSDGFGIAMDEGRWLKIPQIGRVVIGRDVEIGANTTIDRGALDDTVIEDGVKLDNQI 234

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HNV IG    I   VGIAGST IG    IGG  GI G+LKI D V I+S + + K I
Sbjct: 235 QIAHNVRIGAHTAIAGCVGIAGSTTIGKYCQIGGSAGILGHLKIADRVVISSFTLIGKSI 294

Query: 314 PAGQQYGGM-------PARPIGEYLRHMVMLSKPSK 342
                Y  +         R    +LRH+  ++K  K
Sbjct: 295 REAGSYAAIYPFAKTDDWRKNAVHLRHLDEMAKRLK 330


>gi|114778071|ref|ZP_01452971.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Mariprofundus ferrooxydans PV-1]
 gi|114551677|gb|EAU54230.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Mariprofundus ferrooxydans PV-1]
          Length = 347

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/263 (40%), Positives = 151/263 (57%), Gaps = 8/263 (3%)

Query: 87  LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG 146
           +L D P ++FA      +P  +          I+P A L  DV +       P AV+   
Sbjct: 88  ILVDDPYLAFARLQRHFHPAPVSAGQRHATAVIAPDARLAADVDV------GPQAVIGAR 141

Query: 147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYAR 205
            +IG  + +GPG VIG  V IG+ C + A + + +  ++G+ VIL  G  IG+DGFGYA 
Sbjct: 142 ADIGSGSIIGPGCVIGEDVVIGQRCILHANAVVMNGCVLGDDVILQPGAVIGSDGFGYAW 201

Query: 206 GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
                 KI   GRVI+++ VEIGAN+ +DRG + DT+I    K+DN VQ+ HNV +G   
Sbjct: 202 TGESYLKIPQAGRVILENDVEIGANACVDRGALGDTVIERGVKLDNLVQVAHNVRVGAFT 261

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR 325
           ++ SQVG++GST IG     GGQ GIAG+LKIGD  ++A ++GV+ D+ AG  Y G PA 
Sbjct: 262 VMASQVGVSGSTQIGRGCQFGGQVGIAGHLKIGDGCRLAGQTGVMSDLEAGGTYAGSPAM 321

Query: 326 PIGEYLR-HMVMLSKPSKYKIKR 347
           P   +LR   +ML  P  +K  R
Sbjct: 322 PHRMWLRVSAIMLKLPDLWKSLR 344


>gi|313201211|ref|YP_004039869.1| UDP-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Methylovorus sp. MP688]
 gi|312440527|gb|ADQ84633.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylovorus sp. MP688]
          Length = 351

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 114/321 (35%), Positives = 173/321 (53%), Gaps = 12/321 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L ++   +G  L+ +  G+ +I  ++ +A A  G IS+I   K+   +    ASAII S
Sbjct: 6   SLTEIISRLGGELVGD--GDIVISRVASLANAQAGHISFITDSKYRTQLADTAASAIIIS 63

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +         +P +++D P   FA    +L P+  ++       GISP A +  D  +  
Sbjct: 64  EQHRAL--TTLPRIVTDNPYAYFARVSDLLNPRVEYVP------GISPNASVAADAVVPA 115

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
              +   AV+ PGV+ G    +GPG V+G  V IG    + +  +IY+   IG   ++ +
Sbjct: 116 SCTVMDYAVIAPGVKFGEGVVIGPGCVVGRNVHIGSQTVLQSHVTIYADCQIGERCVMAA 175

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           GV IG DGFGYA       KI  +GRVII+D VEIG N+++DRG +DDTII +  K+DN 
Sbjct: 176 GVVIGADGFGYANDQGRWVKIPQVGRVIIEDDVEIGVNTSVDRGALDDTIIEQGVKLDNL 235

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           +QIGHN  IG   +I   VGIAGS  +G +  IGG   I G+L+I D V I+  S + + 
Sbjct: 236 IQIGHNCRIGAHTVIAGCVGIAGSAIVGKHCRIGGAAMILGHLEIADGVTISPGSMITRS 295

Query: 313 IPAGQQYGG-MPARPIGEYLR 332
           +     Y   MP +  G++L+
Sbjct: 296 LLKTDTYTALMPFQTHGDWLK 316


>gi|329965237|ref|ZP_08302167.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fluxus YIT 12057]
 gi|328523257|gb|EGF50357.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides fluxus YIT 12057]
          Length = 346

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 116/318 (36%), Positives = 170/318 (53%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+   I + ++S ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYTPYIYETQSSIVLVNKDFVPEQEIKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI P AF+ E  KI   V IAP A V    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRV-----GIDPLAFVAETAKIGKDVYIAPFAYVGEHA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P   IG+G ++G +C I A ++IY    +GN  ILH+G  IG DGFG+A  
Sbjct: 130 EVGDNTVIHPHVTIGSGAKVGSDCIIYANATIYHDCRVGNHCILHAGSVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG VI++D VEIGAN+ +DR T+  TI+    K+DN VQ+ HN  IG   +
Sbjct: 190 PQGYEKIPQIGIVILEDNVEIGANTCVDRATMGATIVHSGVKLDNLVQVAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST +G+  + GGQ GIAG++ IGD V + ++SGV   +  G +  G P   
Sbjct: 250 MAAQVGIAGSTKVGEWCMFGGQVGIAGHIHIGDKVNLGAQSGVPGSLKEGSRLIGTPPME 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
           +  Y +   +  K P  Y
Sbjct: 310 MKPYFKSASVYRKLPDMY 327


>gi|255534161|ref|YP_003094533.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pedobacter heparinus DSM 2366]
 gi|255347145|gb|ACU06471.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pedobacter heparinus DSM 2366]
          Length = 357

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 110/321 (34%), Positives = 177/321 (55%), Gaps = 10/321 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DE  G   +  LS I     G + ++ + K+ N +    AS +I  +D VP    N   +
Sbjct: 19  DERVG---VSELSKIEDGKAGSLCFLSNPKYENYLYSTSASVVIVGKDFVPSQQVNSTLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
               P  +F++   +L      +  +S + GI   +F+    KI   V I   + +   V
Sbjct: 76  RVADPYSAFSV---LLEKYNEVVNQNSAQVGIEQPSFIHPSAKIGKNVFIGAFSYIAENV 132

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARG 206
           EIG    V P   IGA   +GRNC++  G  +Y+ S++GN++I+HS   +G+DGFG+A  
Sbjct: 133 EIGDNCKVSPQVYIGADSALGRNCTLFPGVKLYNRSVLGNNIIIHSNTVVGSDGFGFAPQ 192

Query: 207 VSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
               + KI  IG V+I+D VEIGAN++IDR T+  T I +  K+DN +QI HNV +G   
Sbjct: 193 ADGTYTKIAQIGNVVIEDDVEIGANTSIDRATMGSTFIRKGVKLDNLIQIAHNVDVGEHS 252

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV-LKDIPAGQQYGGMPA 324
           ++ +Q GI+GS+ +G+  +IGGQ GIAG+L +    QI +++G+        +Q+ G PA
Sbjct: 253 VVAAQTGISGSSKLGEKSVIGGQVGIAGHLSLAKGTQIGAQAGINFNTTEENKQWHGSPA 312

Query: 325 RPIGEYLRHMVMLSK-PSKYK 344
           +P+ +++R  V+  + PS  K
Sbjct: 313 QPLRDWMRASVIFKQLPSVEK 333


>gi|168698125|ref|ZP_02730402.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Gemmata obscuriglobus UQM 2246]
          Length = 342

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 115/330 (34%), Positives = 174/330 (52%), Gaps = 15/330 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + + +LA+ +   +L +   E  I +   ++ A  GDI+++ S + L+     +ASA + 
Sbjct: 3   VTVRQLAEWVRGEVLGDP--ELAITNARTLSEAEPGDITFVESERNLHAWHNSRASAAV- 59

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEG--GISPQAFLGEDVK 130
                  +P ++P  ++ +P +  A           H+ A   E    ISP A +    K
Sbjct: 60  -------VPASVP--VNGRPVIRVADPLMAFADIVRHLRARPDETPRDISPGAHVHPTAK 110

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVI 189
           +  GV + P+AV+  G E+G    V  G++IG   +IGR+  I     +Y   ++G+ VI
Sbjct: 111 LAPGVSVGPLAVIGEGTELGENCTVHAGAIIGRFCKIGRDAIIYPHVVLYDDCVLGDRVI 170

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           LH+G  IG DGFGY       HK+  +G V ++D VEIGANS +DRGT   T IG  TKI
Sbjct: 171 LHAGAVIGADGFGYRTANGKHHKVPQLGWVELEDDVEIGANSTVDRGTFAPTRIGAGTKI 230

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V +GHN  IG   +  SQ G+AGS   GD V++ GQ GIA ++ IGD   + +++GV
Sbjct: 231 DNLVMVGHNCQIGKHNLYCSQSGVAGSCVTGDYVVLAGQAGIADHVTIGDRAMVGAQAGV 290

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             D+P    Y G PA P+ E  R    L +
Sbjct: 291 PADLPGDLHYLGTPAMPVKEMARVFASLRR 320


>gi|283955988|ref|ZP_06373477.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792464|gb|EFC31244.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 321

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 177/324 (54%), Gaps = 25/324 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ I   L  E  GE + I +L+ + +A+  +++Y    K   +I    A+AI+ S+
Sbjct: 1   MKLSE-IAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTKDIPHTGAAAILVSK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE-----GGISPQAFLGEDV 129
           +    +PK+   L++  P ++FA    +     +       +       I P  ++G++V
Sbjct: 60  EYENLVPKDTKALITQNPHLNFAFLSKLFAKPLISTAKEKVQNIAKSARIMPNVYIGDNV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I D V+I   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGDNVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G VI++D VE+GA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVILEDFVEVGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN +IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ G
Sbjct: 223 VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V K++  G+ YGG P     ++L+
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLK 306


>gi|148265263|ref|YP_001231969.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter uraniireducens Rf4]
 gi|146398763|gb|ABQ27396.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter uraniireducens Rf4]
          Length = 348

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 189/339 (55%), Gaps = 26/339 (7%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L +LA+ +G  ++ +     ++  L  +  A  G I+++ + K+   +    A+A+I  
Sbjct: 4   SLKELAEYLGGRVIGDE--SALVRGLGTLDDAGDGQITFLANPKYAQKVATTNAAAVILP 61

Query: 74  -------QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLG 126
                  +++V              P ++FA   ++ Y       A +   G+   AF+G
Sbjct: 62  PGADGHGRNVVEVA----------NPYLAFAKLLTLFY------VAPAKAYGVMDGAFVG 105

Query: 127 EDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IG 185
           + V + D V + P A V  GV +G +  + PG V+  GV +G + ++ A  S+     IG
Sbjct: 106 KAVAMGDDVTVYPGAFVADGVRLGNRVTLYPGVVLYPGVILGDDVTLHANVSVRERCRIG 165

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N V +H+G  +G DGFGYA    + +KI  IG V+I+D VEIG+N+ IDR  ++ T+I  
Sbjct: 166 NRVTIHNGTVVGCDGFGYAPDGKEWYKIPQIGIVMIEDDVEIGSNTVIDRAALEVTLIRR 225

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HN  IG   +I SQVGI+GST +G +V +GGQ G+AG+++IGDNV + +
Sbjct: 226 GTKIDNLVQIAHNCVIGENGMICSQVGISGSTKVGSHVTMGGQVGVAGHIQIGDNVMVGA 285

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           KSGV  +IPA Q   G+PA P  E+L+   +  +  +Y+
Sbjct: 286 KSGVPGNIPANQIISGIPAIPHREWLKASGIFPRLPEYR 324


>gi|320101872|ref|YP_004177463.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Isosphaera pallida ATCC 43644]
 gi|319749154|gb|ADV60914.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Isosphaera pallida ATCC 43644]
          Length = 406

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 178/322 (55%), Gaps = 11/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA  +G  L+D       +    PI  A  G+++++   K L   + C+A+A++ 
Sbjct: 31  MTLGELADRLGGRLVDTQTASVPLVGAKPIHEAGPGELTFLDGDKNLPLWKSCRAAAVLV 90

Query: 73  SQDIVPFIP---KNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           +   +P  P   + IP L  D P ++FA A  +L+        +SF+G I PQA + +  
Sbjct: 91  NPRFIP--PEGCRAIPRLEVDDPLMAFAEA-VLLF---RRPPPASFQG-IHPQAIVAQSA 143

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSV 188
           ++ + V I P AV+   VE+G    + PG+V+    ++GR+C I   + +Y  +I G+ V
Sbjct: 144 RLGENVTIHPGAVIGERVELGENVVIHPGAVVQDDCKLGRDCVIHPRAVLYPGVILGDRV 203

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           ++H+G  +G DGFGY        K+  +G +++ D VEIG N+ IDRGT  DT IG  TK
Sbjct: 204 VVHAGAVLGGDGFGYRFHQGRHLKVPQLGGLVVGDDVEIGCNTTIDRGTFGDTKIGAGTK 263

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQIGHN  IG   +I   VGIAGS   GD+V++ GQ G+  ++ IG    I +++G
Sbjct: 264 IDNLVQIGHNTSIGRHNLICGLVGIAGSCATGDHVVLAGQVGLRDHITIGSRAVIGAQAG 323

Query: 309 VLKDIPAGQQYGGMPARPIGEY 330
           V +DI       G PA P  E+
Sbjct: 324 VSRDIKPDASVVGSPAIPDKEF 345


>gi|209695841|ref|YP_002263771.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aliivibrio salmonicida LFI1238]
 gi|208009794|emb|CAQ80101.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aliivibrio salmonicida LFI1238]
          Length = 339

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 121/329 (36%), Positives = 178/329 (54%), Gaps = 12/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L KLA+ +GA++     G+ +++S++ + +A  GDI+++ + K+   + +C+ASA+I 
Sbjct: 4   ITLAKLAEKLGATV--HGNGDVIVHSIASMNKAREGDITFLSNAKYRKQLAECQASAVIV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +  V F   N   L+   P + FA+A      QA+    +     I+P A++  D  I 
Sbjct: 62  KEADVEFCQSN--ALIMRDPYLGFALA-----AQALDTTPAPATD-IAPSAYIAADAIIG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
            GV I   AV+     I     +G G  IG   +IG N  + A  SIY  + IG S ++ 
Sbjct: 114 KGVAIGHNAVIESKAVIADGAIIGSGCFIGQEAKIGENTKLWANVSIYHRVEIGKSCLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           +G  IG+DGFGYA       KI  +G VII D VEIGAN+AIDRG ID+TII  N  IDN
Sbjct: 174 AGTVIGSDGFGYANDRGTWVKIPQLGTVIIGDNVEIGANAAIDRGAIDNTIIESNVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            +QI HNV IG G  +     +AGST IG + +IGG   I G+++I D V I     V++
Sbjct: 234 HIQIAHNVQIGSGSAMAGGTIVAGSTKIGKHCIIGGGSVINGHIEITDGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVMLSK 339
            I     Y  G+P +P  E+ +    + K
Sbjct: 294 GISEKGMYSSGIPLQPNKEWRKTATRVHK 322


>gi|322379453|ref|ZP_08053823.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter suis HS1]
 gi|321148162|gb|EFX42692.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter suis HS1]
          Length = 338

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 124/345 (35%), Positives = 183/345 (53%), Gaps = 22/345 (6%)

Query: 13  IALMKLAQSIGASL-LDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           + L  L ++ G  + L  NF +  +  ++P+  A+   ISY+  + ++  ++  KA A+ 
Sbjct: 1   MTLQHLLKTYGLEITLPLNFKDFEVEGVAPLESATQQHISYVDQKSYVKKLKDTKAGAVF 60

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
              +    +P     L+ + P ++FA+            +A   E   +PQA      K+
Sbjct: 61  IRAEHANKVPSMSQALIVENPHLAFALIS----------DAFKVEMFANPQA--KHIPKL 108

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVIL 190
            +GV++ P  VV  GVEIG  + +    VIG  V+IG +C I    +IY ++ IG+ V +
Sbjct: 109 GEGVILMPHVVVGEGVEIGDHSVIMANVVIGDHVKIGAHCKIYPNVTIYQNTTIGDHVYI 168

Query: 191 HSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           H+   IG+DGFGYA      H KI H G V I + VEIGA++ IDR     T I E  KI
Sbjct: 169 HANSVIGSDGFGYAHTKEGAHVKIEHTGCVRIDNWVEIGASTTIDRAVFGITHIKEGVKI 228

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQ+GHN  +G   IIV+QVG++GST +G NV++GGQ G  G++ IG+  QI  K  V
Sbjct: 229 DNLVQVGHNCVLGEHSIIVAQVGLSGSTTMGRNVVLGGQVGTGGHMHIGEFSQIGGKGAV 288

Query: 310 LKDIPAGQQY-GGMPARPIGEY------LRHMVMLSKPSKYKIKR 347
            KD+P    Y G +PA  I E+      LR  V   KPS  +  R
Sbjct: 289 GKDLPPHTNYAGAIPAMEIHEWHHFLATLRRFVKGQKPSLLEKAR 333


>gi|307823265|ref|ZP_07653495.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacter tundripaludum SV96]
 gi|307736040|gb|EFO06887.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylobacter tundripaludum SV96]
          Length = 346

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 117/329 (35%), Positives = 180/329 (54%), Gaps = 9/329 (2%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L +LA   GA + +       I+S + I  A  G ++ + + ++  +I+   ASA   
Sbjct: 3   ITLKELADFCGARI-EGGDPSATIHSAAEITSAHQGQVTQLTNSRYTRHIKDSTASACFI 61

Query: 73  SQDI-VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
           ++   V  +P+ +  L+   PEVSF  A  +L+P      A  +   I+PQA L  +V +
Sbjct: 62  AESFAVENVPEGMALLICPDPEVSFIKAVELLHP------ARIYGRQIAPQAVLEANVTL 115

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
            D + I P AV+     +G  + +  G+ +G  V+IG+NC I   + IY  + IGN+VI+
Sbjct: 116 GDELYIGPYAVIGENSTLGDGSEIHAGAYLGKNVKIGKNCRIYPYAVIYDDVAIGNNVII 175

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           HSG  IG DGFGY    +   K+  +G V+I+D VEIGAN+ IDRG +  T+IG  +KID
Sbjct: 176 HSGAIIGADGFGYKFRNNQHVKVPQVGNVVIEDNVEIGANTCIDRGALGSTLIGAGSKID 235

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGHN  +G   I+    G++GS  I D  ++ G  GIA ++ IG    + ++SGV 
Sbjct: 236 NLVQIGHNNKVGKHVIMCGLTGVSGSCNIEDYAILAGSSGIADHVTIGQGAVVMARSGVA 295

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            D+ AG Q  G PA+      +  + +SK
Sbjct: 296 GDVKAGTQVFGSPAKDKKTAYKEQIAISK 324


>gi|254443161|ref|ZP_05056637.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Verrucomicrobiae bacterium DG1235]
 gi|198257469|gb|EDY81777.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Verrucomicrobiae bacterium DG1235]
          Length = 346

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 180/336 (53%), Gaps = 10/336 (2%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           ++L  +   I  S  +   G R I  ++ +  A  GD +++ S K++  +++ +AS I+ 
Sbjct: 5   LSLNAVLDRIDYSSFEGELGVRNITGVASLNEAKQGDATFVASSKYIQELKESRASLIVV 64

Query: 73  SQDIVPFIPKNIPCLLS-DKPEVSFAIAGSILYPQAMHMEASSFE--GGISPQAFLGEDV 129
           S+D+    PK+   +L  D P +  A    ++  +  +           I P A + E  
Sbjct: 65  SKDL-EVSPKSGQLILRVDNPSIEIAKLCELISQKMWNRPDPGVHRLADIHPSARIDESA 123

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            IE    I   A+V PG  +G  + +GP   +G G  +  N ++        +++G  V 
Sbjct: 124 TIEAFATIGEGAIVGPGCVVGTGSAIGPACQLGEGCHLSSNVTLE-----RDTIVGKRVR 178

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           +H+GV +G+DGFGY        KI  IG V + D VEIGAN+ IDRG    T IGE +KI
Sbjct: 179 IHAGVVLGSDGFGYEFENGRHRKIPQIGLVNVGDDVEIGANTTIDRGRFGPTRIGEGSKI 238

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQIGHNV +G  CI+ +QVGIAGST +GD V++GG+ G +G+++IG   Q++ +   
Sbjct: 239 DNLVQIGHNVAVGKHCILCAQVGIAGSTKLGDYVVMGGRAGASGHIEIGGGAQLSGQCVA 298

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYK 344
             D+  G +YGG PA P+  Y R  V+  + P  +K
Sbjct: 299 YSDLEGGAKYGGAPAIPLVAYQRITVITRRLPELFK 334


>gi|315022915|gb|EFT35938.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Riemerella anatipestifer RA-YM]
 gi|325336447|gb|ADZ12721.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Riemerella anatipestifer RA-GD]
          Length = 344

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 111/304 (36%), Positives = 168/304 (55%), Gaps = 6/304 (1%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           +I  +SPI     G +S++   KF + IE+ K S +I S+ ++         +  +   +
Sbjct: 23  LITGVSPIESGEEGHLSFVAQEKFSHFIEETKCSVLIVSKKLLDKKDYKATIIAVEDAYL 82

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           SF +  + LY + +    S  E G    AF+ +   + + V +     +    ++G  + 
Sbjct: 83  SFQVLMN-LYNEMVQDRKSGVEEG----AFIHQTAVLGENVFVGAFTYISEKTKVGEGSQ 137

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           + P   IG  V+IG+NC I +G+ IY   +IG++ I+HS   IG DGFG+        KI
Sbjct: 138 IAPQVYIGKRVKIGKNCKIDSGARIYDGCVIGDNCIIHSNTVIGGDGFGFQPTAEGFKKI 197

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             +G VII++ VEIG+N +IDR TI  TIIGE TKIDN +QI HNV IG   +I +Q GI
Sbjct: 198 PQLGNVIIENNVEIGSNCSIDRATIGSTIIGEGTKIDNLIQIAHNVKIGKHNVIAAQAGI 257

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           AGST IGD   +GGQ GI G++ IG+ V+I ++SGV   +  G+   G PA    ++ R+
Sbjct: 258 AGSTTIGDWNQVGGQVGIVGHINIGNQVKIQAQSGVNNSVSDGEILYGSPAISASDFRRN 317

Query: 334 MVML 337
            V  
Sbjct: 318 YVHF 321


>gi|237751927|ref|ZP_04582407.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter winghamensis ATCC BAA-430]
 gi|229376686|gb|EEO26777.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter winghamensis ATCC BAA-430]
          Length = 334

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 113/320 (35%), Positives = 167/320 (52%), Gaps = 21/320 (6%)

Query: 22  IGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIP 81
           + ++ LD NF    I ++     A+   I+++    ++  I+  KA AI+  +  +  IP
Sbjct: 29  VHSNFLDSNF----ITNIESPQNATCDCITFLEKESYIPEIKTSKAKAILVRKSHLNAIP 84

Query: 82  KNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMA 141
            +   L+ + P ++ A           +ME                  KI     IA   
Sbjct: 85  TSAFALVCENPYLAMAYLTECFATPLFNMETPP---------------KIAKSAQIASNV 129

Query: 142 VVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDG 200
            +  G EIG    +     IG  V+IG NC +  G  IY    IG++V +H+   IG+DG
Sbjct: 130 TIGNGSEIGENCVILANVTIGENVKIGANCVLFPGVCIYRDCEIGDNVRIHANSVIGSDG 189

Query: 201 FGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNV 259
           FGYA      H KI H G+ ++++ VEIGAN+ IDR    +T I + TKIDN VQIGHN 
Sbjct: 190 FGYAHTKDGKHIKIYHNGKAVLENDVEIGANTTIDRAVFGETRIKQGTKIDNLVQIGHNC 249

Query: 260 HIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY 319
           +IG   IIVSQ GI+GST  G NV++GGQCG AG+L IGD  Q+ ++  + K +PA  ++
Sbjct: 250 NIGEFSIIVSQAGISGSTSTGRNVVLGGQCGSAGHLHIGDFTQVGARGAISKSLPANGKF 309

Query: 320 GGMPARPIGEYLRHMVMLSK 339
            G P  PI ++L+   +L K
Sbjct: 310 SGHPLLPINDWLKLQALLKK 329


>gi|86151822|ref|ZP_01070036.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|86153381|ref|ZP_01071585.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|121612208|ref|YP_001000277.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167005230|ref|ZP_02270988.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315124096|ref|YP_004066100.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
 gi|85841451|gb|EAQ58699.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|85843107|gb|EAQ60318.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|87250108|gb|EAQ73066.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|315017818|gb|ADT65911.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni ICDCCJ07001]
          Length = 321

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 177/324 (54%), Gaps = 25/324 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ I   L  E  GE + I +L+ + +A+  +++Y    K   +I    A+AI+ S+
Sbjct: 1   MKLSE-IAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTKDIPHTGAAAILVSK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE-----GGISPQAFLGEDV 129
           +    +PK+   L++  P +SFA    +     +       +       I P  ++G++V
Sbjct: 60  EYENLVPKDTKALITQSPHLSFAFLSKLFAKPLISTAKEKVQNIAKSARIMPNVYIGDNV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I + V+I   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G VI++D VE+GA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVILEDFVEVGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN +IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ G
Sbjct: 223 VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V K++  G+ YGG P     ++L+
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLK 306


>gi|220932600|ref|YP_002509508.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Halothermothrix orenii H 168]
 gi|219993910|gb|ACL70513.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Halothermothrix orenii H 168]
          Length = 348

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 178/319 (55%), Gaps = 12/319 (3%)

Query: 17  KLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           +LA  +G  L+ +   + +I  +S +  +    +++  +  +L+  E+ +A  +I  ++I
Sbjct: 15  ELAHLVGGELVGDP--DLVIKGVSGVGESRPDTVTFAENSTYLDKAEQSRAGLVIVPEEI 72

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
                KNI  +    P ++FA   S   P  ++         IS  A +GEDV I   VV
Sbjct: 73  EES-SKNI--IRVKNPRLAFARIASHFAPDMLYRPGIDETAVISSTACIGEDVSIHPHVV 129

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHSGVR 195
           I   AV      IG +  + PG  +G GV IG +  I A   I Y ++IG++VI+H G  
Sbjct: 130 IDKEAV------IGDRVILAPGVYVGPGVEIGDDTVIHANVVIEYDTVIGSNVIIHGGTV 183

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG+DG+G+       HKI  +G VII+D VEIGAN  +DRGT   T+I + TKIDN VQ+
Sbjct: 184 IGSDGYGFVTDEKGHHKIPQLGNVIIEDNVEIGANVTVDRGTSGPTVIKQGTKIDNLVQV 243

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HNV +G   +IV+QVG+AGST +G  V + G+ G+AG++++GDN  IA+ S V K+ P+
Sbjct: 244 AHNVQVGEENLIVAQVGVAGSTRLGRRVTLAGKVGVAGHIELGDNSTIAAGSIVTKNTPS 303

Query: 316 GQQYGGMPARPIGEYLRHM 334
           G  Y G PA    E L+  
Sbjct: 304 GVFYSGNPAHDHREELKEQ 322


>gi|160891029|ref|ZP_02072032.1| hypothetical protein BACUNI_03476 [Bacteroides uniformis ATCC 8492]
 gi|270294367|ref|ZP_06200569.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D20]
 gi|317480973|ref|ZP_07940053.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 4_1_36]
 gi|156859250|gb|EDO52681.1| hypothetical protein BACUNI_03476 [Bacteroides uniformis ATCC 8492]
 gi|270275834|gb|EFA21694.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D20]
 gi|316902866|gb|EFV24740.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 4_1_36]
          Length = 346

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 165/306 (53%), Gaps = 10/306 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+   I + ++S ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYTPYIYETQSSIVLVNKDFVPEQEVKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI   AF+ E  KI   V IAP A +    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRV-----GIDSLAFVAETAKIGKDVYIAPFACIGEYA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P   IG+G ++G +C I A S+IY    +GN  ILHSG  IG DGFG+A  
Sbjct: 130 EVGDNTVIHPHVTIGSGAKVGNDCIIYANSTIYHDCRVGNHCILHSGCVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  I++D VEIGAN+ +DR T+  TI+    K+DN +Q+ HN  IG   +
Sbjct: 190 SEGYEKIPQIGITILEDHVEIGANTCVDRATMGATIVHSGVKLDNLIQVAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVG+AGST IG+  + GGQ GIAG++ IG+ V + ++SGV   I  G Q  G P   
Sbjct: 250 MAAQVGVAGSTKIGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPSSIKDGSQLIGTPPME 309

Query: 327 IGEYLR 332
           + +Y +
Sbjct: 310 LKQYFK 315


>gi|297621419|ref|YP_003709556.1| putative UDP glucosamine N-acyltransferase [Waddlia chondrophila
           WSU 86-1044]
 gi|297376720|gb|ADI38550.1| putative UDP glucosamine N-acyltransferase [Waddlia chondrophila
           WSU 86-1044]
          Length = 347

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 128/330 (38%), Positives = 174/330 (52%), Gaps = 18/330 (5%)

Query: 25  SLLDEN--FGE--RMIYSLSPIARASTGDISYIISRKFLNN-----IEKCKASAIICSQD 75
           SLL E+  FG+    I   + +  A     S++ + K+ N      +   +A  I  +  
Sbjct: 13  SLLTESKLFGDPDYTITGYADLENAQPHHASFLSNPKYTNTRYEGVMNASQAGVIFVAPH 72

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
           I     KN   L+ + P  +F  A   L  +       SF     P A +    KI    
Sbjct: 73  IARAQGKNY--LVHEDPSRAFQTAIEALKGKIKQTGFESFH----PSAVIHPTTKIGLNT 126

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGV 194
           +I P AV+  GV IG+  Y+G G+ IG    IG  C I     I    +IGN VI+ SG 
Sbjct: 127 IIGPHAVIDEGVTIGKDCYIGAGAFIGPETTIGERCRIDPNVVIREHCVIGNRVIVQSGA 186

Query: 195 RIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            IG+ GFGY      +H ++ HIG VI++D VEIGANS IDR     TII + TKIDN V
Sbjct: 187 VIGSCGFGYTTNDQGLHERLSHIGNVILEDDVEIGANSTIDRARFTSTIIAKGTKIDNLV 246

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
            IGHNV +G   II  Q GIAGS+  G +V+I GQCGI G++K+ D V IA+KSGV K +
Sbjct: 247 VIGHNVKVGRHNIICGQSGIAGSSETGSHVVIAGQCGINGHIKLEDGVIIAAKSGVTKSL 306

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSKPSKY 343
             G +YGG+PA+P+ ++ R  V +    KY
Sbjct: 307 STG-RYGGIPAQPLDQHNRTNVHIRNLEKY 335


>gi|317475298|ref|ZP_07934564.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides eggerthii 1_2_48FAA]
 gi|316908552|gb|EFV30240.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides eggerthii 1_2_48FAA]
          Length = 346

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 170/318 (53%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K++  + + ++S ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYIPYLYETQSSIVLVNKDFVPEQEVKATMI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI  +A++ E  KI   V IAP A +    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRT-----GIDSRAYVAETAKIGKDVYIAPFACIGEYA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P + IG+G ++G +C I A  +IY    IGN  ILH+G  IG DGFG+A  
Sbjct: 130 EVGDNTVIHPHATIGSGAKVGNDCIIYANVTIYHDCRIGNRCILHAGCVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  I++D VEIGAN+ +DR T+  TI+    K+DN +Q+ HN  IG   +
Sbjct: 190 PEGYEKIPQIGVTILEDDVEIGANTCVDRATMGATIVHSGVKLDNLIQVAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST +G+  + GGQ GIAG++ IG+ V + ++SGV   I  G Q  G P   
Sbjct: 250 MAAQVGIAGSTKVGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPSSIKEGSQLIGTPPME 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
           +  Y +   +  K P  Y
Sbjct: 310 VKSYFKSQSVFRKLPDMY 327


>gi|29840240|ref|NP_829346.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila caviae GPIC]
 gi|33301243|sp|Q823E0|LPXD_CHLCV RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|29834588|gb|AAP05224.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Chlamydophila caviae GPIC]
          Length = 359

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 173/310 (55%), Gaps = 11/310 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP---FIPKNIPCLLS 89
           E  I  +  I+ A    I+++ + K+   I+  +A AII S+        + KN   ++S
Sbjct: 25  ETPISGVEEISEAQAHHITFLDNEKYSRFIKITEAGAIILSKAQAQKYGHLNKNF-LVVS 83

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           + P ++F     +  P       S F G I P A +     I   V I P AV+     I
Sbjct: 84  EFPSIAFQKCIELFIPPV----ESGFPG-IHPTAVIHPTAHIGKDVCIEPYAVIGQHAHI 138

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVS 208
           G  +Y+G GS++GA   +G NC I     I   + IG  VI+  G  IG+ GFGY     
Sbjct: 139 GDSSYIGAGSIVGAYSILGENCLIHPKVVIRERVEIGKRVIVQPGAVIGSCGFGYITNAF 198

Query: 209 DIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             HK + H+G+VII+D VEIGAN+ IDRG   +++I E TKIDNQVQI H+V IG   +I
Sbjct: 199 GRHKHLKHLGKVIIEDDVEIGANTTIDRGRFKNSVICEGTKIDNQVQIAHHVEIGKHSMI 258

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K I +   YGG PARP 
Sbjct: 259 VAQAGIAGSTKIGNHVIIGGQTGITGHISITDHVIMMAQTGVTKSISSPGIYGGAPARPY 318

Query: 328 GEYLRHMVML 337
            E  R +  +
Sbjct: 319 QEIHRQVAKI 328


>gi|157414858|ref|YP_001482114.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157385822|gb|ABV52137.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747495|gb|ADN90765.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni M1]
 gi|315931774|gb|EFV10729.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 327]
          Length = 321

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 177/324 (54%), Gaps = 25/324 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ I   L  E  GE + I +L+ + +A+  +++Y    K   +I    A+AI+ S+
Sbjct: 1   MKLSE-IAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTKDIPHTGAAAILVSK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE-----GGISPQAFLGEDV 129
           +    +PK+   L++  P +SFA    +     +       +       I P  ++G++V
Sbjct: 60  EYENLVPKDTKALITQSPHLSFAFLSKLFAKPLISTAKEKVQNIAKSARIMPNVYIGDNV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I + V+I   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G V+++D VE+GA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVVLEDFVEVGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN +IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ G
Sbjct: 223 VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V K++  G+ YGG P     ++L+
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLK 306


>gi|310778413|ref|YP_003966746.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Ilyobacter polytropus DSM 2926]
 gi|309747736|gb|ADO82398.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Ilyobacter polytropus DSM 2926]
          Length = 334

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 130/324 (40%), Positives = 171/324 (52%), Gaps = 17/324 (5%)

Query: 20  QSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV 77
           Q + A L  E  G++   I  LSP  +A   ++++    KFL  I + KA A+I     V
Sbjct: 6   QDVAALLGGEIKGDKSLEISGLSPFFQARETELTFAADEKFLRKISETKAGAVI-----V 60

Query: 78  PFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV-KIEDGVV 136
           P     IP L  DK  +        L P+ +    S F+    P   + ED  KI   V 
Sbjct: 61  P----PIPGLPGDKTYIVVNGNPRELMPKLL----SFFKRKTKPMVKMIEDTAKIGKNVS 112

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVR 195
           IAP   +   VEIG    + P + I  GV+IG    I +  +I   S +G   I+  G  
Sbjct: 113 IAPNVYLGHDVEIGDNVAISPNTTICQGVKIGEGSVIYSNVTIREFSELGKKCIIQPGAV 172

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG+DGFGY +      KI  IGRV+I D+VEIG+N+ IDRG I DTII   TKIDN VQI
Sbjct: 173 IGSDGFGYVKVAGKNQKIEQIGRVLIGDEVEIGSNTTIDRGAIGDTIIKNYTKIDNLVQI 232

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG  CII+SQVGIAGST +GDN  + GQ G++G+LKIG NV + SKS +  ++  
Sbjct: 233 AHNDIIGENCIIISQVGIAGSTEVGDNTTLAGQVGVSGHLKIGSNVIVGSKSAIHGNVKD 292

Query: 316 GQQYGGMPARPIGEYLRHMVMLSK 339
            Q   G P     + L+  V L K
Sbjct: 293 NQILSGFPLVDHRDDLKIKVSLKK 316


>gi|303231005|ref|ZP_07317748.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302514387|gb|EFL56386.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Veillonella atypica ACS-049-V-Sch6]
          Length = 343

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 177/323 (54%), Gaps = 19/323 (5%)

Query: 14  ALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
            +++LAQ IG  ++ +E+    +I       +A+   I++ I  +++ +I  CKA A+I 
Sbjct: 4   TVLELAQLIGGKVVGNESL---VITETRGFEQAAPQSITFAIG-EYVEHIGLCKAGAVIL 59

Query: 73  SQDIVPFIPKNIPC--LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
            Q+       N P   ++ D  +V+FA    + +P  +          I P A +GE+VK
Sbjct: 60  EQE-----ASNAPMTQIIVDNAKVAFAQVLQLFHPPVV------IPREIHPTAIIGENVK 108

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVI 189
           + D V I    V+     IG    + P   IG   R+G NC I  G+ ++ + ++GN V+
Sbjct: 109 LGDNVAIGAYCVINDNAVIGDNVTIRPYVYIGHNTRVGNNCDIYTGAVVHENCILGNRVV 168

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           L +   IG +GFG+A        I  +G VI++D VEIG+ + ID  T+  T++ + TKI
Sbjct: 169 LRAKAVIGGEGFGFATENGVHTHIPQVGNVILEDDVEIGSCTTIDNATMGSTLVRKGTKI 228

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V +GHNV IG  C +++QVGIAGST  G+NV+  GQ G  G++ IGDN + A K+G+
Sbjct: 229 DNLVHLGHNVEIGENCFLIAQVGIAGSTKCGNNVIFAGQTGCTGHITIGDNAKFAGKTGI 288

Query: 310 LKDIPAGQQYGGMPARPIGEYLR 332
             ++PA     G P RP  E+L+
Sbjct: 289 TGNVPADAVMAGYPMRPHKEWLK 311


>gi|57238228|ref|YP_178691.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni RM1221]
 gi|86149836|ref|ZP_01068065.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88597090|ref|ZP_01100326.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|148925937|ref|ZP_01809624.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205355426|ref|ZP_03222197.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni CG8421]
 gi|218562227|ref|YP_002344006.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|20138774|sp|Q9PHU0|LPXD_CAMJE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|81557545|sp|Q5HVJ4|LPXD_CAMJR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|57167032|gb|AAW35811.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni RM1221]
 gi|85839654|gb|EAQ56914.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88190779|gb|EAQ94752.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359933|emb|CAL34722.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|145844923|gb|EDK22027.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni CG8486]
 gi|205346660|gb|EDZ33292.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni CG8421]
 gi|284925837|gb|ADC28189.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315057990|gb|ADT72319.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni S3]
 gi|315927312|gb|EFV06656.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni DFVF1099]
 gi|315928650|gb|EFV07937.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter jejuni subsp. jejuni 305]
          Length = 321

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 180/324 (55%), Gaps = 25/324 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MKL++ I   L  E  GE + I +L+ + +A+  +++Y    K   +I    A+AI+ S+
Sbjct: 1   MKLSE-IAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTKDIPHTGAAAILVSK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAI-----AGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           +    +PK+   L++  P +SFA      A  ++      ++  +    I P  ++G++V
Sbjct: 60  EYENLVPKDTKALITQSPHLSFAFLSKLFAKPLISTAKEKVQNIAKSARIMPNVYIGDNV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I + V+I   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G V+++D VE+GA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVVLEDFVEVGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN +IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+LKIGD   IA++ G
Sbjct: 223 VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V K++  G+ YGG P     ++L+
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLK 306


>gi|262066904|ref|ZP_06026516.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium periodonticum ATCC 33693]
 gi|291379373|gb|EFE86891.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium periodonticum ATCC 33693]
          Length = 332

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 120/325 (36%), Positives = 174/325 (53%), Gaps = 27/325 (8%)

Query: 25  SLLDENFGERMIYS---LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIP 81
           +LL+  +   +I S   LSP   +    +++    KFL N+ + KA  II     +P I 
Sbjct: 10  TLLNAEYKGEVIESVSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIELPLIE 69

Query: 82  KNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMA 141
                ++ D P V        + P+ +H  + + +     +    +  KI + V IAP  
Sbjct: 70  GKGYIVVKDSPRV--------IMPKLLHFFSRTLK---KIEKMREDSAKIGENVDIAPNV 118

Query: 142 VVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGV 194
            V   V IG    + P   IG GV      +IG G+ IYS++       IG   ++  G 
Sbjct: 119 YVGHDVVIGNNVKIFPNVTIGEGV------TIGEGTVIYSNVTIREFVEIGKKCVIQPGA 172

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
            IG+DGFG+ +   +  KI  IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQ
Sbjct: 173 VIGSDGFGFVKVNGNNTKIDQIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQ 232

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           I HN  IG  C+I+SQVGIAGST +G+NV + GQ G+AG+L+IGDN  I ++SGV  ++ 
Sbjct: 233 IAHNDIIGENCLIISQVGIAGSTIVGNNVTLAGQVGVAGHLEIGDNTMIGAQSGVPGNVE 292

Query: 315 AGQQYGGMPARPIGEYLRHMVMLSK 339
           A +   G P     E ++  V + K
Sbjct: 293 ANKILSGHPLVDHREDMKIRVAMKK 317


>gi|118581424|ref|YP_902674.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pelobacter propionicus DSM 2379]
 gi|118504134|gb|ABL00617.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pelobacter propionicus DSM 2379]
          Length = 346

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 117/327 (35%), Positives = 184/327 (56%), Gaps = 14/327 (4%)

Query: 15  LMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           L +LA  +G ++  DE     ++  L+P+  A    I+++ + K+   + +  A A++ +
Sbjct: 7   LKELADYLGGTVRGDETL---VVNGLAPLESAGADKITFLANPKYAAKVAETGAGAVLMA 63

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                F  +N+  +    P ++FA   ++ Y   +H  A     G+   A +G ++ +  
Sbjct: 64  PGGEAF-GRNL--IEVATPYLAFAKLLNLFY---VHKPAPR---GVMEGASIGANLTLGS 114

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
            V I P A++   V +G +  +  G+VI  G  IG +C I A + +     IGN  +L  
Sbjct: 115 DVTIHPGAMIGNNVRVGDRCVIHSGAVIYDGASIGDDCLIHANAVVRERCRIGNRCVLQP 174

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           G  IG+DGFGYA   S  + I  IG V+++D VEIGANS +DR  ++ T+I   TK+DN 
Sbjct: 175 GAVIGSDGFGYAPDGSGYYPIPQIGIVVLEDDVEIGANSCVDRAALEVTLIRRGTKLDNL 234

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI HN  IG  C+IVSQVGI+GST +G++V + GQ G+AG+L IGDNV I ++SGV   
Sbjct: 235 VQIAHNCQIGEDCMIVSQVGISGSTKLGNHVTLAGQVGVAGHLTIGDNVMIGAQSGVPNS 294

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +PA   Y G P  P  ++LR M ++ +
Sbjct: 295 VPANAGYSGTPIMPHKDWLRAMAVVPR 321


>gi|237739186|ref|ZP_04569667.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 2_1_31]
 gi|229423786|gb|EEO38833.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 2_1_31]
          Length = 332

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 166/305 (54%), Gaps = 12/305 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P V 
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLAQTKAKVIIVPDIELPLIEGKGYIVVKDSPRV- 82

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
                  + P+ +H  + + +     +    +  KI + V IAP   +   V IG    +
Sbjct: 83  -------IMPKLLHFFSRTLK---KIEKMREDSAKIGENVDIAPNVYIGHDVVIGNNVKI 132

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   IG GV+IG    I +  +I   + IG + ++  G  IG+DGFG+ +   +  KI 
Sbjct: 133 FPNVTIGEGVKIGEGTVIYSNVTIREFVEIGKNCVIQPGAVIGSDGFGFVKVNGNNTKID 192

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVGIA
Sbjct: 193 QIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVGIA 252

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST +G+NV + GQ G+AG+L+IGDN  I ++SGV  ++ A +   G P     E ++  
Sbjct: 253 GSTIVGNNVTLAGQVGVAGHLEIGDNTMIGAQSGVPGNVEANKILSGHPLVDHREDMKIR 312

Query: 335 VMLSK 339
           V + K
Sbjct: 313 VAMKK 317


>gi|332703881|ref|ZP_08423969.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio africanus str. Walvis Bay]
 gi|332554030|gb|EGJ51074.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio africanus str. Walvis Bay]
          Length = 348

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 185/331 (55%), Gaps = 15/331 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++A+  G  L      +R I  ++ +  A + ++S++ S K+L+ +E  KA+A+I 
Sbjct: 3   VKLSQMAEQFGLRL---KGADREISGINTLEAAGSTELSFLASNKYLDALENTKAAAVIL 59

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL-YPQAMHMEASSFEGGISPQAFLGEDVKI 131
            +     +      L+S  P +S A    +   PQ   +       G S  AF+    ++
Sbjct: 60  EEAHADRVQS---ALISTNPYLSVAQVAKLFDKPQGEFL-------GHSELAFVHPQSEV 109

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVIL 190
           +    I P A V  G +IG ++ V P   +G  V +G+  ++  G ++ + + +G+  ++
Sbjct: 110 DATATIYPFAYVARGAKIGPESKVYPFCYVGEDVTLGKCVTLYPGVTLMARTQVGDGCLI 169

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           H G  +G+DGFG+  G + + K+  IG V I + VEIG N+AIDRG++  T +G  TKID
Sbjct: 170 HPGAVLGSDGFGFLPGPTGLMKVPQIGTVSIGNDVEIGCNTAIDRGSLGQTSVGHGTKID 229

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQI HNV IG   I+V QVGI+GST IG  V IGGQ G+AG+L +GD  +I ++SGV+
Sbjct: 230 NLVQIAHNVRIGEHSILVGQVGISGSTKIGSCVQIGGQAGLAGHLTVGDGARIGAQSGVM 289

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPS 341
           ++I AG +  G PA    ++ R  V  +K S
Sbjct: 290 QNIEAGSEVLGSPAVEAKKFFRIAVQQTKLS 320


>gi|206890404|ref|YP_002247944.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206742342|gb|ACI21399.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 342

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 118/304 (38%), Positives = 162/304 (53%), Gaps = 15/304 (4%)

Query: 45  ASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY 104
           A  GDI+YI S K+    +  KASA I  + I      N P L+++ P+  FA    + Y
Sbjct: 31  AQEGDITYIASSKYAELAKNSKASAFIVKEKIPNL---NKPQLITENPQFVFAKLLEMFY 87

Query: 105 --PQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIG 162
             PQ           GIS ++ +    +I   V + P   +   V IG  T + P + IG
Sbjct: 88  VKPQPCK--------GISEKSIVASTAQIGKNVTVYPFVYIDENVTIGDNTIIYPFTFIG 139

Query: 163 AGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVII 221
               IG +C I    ++   + IGN VI+H+G +IG+DGFGY       HKI  +G VII
Sbjct: 140 KETLIGSDCVIYPNVTVRERVKIGNRVIIHAGTQIGSDGFGYIFHEGKHHKIPQVGGVII 199

Query: 222 QDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGD 281
           +D VEIGA   IDR T  +T IG+ TKIDN VQI HNV IG   IIV+QVGIAGS+ +GD
Sbjct: 200 EDDVEIGACVTIDRATTGNTFIGKGTKIDNLVQIAHNVKIGQNVIIVAQVGIAGSSQVGD 259

Query: 282 NVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-P 340
             ++ GQ GI+ +++I     I ++SGV+        + G P  P  E+LR   +  K P
Sbjct: 260 GCILAGQVGISDHVEIEAGTIITAQSGVMPGKVQKGVFSGSPIMPHREWLRTNAIFQKLP 319

Query: 341 SKYK 344
             YK
Sbjct: 320 ELYK 323


>gi|319941632|ref|ZP_08015956.1| hypothetical protein HMPREF9464_01175 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804862|gb|EFW01716.1| hypothetical protein HMPREF9464_01175 [Sutterella wadsworthensis
           3_1_45B]
          Length = 367

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 153/264 (57%), Gaps = 13/264 (4%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ-DIVPFIPKNIP---CLLSDKPEV 94
           +SP A A  GD+S++   ++   ++  KA+AI+  + D      + +P    LL D P  
Sbjct: 39  MSP-AEAGEGDMSFLTDPRYAEAMKATKAAAIVLRERDAKALFGEELPNRTMLLCDDPYA 97

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
            FA A  I YP            GI P+A++ E   ++    I PMAVV  G ++G  T 
Sbjct: 98  FFAFASQIFYP-------VKRTPGIHPRAYVEESALVDPTASIEPMAVVQAGAKVGANTL 150

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           +  G+ IG    IGR+C I   + + + +++G+  ++  G  +G DGFG+A    +  KI
Sbjct: 151 ISAGAYIGEDCDIGRDCVIYPNAVLQAGTVVGDGSVVQPGAVLGGDGFGFAPFKGEWIKI 210

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
              GR ++   VEIGAN+ IDRG IDDT +GE TK+DNQ+Q+GHNV +G  C++ S VGI
Sbjct: 211 PQRGRTVLGTDVEIGANTTIDRGAIDDTFVGEGTKLDNQIQLGHNVRVGKHCVMASCVGI 270

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKI 297
           AGST +GD+V++GG   I G+++I
Sbjct: 271 AGSTTVGDHVMVGGAAMINGHIEI 294


>gi|218129329|ref|ZP_03458133.1| hypothetical protein BACEGG_00906 [Bacteroides eggerthii DSM 20697]
 gi|217988506|gb|EEC54827.1| hypothetical protein BACEGG_00906 [Bacteroides eggerthii DSM 20697]
          Length = 346

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 170/318 (53%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K++  + + ++S ++ ++D VP        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYIPYLYETQSSIVLVNKDFVPEQEVKATMI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI  +A++ E  KI   V IAP A +    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRT-----GIDSRAYVAETAKIGKDVYIAPFACIGEYA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P + IG+G ++G +C I A  +IY    IGN  ILH+G  IG DGFG+A  
Sbjct: 130 EVGDNTVIHPHATIGSGAKVGSDCIIYANVTIYHDCRIGNRCILHAGCVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  I++D VEIGAN+ +DR T+  TI+    K+DN +Q+ HN  IG   +
Sbjct: 190 PEGYEKIPQIGIAILEDDVEIGANTCVDRATMGATIVHSGVKLDNLIQVAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST +G+  + GGQ GIAG++ IG+ V + ++SGV   I  G Q  G P   
Sbjct: 250 MAAQVGIAGSTKVGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPSSIKEGSQLIGTPPME 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
           +  Y +   +  K P  Y
Sbjct: 310 VKSYFKSQSVFRKLPDMY 327


>gi|303230203|ref|ZP_07316971.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Veillonella atypica ACS-134-V-Col7a]
 gi|302515129|gb|EFL57103.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Veillonella atypica ACS-134-V-Col7a]
          Length = 343

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 178/321 (55%), Gaps = 15/321 (4%)

Query: 14  ALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
            +++LAQ IG  ++ +E+    +I       +A+   I++ I  +++ +I  CKA A+I 
Sbjct: 4   TVLELAQLIGGKVVGNESL---VITETRGFEQAAPQSITFAIG-EYVEHIGLCKAGAVIL 59

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            Q+  P  P  +  ++ D  +V+FA    + +P  +          I P A +GE+VK+ 
Sbjct: 60  EQE-APNAP--MTQIIVDNAKVAFAQVLQLFHPPVV------IPREIHPTAIIGENVKLG 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILH 191
           D V I    V+     IG    + P   IG   R+G +C I  G+ ++ + ++GN V+L 
Sbjct: 111 DNVAIGAYCVINDNAVIGDNVTIRPYVYIGHNTRVGNDCDIYTGAVVHENCILGNRVVLR 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           +   IG +GFG+A        I  +G VI++D VEIG+ + ID  T+  T++ + TKIDN
Sbjct: 171 AKAVIGGEGFGFATENGVHTHIPQVGNVILEDDVEIGSCTTIDNATMGSTLVRKGTKIDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            V +GHNV IG  C +++QVGIAGST  G+NV+  GQ G  G++ IGDN + A K+G+  
Sbjct: 231 LVHLGHNVEIGENCFLIAQVGIAGSTKCGNNVIFAGQTGCTGHITIGDNAKFAGKTGITG 290

Query: 312 DIPAGQQYGGMPARPIGEYLR 332
           ++PA     G P RP  E+L+
Sbjct: 291 NVPADAVMAGYPMRPHKEWLK 311


>gi|255658885|ref|ZP_05404294.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Mitsuokella multacida DSM 20544]
 gi|260848834|gb|EEX68841.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Mitsuokella multacida DSM 20544]
          Length = 339

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 176/336 (52%), Gaps = 14/336 (4%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++A+ +G  +  E     +I  L  I  A   D+++ +    +   + C+A+A++  
Sbjct: 4   TLQEIAEYVGGRV--EGDASIVISGLDNIEGAGEHDLTFAVD-PHIEEAKACRAAAVMLP 60

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           + +  F PK    L  ++P  +FA    +  P+        F  G+S QA +G+DVK+  
Sbjct: 61  EGVADF-PKT--ALYVEEPRAAFARLLELFTPKL------QFPKGVSEQAHIGKDVKLGK 111

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
            VVI P AVV     IG +  + P + IG    I  +  I + +++     +G   ++H 
Sbjct: 112 DVVIMPFAVVDDHAVIGDRVTLYPHTYIGQYAEIEDDTVIYSSATVREHCHVGKRCVIHC 171

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
              IG+DGFG+        K+  +G V+++D VEIGA+  IDR  +  T+IG  TKIDN 
Sbjct: 172 SAVIGSDGFGFTTHEGVHTKVPQVGNVVLEDDVEIGAHDGIDRAAMGSTVIGHGTKIDNL 231

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           V IGHN  IG  C+IV+Q GI+GST +G NV  GGQ G  G++KIG N   A++SG++ D
Sbjct: 232 VHIGHNCKIGPNCLIVAQTGISGSTTVGHNVTFGGQVGTVGHIKIGANSVYAARSGIIGD 291

Query: 313 IPAGQQYGGMPARPIGEYLRHMV-MLSKPSKYKIKR 347
           +P G    G P +   E+LR    M   P  YK  R
Sbjct: 292 MPEGVFCAGFPVQSHAEWLRMQASMKHLPEMYKKFR 327


>gi|294783834|ref|ZP_06749156.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 1_1_41FAA]
 gi|294479646|gb|EFG27425.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 1_1_41FAA]
          Length = 335

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/311 (37%), Positives = 168/311 (54%), Gaps = 24/311 (7%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P   
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLAQTKAKVIIVPDIELPLIEGKGYIVVKDSPR-- 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
                 I+ P+ +H  + + +     +    +  KI + V IAP   +   V IG    +
Sbjct: 82  ------IIMPKLLHFFSRTLK---KIEKMREDSAKIGENVDIAPNVYIGHDVVIGNNVKI 132

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYARGVS 208
            P   IG GV      +IG G+ IYS++       IG + ++  G  IG+DGFG+ +   
Sbjct: 133 FPNVTIGEGV------TIGEGTVIYSNVTIREFVKIGKNCVIQPGAVIGSDGFGFVKVNG 186

Query: 209 DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
           +  KI  IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+
Sbjct: 187 NNTKINQIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLII 246

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQVGIAGST IG+NV + GQ G+AG+L+IGDN  I ++SGV  ++ A +   G P     
Sbjct: 247 SQVGIAGSTTIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGVPGNVEANKILSGHPLVDHR 306

Query: 329 EYLRHMVMLSK 339
           E ++  V + K
Sbjct: 307 EDMKIRVAMKK 317


>gi|260772232|ref|ZP_05881148.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           metschnikovii CIP 69.14]
 gi|260611371|gb|EEX36574.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           metschnikovii CIP 69.14]
          Length = 346

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/323 (34%), Positives = 174/323 (53%), Gaps = 13/323 (4%)

Query: 13  IALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           + L  LA   G +L  D N     + +++P+ RA  GD++++ + K+  +++ C+AS ++
Sbjct: 6   LTLADLATITGGTLYGDANV---KVSAVAPMDRAKEGDVTFLSNTKYAKHLKLCQASVVM 62

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
             +      P N+  L+   P ++FA        QA+         GI+P A +  D ++
Sbjct: 63  VKESERELCPSNV--LVVADPYIAFA-----KVAQALDKTPKPALVGIAPSAVVATDAQL 115

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
              V I   AV+  GV +G    VG G  IG   R+G N  + A  ++Y  + IG+  ++
Sbjct: 116 GQNVAIGANAVIESGVVLGDNAVVGAGCFIGHNARLGHNTKLWANVTVYHGVQIGDDCLI 175

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
            SG  IG+DGFGYA    +  KI  +G V I ++VEIGA++ IDRG +DDT+I +N  +D
Sbjct: 176 QSGTVIGSDGFGYANERGEWVKIPQMGTVRIGNRVEIGASTTIDRGALDDTVIEDNVIMD 235

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           NQ+QI HNVHIG G  I     IAGST+IG   +IGG   I G++ I D V I     V+
Sbjct: 236 NQLQIAHNVHIGYGTAIAGGTVIAGSTHIGKYCIIGGATVINGHITIADGVTITGMGMVM 295

Query: 311 KDIPAGQQY-GGMPARPIGEYLR 332
           + I     Y  G+P +P  E+ +
Sbjct: 296 RSIEEKGMYSSGIPLQPNKEWRK 318


>gi|255536047|ref|YP_003096418.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Flavobacteriaceae bacterium 3519-10]
 gi|255342243|gb|ACU08356.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Flavobacteriaceae bacterium 3519-10]
          Length = 362

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/311 (36%), Positives = 163/311 (52%), Gaps = 10/311 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     I  +SPI     G +S++   +F   I K K S +I S+ ++         +
Sbjct: 38  DEN---ATITGVSPIESCEPGHLSFVAQERFAEYIGKAKCSVLIVSEKLLTAETYPTTVI 94

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             +   +SF +         ++ E    + GI   A   E   + + V +     V   V
Sbjct: 95  AVEDAYLSFQVL------MNLYKEMQGRKTGIEQGAVFHESATVGEDVYVGAFTCVSEKV 148

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARG 206
           +IG  + + P   IG  V+IG+NC I +G  IY   ++G+  ++HS   IG+DGFG+   
Sbjct: 149 KIGDGSQIYPQVYIGKNVKIGKNCIIYSGVRIYDYCVVGDDCVIHSNTVIGSDGFGFQPT 208

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  +G VI++D VEIG+N +IDRGTI  T+IG  TKIDN +QI HNV IG   +
Sbjct: 209 KDGYQKIPQLGNVILEDHVEIGSNCSIDRGTIGSTVIGRGTKIDNLIQIAHNVKIGQNNV 268

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           I +Q GIAGST IGD   IGGQ GI G++ IG+ V+I ++SGV      G    G PA  
Sbjct: 269 IAAQAGIAGSTTIGDWNQIGGQVGIVGHINIGNQVKIQAQSGVNSGAKDGDVLYGSPAIN 328

Query: 327 IGEYLRHMVML 337
            GEY R+ V  
Sbjct: 329 AGEYRRNYVHF 339


>gi|329957138|ref|ZP_08297705.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides clarus YIT 12056]
 gi|328523406|gb|EGF50505.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides clarus YIT 12056]
          Length = 346

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 168/310 (54%), Gaps = 8/310 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +++ + I     G IS++ + K++  + + ++S ++ ++D VP        +  D    S
Sbjct: 24  VHTFAKIEEGIPGAISFLSNPKYIPYLYETQSSIVLVNKDFVPEQEVKATMIKVDNAYES 83

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
            A   + LY Q+          GI  +A++ E  KI   V IAP A +    E+G  T +
Sbjct: 84  LAKLLN-LYEQSKPKRT-----GIDSRAYVAETAKIGKDVYIAPFACIGEYAEVGDNTVI 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P + IG+G ++G +C I A  +IY    +GN  ILH+G  IG DGFG+A       KI 
Sbjct: 138 HPHATIGSGAKVGSDCIIYANVTIYHDCRVGNHCILHAGCVIGADGFGFAPTPEGYEKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG  I++D VEIGAN+ +DR T+  TI+    K+DN +Q+ HN  IG   ++ +QVGIA
Sbjct: 198 QIGITILEDNVEIGANTCVDRATMGATIVHSGVKLDNLIQVAHNDEIGSHTVMAAQVGIA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST IG+  + GGQ GIAG++ IG+ V + ++SGV  +I  G Q  G P   +  Y +  
Sbjct: 258 GSTKIGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPGNIKEGSQLIGTPPMEVKPYFKAQ 317

Query: 335 VMLSK-PSKY 343
            +  K P  Y
Sbjct: 318 TVFRKLPDMY 327


>gi|34556553|ref|NP_906368.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Wolinella succinogenes DSM 1740]
 gi|81833256|sp|Q7MAQ2|LPXD_WOLSU RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|34482267|emb|CAE09268.1| PUTATIVE ACYLTRANSFERASEPROTEIN [Wolinella succinogenes]
          Length = 318

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 172/317 (54%), Gaps = 20/317 (6%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E+ I  +S +  A+  +IS++   ++ +++++ +A A++    ++  +P+    L+S  P
Sbjct: 18  EKEIVGISSLEGATPDEISFVEQDRYASSLKESRAGAVLIRASLLSLVPQGCTPLVSAHP 77

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            +  A    +     + + A   E  I+P A             IAP A +  G  IG +
Sbjct: 78  YLDMARLSKLFAKPPLGLNAQ--EPQIAPSA------------QIAPSATIGKGAVIGER 123

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           T V  G+VIG GV +G +C I     IY  + IGN V +H+G  IG+DGFGYA      H
Sbjct: 124 TIVMAGAVIGEGVCLGEDCLIYPNVVIYRDTQIGNRVFIHAGSVIGSDGFGYAHTERGEH 183

Query: 212 -KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI H G V+I+D VE+GAN+ IDR    +T I   TKIDN VQI HN  +G   I+VSQ
Sbjct: 184 IKIHHNGIVVIEDDVELGANNCIDRAVFGETRIKRGTKIDNLVQIAHNCVLGEHSIVVSQ 243

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
           VG+AGST  G NV+ GGQ   +G+L +GD   IA++ GV K I   + Y G P     E+
Sbjct: 244 VGLAGSTTTGRNVIFGGQSATSGHLHVGDFATIAARGGVSKSIEGKKTYAGFPLMEHKEW 303

Query: 331 LRHMVMLSKPSKYKIKR 347
           L+    L    K+++K+
Sbjct: 304 LK----LQASLKHQLKK 316


>gi|222823815|ref|YP_002575389.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter lari RM2100]
 gi|254810169|sp|B9KGF3|LPXD_CAMLR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|222539037|gb|ACM64138.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Campylobacter lari RM2100]
          Length = 319

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 175/323 (54%), Gaps = 24/323 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           MK+++ I   L  E +G+ + I +L+ +  AS  ++SY    K    I    A AI+ S+
Sbjct: 1   MKISE-IAKFLGIEYYGDDIEITALNSLNNASFSELSYCDGEKNSKKIASSGAGAILISK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEAS----SFEGGISPQAFLGEDVK 130
           +    + K+   L+ D P +SFA+   +     +  E      +    I P  ++GE+V+
Sbjct: 60  EFENLVSKDCVKLVVDNPHLSFALLSKLFAKPLISSEKKQSNIAKSAKIMPNVYIGENVQ 119

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVIL 190
           I D VVI   A +   V IG  T + P +VI    +IG+ C           L+ N VI 
Sbjct: 120 IADHVVIMAGAYIGDNVSIGEYTIIHPNAVIYNDTKIGKKCH----------LLANCVI- 168

Query: 191 HSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
                 G+DGFGYA   +  H KI H G VI++D VE+GA + IDR   + TII + TKI
Sbjct: 169 ------GSDGFGYAHTKNGEHYKIYHNGNVILEDFVEVGACTTIDRAVFESTIIKQGTKI 222

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQ+GHN  IG  C+IV+Q GI+GS+ +G NV +GGQ   +G+L+IGD   IA++ GV
Sbjct: 223 DNLVQVGHNCEIGENCLIVAQSGISGSSILGKNVTMGGQSATSGHLEIGDFATIAARGGV 282

Query: 310 LKDIPAGQQYGGMPARPIGEYLR 332
            K++   + YGG P     ++L+
Sbjct: 283 TKNLEGARVYGGFPIMLQKDWLK 305


>gi|59712559|ref|YP_205335.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [Vibrio
           fischeri ES114]
 gi|75431540|sp|Q5E3E9|LPXD_VIBF1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|59480660|gb|AAW86447.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [Vibrio
           fischeri ES114]
          Length = 339

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/329 (35%), Positives = 181/329 (55%), Gaps = 12/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L +LA+ + A++  +  G  +++S++ +++A  GDI+++   K+  ++ +C+ASA+I 
Sbjct: 4   ITLAELAEKLDATVHGD--GTVVVHSIASMSKAKEGDITFLSDAKYRKHLVECQASAVIV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +  V F   N+  L+   P + FA+A      QA+    +     I+P A++ +D  I 
Sbjct: 62  KEADVEFCQSNV--LIMRDPYLGFALA-----AQALDTTPAPASD-IAPSAYIADDAIIG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           +GV I   AV+     I     +G G  IG   +IG+N  + A  S+Y  + IG + ++ 
Sbjct: 114 EGVAIGHNAVIESKAVIADGAMIGAGCFIGKEAKIGKNTKLWANVSVYHRVEIGEACLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA       KI  +G VII D VEIGAN+ IDRG IDDT+I  N  IDN
Sbjct: 174 SGTVIGSDGFGYANDRGTWVKIPQLGSVIIGDNVEIGANTTIDRGAIDDTVIESNVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNV IG G  +     +AGST IG + +IGG   I G+++I D V I     V++
Sbjct: 234 QIQIAHNVQIGSGSAMAGGTIVAGSTKIGKHCIIGGGSVINGHIEITDGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVMLSK 339
            I     Y  G+P +   E+ +    + K
Sbjct: 294 AIDEKGMYSSGIPLQTNKEWRKTAARVHK 322


>gi|294084078|ref|YP_003550836.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663651|gb|ADE38752.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 344

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 112/305 (36%), Positives = 164/305 (53%), Gaps = 6/305 (1%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
            I  + P+   ++G +SY+ S K L        + I+ S+  +  +P  I  ++ D P +
Sbjct: 37  FITDIEPLHSVASGALSYVSSPKHLAGQAIPDNAVILASESCLNSLPDAIHLIIVDNPRL 96

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           ++A A   L  + +  +A     GI+P      D +I+    I+P A +     IG  T 
Sbjct: 97  AYAKAAQHLVTERVDPKAHMATAGIAP------DARIDPTAQISPRATIMHDAVIGAGTI 150

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
           +  G++I   V IG  C I A SSI  + IG+ V++ +GV IG+ GFG       I K+ 
Sbjct: 151 IEAGAIIYPHVTIGAQCHIFANSSIAFADIGDHVVVRNGVVIGSAGFGLEPASDSIVKVP 210

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            +G V I D  +IG+NS IDRG +DDTI+G+   +DN   I HN  IG  C+I +QVG+A
Sbjct: 211 QLGIVRIADGCDIGSNSTIDRGALDDTIVGKMVMLDNLCHIAHNCVIGDNCMIAAQVGMA 270

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS  +G NV+IGGQ GI+G+L IGD   I   SGV K+I A     G PA   G+Y R +
Sbjct: 271 GSVTLGKNVIIGGQAGISGHLTIGDGAIIMGHSGVTKNIDANSTVVGFPAEASGDYWRKL 330

Query: 335 VMLSK 339
             L +
Sbjct: 331 AGLRR 335


>gi|237743723|ref|ZP_04574204.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 7_1]
 gi|229432754|gb|EEO42966.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 7_1]
          Length = 332

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 164/305 (53%), Gaps = 12/305 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P   
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPR-- 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
                 I+ P+ +H  + + +     +    +  KI D V IAP   +   V IG    +
Sbjct: 82  ------IIMPKLLHFFSRTLK---KIEKMREDTAKIGDNVDIAPNVYIGHDVVIGNNVKI 132

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   IG G  IG    I +  SI   + IG + ++  G  IG+DGFG+ +   +  KI 
Sbjct: 133 FPNVTIGEGAIIGEGTVIYSNVSIREFVEIGKNCVIQPGAVIGSDGFGFVKVNGNNTKID 192

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVGIA
Sbjct: 193 QIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVGIA 252

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST IG+NV + GQ G+AG+L+IGDN  I ++SG+  ++ A +   G P     E ++  
Sbjct: 253 GSTIIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGIAGNVKANKILSGHPLVDHREDMKIR 312

Query: 335 VMLSK 339
           V + K
Sbjct: 313 VAMKK 317


>gi|281420642|ref|ZP_06251641.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella copri DSM 18205]
 gi|281405415|gb|EFB36095.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella copri DSM 18205]
          Length = 343

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 108/319 (33%), Positives = 173/319 (54%), Gaps = 11/319 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     + + + I     G IS++ + K+ + + + K+S ++  +++    P +   +
Sbjct: 19  DEN---ATVNTFAKIEEGKEGAISFLSNPKYTHYVYETKSSIVLIDENVELEHPVSTTLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
              + + ++     +L    M+      + GI P AF+    K+ +GV +   A +  G 
Sbjct: 76  ---RVKNAYECVAKLL---QMYESMKPKKTGIDPLAFVSLKAKVAEGVYVGAFAYISEGA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  + + P + IG GV+IG+N  I    ++Y    +GN+V LH+G  IG DGFG+A G
Sbjct: 130 EVGEGSQIYPHAYIGEGVKIGKNALIYPNVTVYHGCKLGNNVTLHAGCVIGADGFGFAPG 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG V I+D VEIGAN+ +DR T+  T + +  K+DN VQI HN  IG   +
Sbjct: 190 PEGYDKIPQIGIVTIEDDVEIGANTCVDRSTMGSTYVRKGVKLDNLVQIAHNTDIGANTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQVG+AGST +G+  + GGQ GIAG++ IGD V + ++SGV   + +GQQ  G P   
Sbjct: 250 MSSQVGVAGSTKVGEWCMFGGQVGIAGHITIGDKVFLGAQSGVPGSLKSGQQLIGTPPME 309

Query: 327 IGEYLRHMVMLSK-PSKYK 344
              Y +   +  + P  YK
Sbjct: 310 QRAYFKSQAIFRRLPDMYK 328


>gi|260911912|ref|ZP_05918477.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella sp. oral taxon 472 str. F0295]
 gi|260633935|gb|EEX52060.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella sp. oral taxon 472 str. F0295]
          Length = 346

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 115/331 (34%), Positives = 176/331 (53%), Gaps = 12/331 (3%)

Query: 17  KLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           ++AQ +   ++ DEN   R   S + I     G IS++ + K+ + I   KAS ++ ++D
Sbjct: 7   QIAQVVNGEIVGDENAAVR---SFAKIEEGQAGAISFLSNPKYTHYIYDTKASVVLINKD 63

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
                P     +  D    ++     +L    M+  A   + GI P AF+  D  + +  
Sbjct: 64  TKLEKPVKATLIKVDN---AYECVAKLL---QMYEAAKPKKKGIDPLAFVSPDATVGEDC 117

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILHSGV 194
            I   A V  GV IG  T + P + +   VRIG NC +     +Y  ++ G+ VILHSG 
Sbjct: 118 YIGAFAYVGSGVVIGNGTQIYPHATLCDNVRIGSNCIVYPQVCVYHDVVVGDRVILHSGS 177

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
            IG+DGFG+A   +   KI  IG V I+D VEIGAN+ +DR T+  T + +  K+DN VQ
Sbjct: 178 VIGSDGFGFAPSANGYDKIPQIGTVTIEDDVEIGANTCVDRSTMGSTYVRKGVKLDNLVQ 237

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           I HN  IG   ++ +QVG+AGST +G   + GGQ G++G++ IG+ V + ++SGV  +I 
Sbjct: 238 IAHNTDIGENTVMSAQVGVAGSTKVGQWCMFGGQVGVSGHITIGNKVFLGAQSGVPGNIK 297

Query: 315 AGQQYGGMPARPIGEYLR-HMVMLSKPSKYK 344
            GQQ  G P   +  Y + H ++   P  YK
Sbjct: 298 DGQQLIGTPPMELKPYFKSHAILKRLPEMYK 328


>gi|256028212|ref|ZP_05442046.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. D11]
 gi|289766144|ref|ZP_06525522.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. D11]
 gi|289717699|gb|EFD81711.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. D11]
          Length = 332

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 12/305 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P   
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPR-- 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
                 I+ P+ +H  + + +     +    +  KI D V IAP   +   V IG    +
Sbjct: 82  ------IIMPKLLHFFSRTLK---KIEKMREDTAKIGDNVDIAPNVYIGHDVVIGNNVKI 132

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   IG G  IG    I +  SI   + IG + ++  G  IG+DGFG+ +   +  KI 
Sbjct: 133 FPNVTIGEGAIIGEGTVIYSNVSIREFVEIGKNCVIQPGAVIGSDGFGFVKVNGNNTKID 192

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG VI++D+VEIGAN+ IDRG I DT+I + TKIDN VQI HN  IG  C+I+SQVGIA
Sbjct: 193 QIGTVIVEDEVEIGANTTIDRGAIGDTVIKKYTKIDNLVQIAHNDIIGENCLIISQVGIA 252

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST IG+NV + GQ G+AG+L+IGDN  I ++SG+  ++ A +   G P     E ++  
Sbjct: 253 GSTIIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGIAGNVKANKILSGHPLVDHREDMKIR 312

Query: 335 VMLSK 339
           V + K
Sbjct: 313 VAMKK 317


>gi|197335029|ref|YP_002156780.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Vibrio
           fischeri MJ11]
 gi|197316519|gb|ACH65966.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Vibrio
           fischeri MJ11]
          Length = 339

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 117/329 (35%), Positives = 180/329 (54%), Gaps = 12/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L +LA+ + A++  +  G  +++S++ +++A  GDI+++   K+  ++ +C+ASA+I 
Sbjct: 4   ITLAELAEKLDATVHGD--GTVVVHSIASMSKAKEGDITFLSDAKYRKHLVECQASAVIV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +  V F   N   L+   P + FA+A      QA+    +     I+P A++ +D  I 
Sbjct: 62  KEADVEFCQSN--ALIMRDPYLGFALA-----AQALDTTPAPASD-IAPSAYIADDAIIG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           +GV I   AV+     I     +G G  IG   +IG+N  + A  S+Y  + IG + ++ 
Sbjct: 114 EGVAIGHNAVIESKAVIADGAMIGAGCFIGKEAKIGKNTKLWANVSVYHRVEIGEACLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA       KI  +G VII D VEIGAN+ IDRG IDDT+I  N  IDN
Sbjct: 174 SGTVIGSDGFGYANDRGTWVKIPQLGSVIIGDNVEIGANTTIDRGAIDDTVIESNVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNV IG G  +     +AGST IG + +IGG   I G+++I D V I     V++
Sbjct: 234 QIQIAHNVQIGSGSAMAGGTIVAGSTKIGKHCIIGGGSVINGHIEITDGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVMLSK 339
            I     Y  G+P +   E+ +    + K
Sbjct: 294 AIDEKGMYSSGIPLQTNKEWRKTAARVHK 322


>gi|89898334|ref|YP_515444.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila felis Fe/C-56]
 gi|119371925|sp|Q254I9|LPXD_CHLFF RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|89331706|dbj|BAE81299.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila felis Fe/C-56]
          Length = 359

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 174/310 (56%), Gaps = 11/310 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP---FIPKNIPCLLS 89
           E  I  +  I+ A +  ++++ + K+   I+  +A AII S+        + KN   ++S
Sbjct: 25  ETPISGVEEISEAQSHHVTFLDNEKYSRFIKNTEAGAIILSKAQAQKYGHLNKNF-LIVS 83

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           + P ++F     +  P       S F G I P A +     I   V + P AV+    +I
Sbjct: 84  EFPSIAFQKCIELFIPPI----DSGFPG-IHPTAVIHPTAHIGKDVFLEPYAVICQHAQI 138

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVS 208
           G  +++G GSVIGA   +G +C +     I   + IG  VI+  G  IG  GFGY     
Sbjct: 139 GDSSHIGAGSVIGAFSTLGEHCYVHPKVVIRERVVIGKRVIVQPGAIIGACGFGYITNAF 198

Query: 209 DIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             HK + H+G+VII+D VEIGAN+ IDRG   +++I E TKIDNQVQI H+V +G   +I
Sbjct: 199 GRHKHLKHLGQVIIEDDVEIGANTTIDRGRFKNSVIREGTKIDNQVQIAHHVEVGKHSMI 258

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K I +   YGG PARP 
Sbjct: 259 VAQAGIAGSTKIGNHVIIGGQTGITGHISITDHVIMMAQTGVTKSISSPGIYGGAPARPY 318

Query: 328 GEYLRHMVML 337
            E  R +  +
Sbjct: 319 QEIHRQVAKI 328


>gi|284049024|ref|YP_003399363.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Acidaminococcus fermentans DSM 20731]
 gi|283953245|gb|ADB48048.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Acidaminococcus fermentans DSM 20731]
          Length = 346

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 141/248 (56%), Gaps = 7/248 (2%)

Query: 87  LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG 146
           L  + P  +FA+   +  P        + + GIS  AF+    K+   V I P A V   
Sbjct: 73  LAVENPRAAFAVLLQLFRP------PEAVKKGISQYAFIHPSAKVGKNVAILPFAYVAED 126

Query: 147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYAR 205
            EIG  T + P   +G  V+IG +C++ +  ++    ++G+ VIL +G  IG DGFGY  
Sbjct: 127 AEIGDNTVIYPHVYVGRHVKIGSDCTLYSNVTVREDCIVGDRVILQAGCVIGGDGFGYIT 186

Query: 206 GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
                 K++  G V++ D VEIG N+ IDR T+D T+IG+ TKIDN V +GHN  IG  C
Sbjct: 187 ANGKHTKVLQTGNVVLGDDVEIGCNTCIDRATVDSTVIGKGTKIDNLVHVGHNDIIGENC 246

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR 325
           I+V+ VGI+GS  IG+N   GGQ   AG+LKIG N   A ++G++ D+P    + G PA+
Sbjct: 247 ILVAHVGISGSVTIGNNCTFGGQAATAGHLKIGSNCTFAGRTGIISDVPDNVVWAGFPAQ 306

Query: 326 PIGEYLRH 333
           P  ++LR 
Sbjct: 307 PHVDWLRQ 314


>gi|75907060|ref|YP_321356.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Anabaena variabilis ATCC 29413]
 gi|119371916|sp|Q3MEX5|LPXD_ANAVT RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|75700785|gb|ABA20461.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Anabaena variabilis ATCC 29413]
          Length = 349

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 175/328 (53%), Gaps = 11/328 (3%)

Query: 25  SLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD---IVPFIP 81
           SL      +  I  ++ I  A++G +SYI   KF + I K  ASA+I  Q+         
Sbjct: 16  SLTQNPNNDPEITGMAAIDEATSGTLSYIEGAKFASFIAKTNASALILPQNEAMQAQAQE 75

Query: 82  KNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMA 141
           + I  + + +P + FA A ++ Y      +  +    I P A +    KI + V I P  
Sbjct: 76  RGIVWMATPEPRLLFAKAIALFY------QPYTPTPEIHPTAVIHPTAKIGNDVYIGPHV 129

Query: 142 VVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDG 200
           V+ PGVEIG    + P  VI  GV+IG    + A  +I   S IG   ++HSG  IG +G
Sbjct: 130 VIQPGVEIGNGVIIHPNVVIYPGVKIGDRTILHANCTIEERSQIGADCVIHSGAVIGGEG 189

Query: 201 FGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVH 260
           FG+    +  +K+   G V+++D+V+IG N+ IDR ++ +T +G +TKIDN VQI H   
Sbjct: 190 FGFVPTRTGWYKMEQSGYVVLEDRVDIGCNTTIDRPSVGETRVGYDTKIDNLVQIAHGCQ 249

Query: 261 IGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYG 320
           IG GC I +Q G+AG   +G+ V++ GQ GIA   K+GD    ++++G+L D+  G+   
Sbjct: 250 IGAGCAIAAQTGMAGGVKLGNRVILAGQVGIANQAKMGDGSTASAQTGILHDVKPGEVVS 309

Query: 321 GMPARPIGEYLRHMVMLSK-PSKYKIKR 347
           G PA P   YL+   + S+ P  Y+  R
Sbjct: 310 GTPAIPHKMYLKIAALYSRLPDMYQAFR 337


>gi|237738386|ref|ZP_04568867.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium mortiferum ATCC 9817]
 gi|229420266|gb|EEO35313.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium mortiferum ATCC 9817]
          Length = 335

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 116/311 (37%), Positives = 169/311 (54%), Gaps = 31/311 (9%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           L+P  +A   ++++    KFL  + + KA  I+     +P I K +  ++ + P      
Sbjct: 28  LAPFFQAQEENVTFASDEKFLKKLNETKAKVILVPDIPLPNIGK-MYLVVKENPRT---- 82

Query: 99  AGSILYPQAMHM---EASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
               L P+ ++    E   FE  I   + +G++V++             P V IG  T +
Sbjct: 83  ----LMPKLLNFFKRETKPFEKMIEDSSKIGKNVRLA------------PNVYIGHDTII 126

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYARGVS 208
           G   VI   V IG   +IG G+ IYS++       IG + ++  G  IG+DGFG+ +   
Sbjct: 127 GDNVVIYPNVTIGEGVTIGEGTIIYSNVTVREFCKIGKNCVIQPGAVIGSDGFGFVKVNG 186

Query: 209 DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
           +  KI  IG VII+D VEIGAN+ +DRG I DTII + TKIDN VQI HN  IG  C+I+
Sbjct: 187 NNTKIDQIGSVIIEDNVEIGANTTVDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLII 246

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQVGIAGS  +G+N  + GQ G+AG+LKIG+NV IA+KSGV  ++   Q   G P     
Sbjct: 247 SQVGIAGSVEVGNNTTLAGQVGVAGHLKIGNNVVIAAKSGVAGNVADNQILSGYPLMDHR 306

Query: 329 EYLRHMVMLSK 339
           E L+  + + K
Sbjct: 307 EDLKVKISMKK 317


>gi|167765228|ref|ZP_02437341.1| hypothetical protein BACSTE_03616 [Bacteroides stercoris ATCC
           43183]
 gi|167696856|gb|EDS13435.1| hypothetical protein BACSTE_03616 [Bacteroides stercoris ATCC
           43183]
          Length = 346

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 110/318 (34%), Positives = 169/318 (53%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K++  + + ++S ++ ++D  P        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGAISFLSNPKYIPYLYETQSSIVLVNKDFTPEQEVKATMI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A   + LY Q+          GI P+A++ E  KI   V IAP A V    
Sbjct: 76  KVDNAYESLAKLLN-LYEQSKPKRT-----GIDPRAYVAETAKIGKDVYIAPFAYVGDHA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
           E+G  T + P + IG+G ++G +C I A ++IY    +GN  ILH+G  IG DGFG+A  
Sbjct: 130 EVGDNTVIHPHATIGSGAKVGNDCIIYANATIYHDCRVGNRCILHAGCVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  +++D VEIGAN+ +DR T+  TI+    K+DN VQ+ HN  IG   +
Sbjct: 190 PEGYEKIPQIGITLLEDNVEIGANTCVDRATMGATIVHSGVKLDNLVQVAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST +G+  + GGQ GIAG++ IG+ V + ++SGV   I       G P   
Sbjct: 250 MAAQVGIAGSTKVGEWCMFGGQVGIAGHIHIGNKVNLGAQSGVPSSIKESSVLIGTPPME 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
           +  Y +   +  K P  Y
Sbjct: 310 VKPYFKSQSVFRKLPDMY 327


>gi|149193838|ref|ZP_01870936.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Caminibacter mediatlanticus TB-2]
 gi|149135791|gb|EDM24269.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Caminibacter mediatlanticus TB-2]
          Length = 327

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 111/311 (35%), Positives = 171/311 (54%), Gaps = 22/311 (7%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           ++ I  L+ +  A+  +IS++ ++K+   ++  KA+A++  ++ +  +PK +  L++D P
Sbjct: 31  DKKITGLNTLVDANEEEISFLENKKYEKYLKNTKAAAVLIRKEDISKLPKGVIPLITDNP 90

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
            +  A+   +          S +E G   I+  + +   V+I  GV +     + P V I
Sbjct: 91  YLKLALLTKLF-------SKSPWEDGGYQINKSSKIDPSVRIAKGVRVGKNVTIMPNVVI 143

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSD 209
           G    +  GS+I   V I R+  IG            +V +H+G  IG+DGFGYA     
Sbjct: 144 GPYVEIDEGSIIYPNVTIYRDTKIG-----------KNVTIHAGSVIGSDGFGYAHTSDG 192

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            H KI H+G+VII+D+VEIGAN+ IDR     TII + +KIDN VQIGHN  IG   I+V
Sbjct: 193 KHIKIYHLGKVIIEDEVEIGANTTIDRAVFGKTIIKKGSKIDNLVQIGHNCEIGEYSILV 252

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQVG++GS+ +G NV++GGQ   AG+L+I     IA++ GV K I     Y G P  P  
Sbjct: 253 SQVGLSGSSKLGRNVVMGGQSATAGHLEIAPFTTIAARGGVTKSIKTPGVYSGFPLMPHK 312

Query: 329 EYLRHMVMLSK 339
            +L+    LSK
Sbjct: 313 LWLKLQAKLSK 323


>gi|57168188|ref|ZP_00367327.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter coli RM2228]
 gi|305431667|ref|ZP_07400836.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter coli JV20]
 gi|57020562|gb|EAL57231.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter coli RM2228]
 gi|304445262|gb|EFM37906.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter coli JV20]
          Length = 317

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 178/324 (54%), Gaps = 25/324 (7%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           M+L + I   L  E  GE + I +L+ + RA+  +++Y    + + +I    A+AI+ ++
Sbjct: 1   MRLKE-IAEFLSLEYEGEDIEITALNSLLRANFTELTYCDGERNIKDIPNTGAAAILVAK 59

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSI----LYPQAMH-MEASSFEGGISPQAFLGEDV 129
           +    +PK+   L++  P + FA    I    L+  A   ++  +    I P  ++G +V
Sbjct: 60  EYENLVPKDTKALITQSPHLCFAFLSKIFAKPLFSNAKEKVQNIAKSAKIMPNVYIGNNV 119

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVI 189
            I + VVI   A +   V IG ++ + P  VI    +IG+ C           L+ N VI
Sbjct: 120 NIGENVVIMAGAYIGDNVSIGEESIIHPNVVIYNDSKIGKKCH----------LLANCVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
                  G+DGFGYA   +  H KI H G VI++D VEIGA + IDR   D TII   TK
Sbjct: 170 -------GSDGFGYAHNKNGEHYKIYHNGNVILEDFVEIGACTTIDRAVFDSTIIKAGTK 222

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQIGHN  IG  CIIV+Q GI+GS+ +G NV++GGQ   +G+L+IGD   IA++ G
Sbjct: 223 VDNLVQIGHNCDIGQNCIIVAQTGISGSSELGRNVVMGGQSATSGHLRIGDFSTIAARGG 282

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V K++  G+ YGG P     ++L+
Sbjct: 283 VSKNLEGGRVYGGFPIMLQKDWLK 306


>gi|269118894|ref|YP_003307071.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Sebaldella termitidis ATCC 33386]
 gi|268612772|gb|ACZ07140.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Sebaldella termitidis ATCC 33386]
          Length = 336

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 162/308 (52%), Gaps = 22/308 (7%)

Query: 38  SLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPK----NIPCLLSDKPE 93
            LSP   A   D+++      L NI   KA A+I     VP + +        +L   P 
Sbjct: 25  KLSPFFEADPEDLTFAADESMLKNIAGTKAKAVI-----VPVMEEYPDGKAYIVLEQNPR 79

Query: 94  VSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKT 153
               I  +   P+              P+  + +  KI + V+I   + +   VEIG  T
Sbjct: 80  NVLPILLNFFKPKMQ-----------KPEKQIEDSAKISENVLIGINSYIGHNVEIGENT 128

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVS-DIH 211
            + P   I  GV+IG+N  I + + I    ++G +VIL  G  IG DGFG+ +  + D  
Sbjct: 129 VIHPNVTIMEGVKIGKNSIIYSNAVIREFCVLGENVILQPGAVIGADGFGFIKDKNGDNV 188

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  IG VI++D VEIGANS +DRG I  T++   TKIDN V I HN  IG  C I++Q 
Sbjct: 189 KIEQIGNVILEDNVEIGANSCVDRGAIGSTVVKRGTKIDNLVHIAHNDIIGENCFIIAQT 248

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GI+GS  +G+N ++ GQ G+AG+LKIG+NV +A+KSG+  DIP   +  G P RP  E L
Sbjct: 249 GISGSVEVGNNTVLAGQVGVAGHLKIGNNVVVAAKSGITNDIPDNSKMSGYPLRPHMEDL 308

Query: 332 RHMVMLSK 339
           R  + + K
Sbjct: 309 RVKMSMGK 316


>gi|124025534|ref|YP_001014650.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prochlorococcus marinus str. NATL1A]
 gi|123960602|gb|ABM75385.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prochlorococcus marinus str. NATL1A]
          Length = 350

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 177/306 (57%), Gaps = 14/306 (4%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNN---IEKCKASAIICSQD---IVPFIPK-NIPCL 87
           +I + + + +A   DIS++ +   LN    IE  KASA++   +   I+    K ++  +
Sbjct: 27  VILTAASLEKAKDNDISFLDNNSPLNLRNLIETSKASALLLPANDTYIIEIAKKISVDWI 86

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
           +  +P+++FA     LYP  +  E      GI   A +G++VKI  GV I   A +    
Sbjct: 87  ILKEPKIAFAETLEFLYPSNVESE------GIHKSAVIGQNVKIGLGVSIGANAYIGDNT 140

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARG 206
           EIG  T +  G V+   VRIG    I A S I+S S +G+  ++++   IG +GFG+   
Sbjct: 141 EIGAGTIIHAGVVLYRNVRIGSKNLIHANSVIHSGSKLGDKCVINANAVIGGEGFGFVPT 200

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
            +   K+  +G VI+++KVE+G+ S IDR ++ +TIIGE+TKIDN VQIGH V  G GC 
Sbjct: 201 SNGWKKMPQVGIVILKNKVEVGSGSTIDRPSVGETIIGEDTKIDNLVQIGHGVTTGKGCA 260

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAG   IGD V++ GQ GI+  +KIGD V  +SK+G++ +I AG    G PA P
Sbjct: 261 MAAQVGIAGGAQIGDGVILAGQVGISNRVKIGDGVIASSKTGIVSNIEAGTVVSGFPAIP 320

Query: 327 IGEYLR 332
              +LR
Sbjct: 321 NKLWLR 326


>gi|320353427|ref|YP_004194766.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfobulbus propionicus DSM 2032]
 gi|320121929|gb|ADW17475.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfobulbus propionicus DSM 2032]
          Length = 354

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 120/329 (36%), Positives = 173/329 (52%), Gaps = 15/329 (4%)

Query: 14  ALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
            L +LA  +G  +  D N    ++  L+ I  A  G+I++I+ RK L   E C+ASA I 
Sbjct: 6   TLRQLADLVGGRVEGDPNL---IVRGLNGIEYAQPGEITFILDRKQLPLPETCQASACIV 62

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D         P +++D+P ++ A   + L  +    +      GI P A  GE   I 
Sbjct: 63  PVDTEAL---GRPAIVTDQPSLAAARIHTFLLTEPFQAK------GIHPSAVTGEGCVIP 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILH 191
             V I P+  +   V +G +  + PG+VIG+ V I  +  I A  ++     IG  VILH
Sbjct: 114 REVTIGPLVCLGDRVTLGERVTIHPGAVIGSDVVIDDDTIIHANVTVAERCTIGKRVILH 173

Query: 192 SGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
            G  IG+DGFG+A     +H K   +G V I D VEIGANS +DR     T I    +ID
Sbjct: 174 HGAVIGSDGFGFATDRMGVHYKKPQVGTVRIDDDVEIGANSCVDRAAFGTTWIKSGARID 233

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N V +GHNV +G   I+V+QVGIAGST +G NV++G + G+AG+L + D V  A+KSG+ 
Sbjct: 234 NLVMVGHNVVVGEHSILVAQVGIAGSTTLGRNVVLGAKAGVAGHLHLDDQVMAAAKSGIH 293

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            + P G   GG PA  +  + R     S+
Sbjct: 294 NNQPKGAMIGGSPAIEVKSWGRAAAAFSR 322


>gi|19705214|ref|NP_602709.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|296329068|ref|ZP_06871573.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|81590531|sp|Q8R6D9|LPXD_FUSNN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|19713163|gb|AAL94008.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|296153787|gb|EFG94600.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 332

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 117/307 (38%), Positives = 165/307 (53%), Gaps = 16/307 (5%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P V 
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPRV- 82

Query: 96  FAIAGSILYPQAMHMEASSF---EGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                  + P+ +H  + +    E      A +GE+V I   V I    V+   V+I   
Sbjct: 83  -------IMPKLLHFFSRNLKKIEKMREDSAKIGENVDIAPNVYIGHDVVIGNNVKIFPN 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
             +G GS+IG G  I  N SI     I     G + ++  G  IG+DGFG+ +   +  K
Sbjct: 136 VTIGEGSIIGDGTVIYSNVSIREFVEI-----GKNCVIQPGAVIGSDGFGFVKVNGNNTK 190

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVG
Sbjct: 191 IDQIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVG 250

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           IAGST IG+NV + GQ G+AG+L+IGDN  I ++SGV  ++ A +   G P     E ++
Sbjct: 251 IAGSTTIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGVPGNVEANKILSGHPLVDHREDMK 310

Query: 333 HMVMLSK 339
             V + K
Sbjct: 311 IRVAMKK 317


>gi|51246797|ref|YP_066681.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Desulfotalea psychrophila LSv54]
 gi|50877834|emb|CAG37674.1| probable UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Desulfotalea psychrophila LSv54]
          Length = 372

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 179/331 (54%), Gaps = 12/331 (3%)

Query: 11  KGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + I +  LA+ +   ++ +  GE ++ +   +  A  GDI++++     + +   KA A+
Sbjct: 30  ENITVAMLAELVDGEVIGD--GEVLVGNFVSLETAGEGDITFLVKAGDQDLLTSTKAGAV 87

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
           I  + +    P  +  +  D   ++ A   + L       E      GI   AF+GE  +
Sbjct: 88  IVHRKVEVESPATL--IKVDDAYLAAAKIHTFLLEDEFSPE------GIHRSAFVGEGCQ 139

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVI 189
           I   V I  +  +   V IG +T +  G  IG  V IG +C + A  +I   S +GN V 
Sbjct: 140 ISSEVTIKALVSIGNRVVIGPRTRIESGVAIGDDVTIGEDCLLKANVTIADGSQLGNGVT 199

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           +HSG  IG+DG+GYA      H K   +G V + D VEIGANS +DR T   T I    K
Sbjct: 200 IHSGTVIGSDGYGYATDKMGFHYKRPQVGTVRVDDNVEIGANSCVDRATYGLTWIKSGAK 259

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQI HNV +G   +IVSQVGI+GST +G NV++GG+    G+L+IGD V IA  SG
Sbjct: 260 IDNLVQIAHNVVVGENSLIVSQVGISGSTSLGRNVVMGGKAAAVGHLQIGDGVMIAGGSG 319

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           VL ++ AG   GG+PARPI ++ + +V+ +K
Sbjct: 320 VLSNLSAGAVVGGIPARPIKQWRKSVVLTTK 350


>gi|255693624|ref|ZP_05417299.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides finegoldii DSM 17565]
 gi|260620600|gb|EEX43471.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides finegoldii DSM 17565]
          Length = 346

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 169/306 (55%), Gaps = 10/306 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G IS++ + K+   I + ++S ++ ++D  P     I   
Sbjct: 19  DEN---ATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDFTP--EHEIKAT 73

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
           L  K E ++     +L    ++  +   + GI   AF+    KI + V I   A +    
Sbjct: 74  LI-KVENAYESLAKLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVYIGAFAYIGENT 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
            IG  T + P + +G GV+IG NC + +  +IY    IGN  ILHSG  IG DGFG+A  
Sbjct: 130 VIGDNTQIYPHTFVGDGVKIGDNCLLYSNVNIYHDCRIGNECILHSGAVIGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
            +   KI  IG VI++DKV+IGAN+ +DR T+  TI+    KIDN VQI HN  IG   +
Sbjct: 190 PNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATIVHSGAKIDNLVQIAHNDEIGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAGST IG+  + GGQ GIAG++KIGD V + ++SGV  DI +G Q  G P   
Sbjct: 250 MAAQVGIAGSTKIGEWCMFGGQVGIAGHIKIGDKVGLGAQSGVPGDIKSGSQLIGTPPMD 309

Query: 327 IGEYLR 332
             +Y +
Sbjct: 310 PKQYFK 315


>gi|237741396|ref|ZP_04571877.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 4_1_13]
 gi|229430928|gb|EEO41140.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 4_1_13]
          Length = 332

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 165/307 (53%), Gaps = 16/307 (5%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P V 
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPRV- 82

Query: 96  FAIAGSILYPQAMHMEASSF---EGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                  + P+ +H  + +    E      A +GE+V I   V I    V+   V+I   
Sbjct: 83  -------IMPKLLHFFSRTLKKIEKMREDTAKIGENVDIATNVYIGHDVVIGNNVKIFPN 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
             +G G++IG G  I  N SI     I     G + ++  G  IG+DGFG+ +   +  K
Sbjct: 136 VTIGEGAIIGDGTVIYSNVSIREFVEI-----GKNCVIQPGAVIGSDGFGFVKVNGNNTK 190

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVG
Sbjct: 191 IDQIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVG 250

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           IAGST IG+NV + GQ G+AG+L+IGDN  I ++SG+  ++ A +   G P     E ++
Sbjct: 251 IAGSTTIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGIAGNVEANKILSGHPLVDHREDMK 310

Query: 333 HMVMLSK 339
             V + K
Sbjct: 311 IRVAMKK 317


>gi|315179355|gb|ADT86269.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           furnissii NCTC 11218]
          Length = 344

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 112/322 (34%), Positives = 174/322 (54%), Gaps = 11/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA   G  L  ++  + ++  L+P+ RA  GDI+++ + K+  ++  CKA+ I+ 
Sbjct: 4   LTLAELATITGGELHGDS--QAVVRGLAPMDRAQEGDITFLSNPKYSKHLASCKATVIMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
                   P N   L+   P V+FA        QA+    +   GGI+P A + +D K+ 
Sbjct: 62  KATERELCPSN--ALVVADPYVAFA-----KVTQALDTTPAPASGGIAPSAVVADDAKLG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILH 191
           + V I   AV+  GVE+G    +G G  IG   +IG +  + A  SIY +++ G   ++ 
Sbjct: 115 ENVSIGANAVIESGVELGDHVIIGAGCFIGKNAKIGNHTKLWANVSIYHNVVLGEHCLVQ 174

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG+DGFGYA    +  KI  +G V I ++VEIGA + IDRG +DDT+I +N  +DN
Sbjct: 175 SSTVIGSDGFGYANERGEWIKIPQLGSVRIGNRVEIGACTTIDRGALDDTVIEDNVILDN 234

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNVHIG G  +     +AGST IG   +IGG   + G+++I D V I     V++
Sbjct: 235 QLQIAHNVHIGYGTAMAGGTIVAGSTTIGKYCIIGGASVLNGHIQIADGVTITGMGMVMR 294

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            I     Y  G+P +   E+ +
Sbjct: 295 SIEEKGMYSSGIPLQTNKEWRK 316


>gi|119371932|sp|Q6AJ06|LPXD_DESPS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
          Length = 345

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 179/331 (54%), Gaps = 12/331 (3%)

Query: 11  KGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + I +  LA+ +   ++ +  GE ++ +   +  A  GDI++++     + +   KA A+
Sbjct: 3   ENITVAMLAELVDGEVIGD--GEVLVGNFVSLETAGEGDITFLVKAGDQDLLTSTKAGAV 60

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
           I  + +    P  +  +  D   ++ A   + L       E      GI   AF+GE  +
Sbjct: 61  IVHRKVEVESPATL--IKVDDAYLAAAKIHTFLLEDEFSPE------GIHRSAFVGEGCQ 112

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVI 189
           I   V I  +  +   V IG +T +  G  IG  V IG +C + A  +I   S +GN V 
Sbjct: 113 ISSEVTIKALVSIGNRVVIGPRTRIESGVAIGDDVTIGEDCLLKANVTIADGSQLGNGVT 172

Query: 190 LHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           +HSG  IG+DG+GYA      H K   +G V + D VEIGANS +DR T   T I    K
Sbjct: 173 IHSGTVIGSDGYGYATDKMGFHYKRPQVGTVRVDDNVEIGANSCVDRATYGLTWIKSGAK 232

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQI HNV +G   +IVSQVGI+GST +G NV++GG+    G+L+IGD V IA  SG
Sbjct: 233 IDNLVQIAHNVVVGENSLIVSQVGISGSTSLGRNVVMGGKAAAVGHLQIGDGVMIAGGSG 292

Query: 309 VLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           VL ++ AG   GG+PARPI ++ + +V+ +K
Sbjct: 293 VLSNLSAGAVVGGIPARPIKQWRKSVVLTTK 323


>gi|317153113|ref|YP_004121161.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943364|gb|ADU62415.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 348

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 177/328 (53%), Gaps = 27/328 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LA+ +G   LD    +  I  ++ + +A   D+S++++ K+   ++  +A  ++ 
Sbjct: 3   IKLSALAEKLG---LDHTGDDMEISGVNTLEKAGPEDLSFLVNPKYAQLLDTTRAGCVLT 59

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY-PQAMHMEASSFEGGISPQAFLGEDVKI 131
           S    P+  +    L+S    +  A   +I   PQ           G+S  A++  + ++
Sbjct: 60  SG---PYADRVGRALVSSNVYMDLAKVVNIFAKPQGCLQ-------GVSELAYVHPEARV 109

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-------SSLI 184
           +D       A VYP   IG +  VG  SV+  G  +G + +IGA   +Y       S  I
Sbjct: 110 DD------TATVYPFAFIGARAVVGARSVVFPGCYVGEDSAIGADCLLYPNAVVMGSVTI 163

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G+ VIL  G  +G DGFG+A+      KI  IG VI+++ VEIG+N+AIDR  +D T IG
Sbjct: 164 GDKVILQPGAVLGGDGFGFAQTPFGHMKIPQIGTVIVEESVEIGSNTAIDRAALDTTRIG 223

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
             TKIDN VQIGHNV +G  C+I+ QVGI GST +G+NV++ GQ G+A   +IGD   IA
Sbjct: 224 RGTKIDNLVQIGHNVQVGEHCLIIGQVGIGGSTKVGNNVVLAGQVGVADNAEIGDGAMIA 283

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           ++SG+   I  G +  G P  P G +L+
Sbjct: 284 AQSGLAGKIEPGSRLAGTPVMPAGTFLK 311


>gi|218961666|ref|YP_001741441.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Candidatus Cloacamonas acidaminovorans]
 gi|167730323|emb|CAO81235.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Candidatus Cloacamonas acidaminovorans]
          Length = 349

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 115/288 (39%), Positives = 155/288 (53%), Gaps = 18/288 (6%)

Query: 44  RASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL 103
            A    I ++   K L  ++   A  II ++  +  +P+    LL  KP  S       L
Sbjct: 37  EADEQTIIFLEQEKLLEKVKASSAGLIITTEKFISELPER-ALLLVQKPYYSLMR----L 91

Query: 104 YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGA 163
               +  E   F   I P A + EDV+ E  V I    V      IG    +G G +IG 
Sbjct: 92  ISWWLEQENKDFIYAIQPTAIVAEDVRFEGEVAIGSNVV------IGSGCILGKGVIIGE 145

Query: 164 GVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHI 216
           G  +G+N S+GAG+ +Y ++       IG + ILHSGV IG DGFG+        KI  +
Sbjct: 146 GCSLGKNVSVGAGTKLYPNVCVYDDCVIGRNCILHSGVIIGADGFGFMLIEGIQQKIPQV 205

Query: 217 GRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS 276
           G V+I D VEIGANS IDR T+  TIIG  TKIDN VQ+GHN  IG   I+ +QVG+AGS
Sbjct: 206 GNVVIGDGVEIGANSCIDRATLGSTIIGNGTKIDNLVQVGHNCIIGEHSILCAQVGLAGS 265

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPA 324
           T +GD V + GQ GIA +L+IG+   + ++SGV  +IP   +Y G PA
Sbjct: 266 TVVGDYVYLAGQVGIADHLQIGNRAMVGAQSGVSTNIPDDGRYFGYPA 313


>gi|120436127|ref|YP_861813.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gramella forsetii KT0803]
 gi|166199087|sp|A0M2A1|LPXD_GRAFK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|117578277|emb|CAL66746.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gramella forsetii KT0803]
          Length = 341

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 118/332 (35%), Positives = 173/332 (52%), Gaps = 11/332 (3%)

Query: 16  MKLAQSIGASLLD---ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           MK   +  A +LD   E   E  +  L+ I   S G ++++ + K+ + +    AS  I 
Sbjct: 1   MKFTATQIAEILDGKVEGNPEAEVSELAKIEEGSEGSLTFLSNPKYTSFLYTTNASVTIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           + D     P N   +       +F+    + Y   + +  S    GI   + + E  K  
Sbjct: 61  NDDFEVEQPVNTTLIKVKDAYKAFSTL--LEYYNQIKLNKS----GIEQPSHISESAKYG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
           +G+ +   A +   V IG    + P   IG  V+IG N ++  G  +YS SLIG+ V +H
Sbjct: 115 EGLYLGAFAYIGENVSIGENVKIYPNVYIGDNVKIGNNVTLFPGVKVYSESLIGSEVTIH 174

Query: 192 SGVRIGNDGFGYARG-VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SGV IG DGFG++ G   +  K+  IG VII+D V+IGA + IDR T+  TII +  K+D
Sbjct: 175 SGVVIGADGFGFSPGDTGEYSKVPQIGNVIIEDYVDIGAGTTIDRATLGSTIIRKGAKLD 234

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N +QI HNV IG    I +Q GIAGST IG N LIGGQ GIAG+L IG+ V+I ++SG+ 
Sbjct: 235 NHIQIAHNVEIGENTAIAAQTGIAGSTKIGKNCLIGGQVGIAGHLTIGNRVKIQAQSGIG 294

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           +DI   +   G PA    +Y +  +      K
Sbjct: 295 RDIKDDEMLQGSPAIGYSDYNKSYIHFKNLPK 326


>gi|322380936|ref|ZP_08055002.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter suis HS5]
 gi|321146608|gb|EFX41442.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Helicobacter suis HS5]
          Length = 338

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 121/330 (36%), Positives = 176/330 (53%), Gaps = 21/330 (6%)

Query: 27  LDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPC 86
           L  NF +  +  ++P+  A+   ISY+  + ++  ++  KA A+    +    +P     
Sbjct: 16  LPLNFKDFEVAGVAPLELATQQHISYVDQKSYVKKLKDTKAGAVFIRAEHANKVPSISQP 75

Query: 87  LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG 146
           L+ + P ++FA+            +A   E   +PQA      K+ +GV++ P  VV  G
Sbjct: 76  LIVENPHLAFALIS----------DAFKVEMFANPQA--KHIPKLGEGVILMPHVVVGEG 123

Query: 147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYAR 205
           VEIG  + +    VIG  V+IG +C I    +IY ++ IG+ V +H+   IG+DGFGYA 
Sbjct: 124 VEIGDHSVIMANVVIGDHVKIGAHCKIYPNVTIYQNTTIGDHVYIHANSVIGSDGFGYAH 183

Query: 206 GVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCG 264
                H KI H G V I + VEIGA++ IDR     T I E  KIDN VQ+GHN  +G  
Sbjct: 184 TKEGAHVKIEHTGCVRIDNWVEIGASTTIDRAVFGITHIKEGVKIDNLVQVGHNCVLGEH 243

Query: 265 CIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GGMP 323
            IIV+QVG++GST +G NV++GGQ G  G++ IG+  QI  K  V KD+P    Y G +P
Sbjct: 244 SIIVAQVGLSGSTTMGRNVVLGGQVGTGGHMHIGEFSQIGGKGAVGKDLPPHTNYAGAIP 303

Query: 324 ARPIGEY------LRHMVMLSKPSKYKIKR 347
           A  I E+      LR  V   KPS  +  R
Sbjct: 304 AMEIHEWHHFLATLRRFVKGQKPSLLEKAR 333


>gi|312898383|ref|ZP_07757773.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Megasphaera micronuciformis F0359]
 gi|310620302|gb|EFQ03872.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Megasphaera micronuciformis F0359]
          Length = 340

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 181/334 (54%), Gaps = 27/334 (8%)

Query: 14  ALMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
            + +LAQ +G +++ DEN   R I     +A A + DIS+ +   +   + +  A A+I 
Sbjct: 4   TVKELAQFLGGTVIGDEN---REISDFKGLAEAGSDDISFAV-EPYTEYLPQVHAGAVIT 59

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            ++   +   +   +L + P ++F+    + +P+       S + GI P A + E   I 
Sbjct: 60  EKE---YPAGDNTLVLVENPRLAFSKLLELFHPR------QSVKQGIHPTAVVDESATIG 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-------SSLIG 185
           +   +   AV      IG+   +G GSVI   V IG N +IGA ++IY       ++++G
Sbjct: 111 ENTAVMAYAV------IGKNVRIGAGSVIYPYVFIGDNVTIGANAAIYPGAVIMENTVMG 164

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           ++ ++ +   IG +GFG+A       +I  IG V I D VEIGA + ID GT+  T +G 
Sbjct: 165 DNAVIRAHAVIGGEGFGFATKDGKHTRIPQIGNVTIGDDVEIGACTTIDNGTLGSTKVGR 224

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN V +GHNV IG  C +++Q GIAGST +G++V+  GQ G  G++ IGDNV  A 
Sbjct: 225 GTKIDNLVHLGHNVEIGEDCFVIAQTGIAGSTKVGNHVIFAGQTGCTGHITIGDNVTFAG 284

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           KSG++ ++ +     G PARP  E+ R  V + K
Sbjct: 285 KSGIVGNVASNTVNAGFPARPHIEWSRTQVYIKK 318


>gi|333029891|ref|ZP_08457952.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bacteroides coprosuis DSM 18011]
 gi|332740488|gb|EGJ70970.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bacteroides coprosuis DSM 18011]
          Length = 345

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 171/313 (54%), Gaps = 10/313 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I    +G IS++ + K+ + I   ++S ++ ++D  P  P +   +
Sbjct: 19  DEN---ATVHTFAKIEEGVSGAISFLSNPKYTHYIYNTQSSIVLVNKDFKPEKPISATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A    +L    ++  +   + GI   A +    KI   V IAP  V+    
Sbjct: 76  KVDNAYDSLA---KLL---TLYEASKPKKTGIDSLASIAHTAKIGKNVYIAPYVVIGENA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARG 206
            +G  + + P + +G   +IG N ++ +  +IY   +IGN+ ILHSGV +G DGFG+A  
Sbjct: 130 VVGDNSAIYPHTYVGDNAKIGANTTLYSNVNIYHECIIGNNCILHSGVVVGADGFGFAPT 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  II+D VEIGAN+ IDR T+  TII +  K+DN +QI HN  +G   +
Sbjct: 190 AEGYEKIPQIGIAIIEDNVEIGANTCIDRATMGATIIRKGVKLDNLIQIAHNDEVGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           I +Q G+AGST IG   +IGGQ G+AG+ KIGD V IA++SG+  +I +G Q  G PA  
Sbjct: 250 IAAQAGVAGSTKIGQWCMIGGQAGLAGHAKIGDKVGIAAQSGIPGNIKSGNQVMGSPAFE 309

Query: 327 IGEYLRHMVMLSK 339
             +Y +   +  K
Sbjct: 310 ARQYFKAASVFKK 322


>gi|257468585|ref|ZP_05632679.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium ulcerans ATCC 49185]
 gi|317062842|ref|ZP_07927327.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium ulcerans ATCC 49185]
 gi|313688518|gb|EFS25353.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium ulcerans ATCC 49185]
          Length = 336

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 115/311 (36%), Positives = 166/311 (53%), Gaps = 24/311 (7%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I  L+P  +A    +++    KFL  + + +A  II     +P +P+NI  +     E  
Sbjct: 25  ISGLAPFFQAQEDSLTFASDEKFLKKLHETRAKVIIVPD--IP-LPENIGKIYLKVKENP 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
             +   +L       E   FE  I   + +G++V++             P V IG  T +
Sbjct: 82  RTLMPKLL--NFFKRETRPFEKMIEDSSKIGKNVRL------------APNVYIGHDTVI 127

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSS-------LIGNSVILHSGVRIGNDGFGYARGVS 208
           G   VI   V IG   +IG G+ IYS+       +IG   ++  G  IG+DGFG+ +   
Sbjct: 128 GDNVVIHPNVTIGEGVTIGEGTVIYSNATIREFCIIGKKCVIQPGAVIGSDGFGFIKING 187

Query: 209 DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
           +  KI  IG V+++D+VEIGAN+ +DRGTI +T+I + TKIDN VQI HN  IG  C+++
Sbjct: 188 NNTKIDQIGHVVLEDEVEIGANTTVDRGTIGNTVIKKFTKIDNLVQIAHNDIIGENCLLI 247

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
           SQVGIAGS  +GDN  + GQ G+AG+LKIG NV IA+KSGV  ++   Q   G P     
Sbjct: 248 SQVGIAGSVEVGDNTTLAGQVGVAGHLKIGSNVVIAAKSGVSGNVADNQMLSGYPLMDHK 307

Query: 329 EYLRHMVMLSK 339
           E L+  V   K
Sbjct: 308 EDLKVRVSWKK 318


>gi|72382035|ref|YP_291390.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prochlorococcus marinus str. NATL2A]
 gi|119371953|sp|Q46LE1|LPXD_PROMT RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|72001885|gb|AAZ57687.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prochlorococcus marinus str. NATL2A]
          Length = 350

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 176/306 (57%), Gaps = 14/306 (4%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNN---IEKCKASAIICSQD---IVPFIPK-NIPCL 87
           +I + + +  A   DIS++ +   LN    IE  KASA++   +   I+    K ++  +
Sbjct: 27  VILTAASLENAKDNDISFLDNNSPLNLRNLIETSKASALLLPANDTYIIEIAKKISVDWI 86

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
           +  +P+++FA     LYP  +  E      GI   A +G++VKI  GV I   A +    
Sbjct: 87  ILKEPKIAFAETLEFLYPSNVESE------GIHKSAVIGQNVKIGLGVSIGANAYIGDNT 140

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARG 206
           EIG  T +  G V+   VRIG    I A S I+S S +G+  ++++   IG +GFG+   
Sbjct: 141 EIGAGTIIHAGVVLYRNVRIGSKNLIHANSVIHSGSKLGDKCVINANAVIGGEGFGFVPT 200

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
            +   K+  +G VI+++KVE+G+ S IDR ++ +TIIGE+TKIDN VQIGH V  G GC 
Sbjct: 201 SNGWKKMPQVGIVILKNKVEVGSGSTIDRPSVGETIIGEDTKIDNLVQIGHGVTTGKGCA 260

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + +QVGIAG   IGD V++ GQ GI+  +KIGD V  +SK+G++ +I AG    G PA P
Sbjct: 261 MAAQVGIAGGAQIGDGVILAGQVGISNRVKIGDGVIASSKTGIVSNIEAGTVVSGFPAIP 320

Query: 327 IGEYLR 332
              +LR
Sbjct: 321 NKLWLR 326


>gi|294784155|ref|ZP_06749456.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_27]
 gi|294488225|gb|EFG35570.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_27]
          Length = 332

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 165/307 (53%), Gaps = 16/307 (5%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P V 
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPRV- 82

Query: 96  FAIAGSILYPQAMHMEASSF---EGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                  + P+ +H  + +    E      A +GE+V I   V I    V+   V+I   
Sbjct: 83  -------IMPKLLHFFSRTLKKIEKMREDTAKIGENVDIAPNVYIGHDVVIGNNVKIFPN 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
             +G G++IG G  I  N SI     I     G + ++  G  IG+DGFG+ +   +  K
Sbjct: 136 VTIGEGAIIGDGTVIYSNVSIREFVEI-----GKNCVIQPGAVIGSDGFGFVKVNGNNTK 190

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVG
Sbjct: 191 IDQIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVG 250

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           IAGST IG+NV + GQ G+AG+L+IGDN  I ++SGV  ++ A +   G P     E ++
Sbjct: 251 IAGSTTIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGVPGNVEANKILSGHPLVDHREDMK 310

Query: 333 HMVMLSK 339
             V + K
Sbjct: 311 IRVAMKK 317


>gi|91202218|emb|CAJ75278.1| similar to UDP-N-acetylglucosamine acyltransferase LpxA [Candidatus
           Kuenenia stuttgartiensis]
          Length = 324

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 174/312 (55%), Gaps = 11/312 (3%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           MI  +  I  A+ G I+++ + K++  +   KASA+I S  ++    KN+  L+ + P +
Sbjct: 1   MINGIMGIDEATEGHITFVANEKYIKKMNHTKASAVIVSPKLINA-KKNL--LVCNNPYL 57

Query: 95  SFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKT 153
           +FA I   +++ + ++++       I+  A +G+DV I+  V I   A       IG + 
Sbjct: 58  AFARIVELLMFKKPVYVKGIDSATSIANTAKIGKDVSIQAYVTIGENAC------IGDRV 111

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
            V PG  IG    IG +  + A   IY  ++IG  V +HS   IG+ GFGYA      +K
Sbjct: 112 VVFPGVFIGENCTIGDDAVLHANVVIYPDTVIGRRVTIHSNTVIGSSGFGYAPDGQSYYK 171

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I   G  +I+D V+IGAN+ I+R T+  TII   TKID+QV I HNV IG   +IVSQVG
Sbjct: 172 IPQAGNTVIEDDVDIGANTTINRATLGQTIIRRGTKIDSQVVISHNVEIGEDSVIVSQVG 231

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
           IAG+  IG +V + G  GI G++ +GDNV +   SGV +D+P    Y G PA PI +  R
Sbjct: 232 IAGTAKIGKHVTLAGGVGIIGHITVGDNVTVGGHSGVAQDLPGNGTYLGTPALPIQKMRR 291

Query: 333 HMVMLSKPSKYK 344
             V++ K  + K
Sbjct: 292 CYVIIEKLPEMK 303


>gi|89890680|ref|ZP_01202189.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Flavobacteria bacterium BBFL7]
 gi|89516825|gb|EAS19483.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Flavobacteria bacterium BBFL7]
          Length = 339

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 118/317 (37%), Positives = 174/317 (54%), Gaps = 10/317 (3%)

Query: 29  ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLL 88
           E   E  +  LS I     G IS++ + K+   I    ASA+I + D VP   +++   L
Sbjct: 17  EGDSEMQVSKLSKIEEGEVGSISFLSNSKYTPYIYTTNASAVIVNADFVP--DQDVTTTL 74

Query: 89  SDKPEVSFAIAGSIL-YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             K E S++    +L Y Q + +     + GI   +++ E V   DG+ +A  A V   V
Sbjct: 75  I-KVEDSYSAFTKLLEYYQMIKLN----KNGIEQPSYMHESVVNGDGLYLAAFAYVSQNV 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARG 206
           ++G    +     I   V IG NC I +G+ I S ++IG++V +H+G  +G DGFG++  
Sbjct: 130 KLGENVKIFSQVHISDNVTIGDNCVIHSGAKIMSDTIIGDNVTIHAGAVVGADGFGFSPN 189

Query: 207 VSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
               + KI   G VII+D V+IGA + IDR T+  TII +  K+DNQ+QIGHNV IG   
Sbjct: 190 SDGTYNKIPQTGIVIIEDNVDIGALTTIDRATLGATIIKKGAKLDNQIQIGHNVEIGENT 249

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR 325
           +I +Q G+AGS+ +G N  IGGQ GI+G+L IGDNV I ++SGV ++I       G PA 
Sbjct: 250 VIAAQTGVAGSSKVGKNCRIGGQVGISGHLTIGDNVGIQAQSGVGRNIKDNMVIQGSPAF 309

Query: 326 PIGEYLRHMVMLSKPSK 342
             G++ R  V      K
Sbjct: 310 DYGDWNRSYVYFKNLKK 326


>gi|157803197|ref|YP_001491746.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia canadensis str. McKiel]
 gi|166199101|sp|A8EX78|LPXD_RICCK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|157784460|gb|ABV72961.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsia canadensis str. McKiel]
          Length = 342

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 181/331 (54%), Gaps = 35/331 (10%)

Query: 31  FGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNI-----P 85
           + + +I+ +  +  AS  DIS++ + K+   ++   A+A I        +PKN      P
Sbjct: 32  YEDIVIHDIKILQEASRNDISFLSNTKYSEFLKTTNAAACI--------VPKNFKGEVNP 83

Query: 86  CLLSDKPEVSFAIAGSIL---------YP-QAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
             +    E S+   G ++         YP + M     +    I    ++G +V IED V
Sbjct: 84  NTILIHAENSYFAYGKLIDFFYAPIKSYPAKIMKSAIVAASAIIGKNCYIGHNVVIEDDV 143

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVR 195
           +I            G  + +  GS IG GV +GRN  I    SI  ++IG+ V++ +G +
Sbjct: 144 II------------GDNSIIEAGSFIGRGVNLGRNARIEQHVSINYAIIGDDVVILTGAK 191

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG++      H+I H G V I + V+IGAN+ IDRG++ DTII +   IDN VQI
Sbjct: 192 IGQDGFGFSTEKGVHHQIFHTGIVKIGNNVKIGANTTIDRGSLQDTIIEDLCCIDNLVQI 251

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
           GH V IG G II++QVGIAGS+ IG    +GGQ GIAG+L IGD VQ+A++SGV ++I A
Sbjct: 252 GHGVKIGKGSIIIAQVGIAGSSTIGKYCALGGQVGIAGHLNIGDQVQVAAQSGVAQNIEA 311

Query: 316 GQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           G+  GG PA  I  + R  +++ +  K + K
Sbjct: 312 GKIVGGSPAVHIMNWHRQSIIMKQLIKKRPK 342


>gi|302392928|ref|YP_003828748.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acetohalobium arabaticum DSM 5501]
 gi|302205005|gb|ADL13683.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acetohalobium arabaticum DSM 5501]
          Length = 343

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/321 (33%), Positives = 168/321 (52%), Gaps = 13/321 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA+ +   ++ E   E +I  +  +   + G+I++  S ++L   E   A+A+I 
Sbjct: 3   VPLKELAELVDGEIIGEV--ELIISGVGGVENVAKGEITFAQSDEYLTKAESSLAAAVIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           + +I      +   L  D P ++FA       P+            I   A + +DV+  
Sbjct: 61  ADEI----ESDKTLLKVDNPRLAFAKIAHEFEPELYKTNE------IHSTAVIADDVECG 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILH 191
             V I P   +  GV IG    +  G+ IG+ V+IG    I     I + + +GN VI+H
Sbjct: 111 SNVSIGPQVTIESGVSIGDNVRIAAGAHIGSQVKIGAETIIHPNVVIMHQTEVGNRVIIH 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
            G  IG+DG+G+       +K+  +G VII+D VE+GAN  IDRGT   T+IG  TK DN
Sbjct: 171 PGAVIGSDGYGFETTSEGHYKVPQLGNVIIEDDVELGANVTIDRGTTGSTVIGRGTKTDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            V I HNV I   C++V+QVGIAGS  IG+ V + G+ G+ G+L++G N  +A++S +  
Sbjct: 231 LVHIAHNVRIAADCLLVAQVGIAGSAEIGEGVTLAGKAGVVGHLEVGANTTVAAQSIITN 290

Query: 312 DIPAGQQYGGMPARPIGEYLR 332
           D+P    Y G PAR     +R
Sbjct: 291 DVPPDSFYSGYPAREHKSEMR 311


>gi|218263806|ref|ZP_03477782.1| hypothetical protein PRABACTJOHN_03472 [Parabacteroides johnsonii
           DSM 18315]
 gi|218222479|gb|EEC95129.1| hypothetical protein PRABACTJOHN_03472 [Parabacteroides johnsonii
           DSM 18315]
          Length = 354

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 173/314 (55%), Gaps = 8/314 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  + + S I     G ++++ + K+ + I K +AS ++ + D  P  P     +     
Sbjct: 21  EVKVNNFSKIEEGKPGTLTFLANPKYEHFIYKTEASIVLVNNDFTPAEPVKATLVKVANA 80

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
             S AI  +++       +A++ + GI   AF+     + +G  +   A +   V+IG+ 
Sbjct: 81  YASLAILLNMVE------QANAKKAGIDATAFIAGSATVGEGCYVGNFAYIGEDVKIGKN 134

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           + + P + IG  V IG NC+I   ++IY+  +IGN+ ILH+G  IG+DGFG+A    +  
Sbjct: 135 SRIYPHAYIGDHVTIGDNCTIYPHATIYNGCVIGNNCILHAGSVIGSDGFGFAPEGDNYK 194

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  +G V+++D VEIGAN+ IDR  +D TII    K+DN VQI HNV +G   ++ +QV
Sbjct: 195 KIPQLGNVVLEDDVEIGANTTIDRAVMDSTIIRRGVKLDNLVQIAHNVEVGENTVMAAQV 254

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GIAGS  IG + + GGQ G++G++ + D+V   ++ GV+ D+       G PA     ++
Sbjct: 255 GIAGSVKIGSHCMFGGQAGLSGHIHVADHVVFGAQCGVISDVKEPTTLLGAPAINAKAFM 314

Query: 332 RHMVMLSK-PSKYK 344
           R   + ++ P  Y+
Sbjct: 315 RSSAIFNRLPDMYR 328


>gi|150025059|ref|YP_001295885.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Flavobacterium psychrophilum JIP02/86]
 gi|149771600|emb|CAL43072.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Flavobacterium psychrophilum JIP02/86]
          Length = 339

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 177/332 (53%), Gaps = 11/332 (3%)

Query: 16  MKL-AQSIGASLLDENFG--ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           MK  A+ I   L  E FG  +  ++ LS I   + G ++++ + K+ N I   KAS +I 
Sbjct: 1   MKFTAEQIAEILEGEIFGNPKATVFKLSKIEEGTEGCLTFLANSKYTNYIYDTKASIVIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           ++    F+P N       K E ++     +L     + +  + + GI     + +  K  
Sbjct: 61  NR---TFVPDNEISTTLIKVEDAYKSFAKLL---EFYNQVKNNKTGIEAPCVIAQSAKYG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
               +   + +   V IG    + P S IG  V+IG N  I AG+ I S ++IGN+  ++
Sbjct: 115 TDFYLGSFSYIGENVIIGDHVKIYPNSFIGDNVQIGNNTIIFAGAKILSETVIGNNCNIY 174

Query: 192 SGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  IG DGFG+A        KI  IG V+I+D V+IGA + IDR T+  TII +  K+D
Sbjct: 175 SGTTIGADGFGFAPNPDGTFSKIPQIGNVVIEDNVDIGACTTIDRATLGSTIIRKGVKLD 234

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           NQ+QI HNV IG   +I +Q GIAGST IG N +IGGQ GIAG+L IG+NV+I ++SGV 
Sbjct: 235 NQIQIAHNVEIGENTVIAAQTGIAGSTKIGKNCMIGGQVGIAGHLTIGNNVKIQAQSGVG 294

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           K+I   +   G P+    EY +  V      K
Sbjct: 295 KNIKDKETLQGSPSFGYSEYSKSYVHFKNLPK 326


>gi|260495592|ref|ZP_05815717.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_33]
 gi|260196934|gb|EEW94456.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_33]
          Length = 320

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 12/305 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +  I      ++ D P   
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLAQTKAKVIIVPDIDLSLIEGKGYIVVKDSPR-- 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
                 I+ P+ +H  + + +     +    +  KI D V IAP   +   V IG    +
Sbjct: 82  ------IIMPKLLHFFSRTLK---KIEKMREDTAKIGDNVDIAPNVYIGHDVVIGNNVKI 132

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   IG GV IG    I +  SI   + IG + ++  G  IG+DGFG+ +   +  KI 
Sbjct: 133 FPNVTIGEGVIIGEGTVIYSNVSIREFVEIGKNCVIQPGAVIGSDGFGFVKVNGNNTKID 192

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG VI++D+VEIGAN+ IDRG I DT+I + TKIDN VQI HN  IG  C+I+SQVGIA
Sbjct: 193 QIGTVIVEDEVEIGANTTIDRGAIGDTVIKKYTKIDNLVQIAHNDIIGENCLIISQVGIA 252

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST IG+NV + GQ G+AG+L+IGDN  I ++SG+  ++ A +   G P     E ++  
Sbjct: 253 GSTIIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGIAGNVKANKILSGHPLVDHREDMKIR 312

Query: 335 VMLSK 339
           V + K
Sbjct: 313 VAMKK 317


>gi|257126520|ref|YP_003164634.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Leptotrichia buccalis C-1013-b]
 gi|257050459|gb|ACV39643.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Leptotrichia buccalis C-1013-b]
          Length = 333

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 166/309 (53%), Gaps = 26/309 (8%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPC-----LLSDKPE 93
           L+P   ++  ++++    K L NI KC A A+I     VP +P N+P      ++ + P 
Sbjct: 26  LAPFFHSNEKELTFAADEKMLKNIGKCNAGAVI-----VPDLP-NLPAEKTFIVVKNNPR 79

Query: 94  VSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG--VEIGR 151
               I  +   P+        FE  I   A      KI+    ++ +   Y G  V+IG+
Sbjct: 80  ELMPILLNYFKPKL-----KPFENQIENSA------KIDKTANVSKINT-YIGHNVKIGK 127

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDI 210
              V P   I  G  IG NC I +  +I   S IG   IL  G  IG DGFG+ +   + 
Sbjct: 128 NVVVYPNVSIFEGTEIGDNCIIYSNVTIREFSKIGRGSILQPGAVIGADGFGFVKVNGNN 187

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  IG VI+ ++VEIGANS +DRG I DTI+ + TKIDN V I HN  IG  C+IV+Q
Sbjct: 188 VKIEQIGHVILGEEVEIGANSCVDRGAIGDTIVKKGTKIDNLVHIAHNDIIGENCLIVAQ 247

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GI+GS  +GDN  + GQ G+AG+LKIG NV IA+KSGV  D+P G+Q  G P R   E 
Sbjct: 248 TGISGSVEVGDNSTLAGQVGVAGHLKIGSNVVIAAKSGVTNDVPDGKQMSGYPLREHMED 307

Query: 331 LRHMVMLSK 339
           LR  + + K
Sbjct: 308 LRVKMAMGK 316


>gi|224372842|ref|YP_002607214.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nautilia profundicola AmH]
 gi|223588621|gb|ACM92357.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nautilia profundicola AmH]
          Length = 324

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 184/340 (54%), Gaps = 34/340 (10%)

Query: 8   VSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKA 67
           +++K   L ++ Q +   L  +N  E  I  ++ +  A+  +IS++ + K+   ++  KA
Sbjct: 6   INNKTFTLKEICQYL--ELDCDNDAE--IQGINTLHDANENEISFLENPKYEKFLKNTKA 61

Query: 68  SAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGE 127
            A++  ++    +P+ +  L++D+P +  AI   +            +E G         
Sbjct: 62  KAVLIRKEDADKLPEGVIPLITDEPYLKLAILTKLFV-------KDPWEDG--------- 105

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVG------PGSVIGAGVRIGRNCSIGAGSSIY- 180
                 G  IA  A V+P V+IG+   +G      PG VIG  V IG NC I    ++Y 
Sbjct: 106 ------GYQIAFSAKVHPSVQIGKGARIGKNSVIMPGCVIGPDVEIGDNCVIYPNVTVYR 159

Query: 181 SSLIGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTID 239
            + IGN+V +H+G  IG+DGFGYA      H KI H+G V I+D VEIGAN+ IDRG   
Sbjct: 160 DTQIGNNVKIHAGSVIGSDGFGYAHTKDGRHIKIYHLGFVEIEDDVEIGANTTIDRGVFG 219

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            T+I + T IDN VQI HN  +G G I+VSQVG+AGST +G +V++GGQ   AG+L++  
Sbjct: 220 KTVIKKGTIIDNLVQIAHNCEVGEGSILVSQVGLAGSTKLGHHVVMGGQSATAGHLEVAP 279

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
              IA++ GV K I     Y G P  P  ++L+   +L++
Sbjct: 280 MTTIAARGGVSKSIKKPGVYSGFPLMPHKQWLKLQGLLNR 319


>gi|256846568|ref|ZP_05552025.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_36A2]
 gi|256718337|gb|EEU31893.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium sp. 3_1_36A2]
          Length = 332

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 113/305 (37%), Positives = 164/305 (53%), Gaps = 12/305 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P V 
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPRV- 82

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
                  + P+ +H  + + +     +    +  KI + V IAP   +   V IG    +
Sbjct: 83  -------IMPKLLHFFSRTLK---KIEKMREDTAKIGENVDIAPNVYMGHDVVIGNNVKI 132

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   IG G  IG    I +  SI   + IG + ++  G  IG+DGFG+ +   +  KI 
Sbjct: 133 FPNVTIGEGAIIGDGTVIYSNVSIREFVEIGKNCVIQPGAVIGSDGFGFVKVNGNNTKID 192

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVGIA
Sbjct: 193 QIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVGIA 252

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST IG+NV + GQ G+AG+L+IGDN  I ++SG+  ++ A +   G P     E ++  
Sbjct: 253 GSTTIGNNVTLAGQVGVAGHLEIGDNTMIGAQSGIAGNVEANKILSGHPLVDHREDMKIR 312

Query: 335 VMLSK 339
           V + K
Sbjct: 313 VAMKK 317


>gi|302343537|ref|YP_003808066.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfarculus baarsii DSM 2075]
 gi|301640150|gb|ADK85472.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfarculus baarsii DSM 2075]
          Length = 346

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 112/330 (33%), Positives = 181/330 (54%), Gaps = 21/330 (6%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           ++L +LA+ +G SL  +   +R++  ++ I  A   +++++ + K+   +  C+A  ++ 
Sbjct: 3   LSLAQLAELVGGSL--DGPADRVVSGINGIQEAGHDELTFLANPKYAPALAGCRAGVVLV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFA----IAGSILY-PQAMHMEASSFEGGISPQAFLGE 127
             D    +P  +  +  D P ++FA    +A    Y P  +H  A      ++P A LG 
Sbjct: 61  RPD--QDVPPGLAVIRVDDPYLAFAKILTVATQKPYQPMGVHPRAE-----VAPSAQLGL 113

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGN 186
           DV +        +A V     IG ++ + PG  +G G R+G +  I    +I +  L+GN
Sbjct: 114 DVSVH------ALAYVGENARIGDRSVIHPGVYVGEGARVGDDTVIHPNVTIGHGCLVGN 167

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
             I+HSG  IG DG+G+        KI  +G V I D VEIGA + IDR  +  T I   
Sbjct: 168 RCIIHSGTVIGADGYGFVPTADGHFKIPQVGVVQIDDDVEIGAGNTIDRAALGRTWIQRG 227

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
            K DN V + HN  IG   ++V+QVG++GST +G NV++GGQ G+AG+L IGD+V+IA+K
Sbjct: 228 VKTDNMVHVAHNCVIGENTLLVAQVGVSGSTTVGKNVIMGGQTGVAGHLTIGDDVKIAAK 287

Query: 307 SGVLKDIPAGQQYGGMPARPIGEYLRHMVM 336
           SGV  D+  G+   G+PA P   +LR++ +
Sbjct: 288 SGVHGDLKPGEIVAGIPAIPHRMWLRNVAV 317


>gi|94969372|ref|YP_591420.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Koribacter versatilis Ellin345]
 gi|119371431|sp|Q1IP54|LPXD2_ACIBL RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|94551422|gb|ABF41346.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Koribacter versatilis Ellin345]
          Length = 333

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 184/334 (55%), Gaps = 14/334 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L KLA+  G+SL+ ++     I S++ +  A+  D+ +    K+L +     A+AI+  +
Sbjct: 5   LQKLAELTGSSLIGDS--TLTICSVANLNHATPRDLVFCEDEKYLGDAFASPAAAIVVGE 62

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                     P L+S +P ++FA A  +L     H + S   G + P A +   V     
Sbjct: 63  FAASAHDAPKPLLISTQPRLAFAKAAKVLRS---HKKRSG--GIVHPTAVVPPTVVFGAE 117

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSG 193
           VV+    V+   V IG +  +G G  IG+ V+IG +C I +  +IY  + IGN VI+H+G
Sbjct: 118 VVVGAYVVLGEHVHIGDRVCIGAGVCIGSDVKIGTDCEIHSRVTIYHGTHIGNHVIIHAG 177

Query: 194 VRIGNDGFGYARG--VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
             +G+DGFGY R       H++  IG +I+ D V+IGAN  IDRG ++DT+IG  TK+DN
Sbjct: 178 AVLGSDGFGYVRDKLTGRYHQMPQIGHLIVGDHVDIGANVTIDRGGLEDTVIGAGTKLDN 237

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            V IGHNV IG   +I +Q GI+GS  IG   +IGGQ G+  +  + +   +  +SG+L 
Sbjct: 238 LVHIGHNVRIGENVVIAAQTGISGSCTIGAGSIIGGQVGMGDHATLEEGTILGGQSGILS 297

Query: 312 DIPAGQQYG---GMPARPIGEYLRHMVMLSKPSK 342
           +    ++ G   G PA+P+ +YLR    LS+ S+
Sbjct: 298 E-KIFREKGPCFGTPAKPLKQYLREQAALSRLSR 330


>gi|253582387|ref|ZP_04859610.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium varium ATCC 27725]
 gi|251835926|gb|EES64464.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium varium ATCC 27725]
          Length = 339

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 115/314 (36%), Positives = 168/314 (53%), Gaps = 30/314 (9%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I  L+P  +A    +++    KFL  + + +A  II     +P +P+NI      K  + 
Sbjct: 25  ISGLAPFFQAQEDSLTFASDEKFLKKLHETRAKVIIVPD--IP-LPENI-----GKTYLK 76

Query: 96  FAIAGSILYPQAMHM---EASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                  L P+ ++    +   FE  I   + +G++VK+             P V IG  
Sbjct: 77  VKENPRTLMPKLLNFFKRKTRPFEKMIEDSSKIGKNVKLA------------PNVYIGHD 124

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-------LIGNSVILHSGVRIGNDGFGYAR 205
           T +G   +I   V IG   +IG G+ IYS+       +IG   ++  G  IG+DGFG+ +
Sbjct: 125 TVIGDNVIIYPNVTIGEGVTIGEGTVIYSNATIREFCVIGKKCVIQPGAVIGSDGFGFIK 184

Query: 206 GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGC 265
              +  KI  IG V+++D+VEIGAN+ +DRGTI +T+I + TKIDN VQI HN  IG  C
Sbjct: 185 INGNNTKIEQIGHVVLEDEVEIGANTTVDRGTIGNTVIKKFTKIDNLVQIAHNDIIGENC 244

Query: 266 IIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR 325
           +++SQVGIAGS  +GDN  + GQ G+AG+LKIG NV IA+KSGV  ++   Q   G P  
Sbjct: 245 LLISQVGIAGSVEVGDNTTLAGQVGVAGHLKIGSNVVIAAKSGVSGNVADNQMLSGYPLM 304

Query: 326 PIGEYLRHMVMLSK 339
              E L+  V   K
Sbjct: 305 DHKEDLKVRVSWKK 318


>gi|329942831|ref|ZP_08291610.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila psittaci Cal10]
 gi|332287424|ref|YP_004422325.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila psittaci 6BC]
 gi|313848004|emb|CBY17001.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila psittaci RD1]
 gi|325506900|gb|ADZ18538.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila psittaci 6BC]
 gi|328815091|gb|EGF85080.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila psittaci Cal10]
 gi|328914672|gb|AEB55505.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila psittaci 6BC]
          Length = 360

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 174/317 (54%), Gaps = 11/317 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP---FIPKNIPCLLS 89
           E  I  +  I+ A    ++++ + K+   I+  +A AII S+        + KN   ++S
Sbjct: 25  ETPISGVEEISAAKAHHVTFLDNEKYARFIKITEAGAIILSKAQAQKYGHLNKNF-LIVS 83

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           + P ++F     +          S F G I P A +     I   V I P AV+     I
Sbjct: 84  EFPSIAFQKCIELFISPV----DSGFPG-IHPTAVIHPTASIGKDVCIEPYAVICQHACI 138

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVS 208
           G  TY+G GSVIGA   +G +C I     I   + +G  VI+  G  IG+ GFGY     
Sbjct: 139 GDSTYIGTGSVIGAYSTLGEHCLIHPRVVIRERVEMGKRVIVQPGAVIGSCGFGYITNAF 198

Query: 209 DIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             HK + H+G+VII+D VEIGAN+ IDRG   ++II E TKIDNQVQI H+V +G   +I
Sbjct: 199 GRHKHLKHLGKVIIEDDVEIGANTTIDRGRFKNSIIREGTKIDNQVQIAHHVEVGKHSMI 258

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K I +   YGG PARP 
Sbjct: 259 VAQAGIAGSTKIGNHVIIGGQTGITGHISITDHVIMMAQTGVTKSISSPGIYGGAPARPY 318

Query: 328 GEYLRHMVMLSKPSKYK 344
            E  R +  +    K +
Sbjct: 319 QEIHRQVAKIRSLPKLE 335


>gi|189461886|ref|ZP_03010671.1| hypothetical protein BACCOP_02552 [Bacteroides coprocola DSM 17136]
 gi|189431480|gb|EDV00465.1| hypothetical protein BACCOP_02552 [Bacteroides coprocola DSM 17136]
          Length = 346

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/330 (31%), Positives = 181/330 (54%), Gaps = 12/330 (3%)

Query: 17  KLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           ++A+ I  +++ DEN     +++ + I     G +S++ + K+ + I + ++S ++ ++D
Sbjct: 7   QIAEYIQGTIVGDEN---ATVHTFAKIEEGIPGALSFLSNPKYTHFIYETQSSIVLVNKD 63

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
              F P++       K E ++     ++    ++  +   + GI P A +    KI   V
Sbjct: 64  ---FTPEHEVKATLIKVENAYESLAKLM---TLYEMSKPKKTGIDPLASISPSAKIGQNV 117

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGV 194
            I P A +  G EIG  TY+ P   +GA  R+G N  +    ++Y    +GN+ I+H+G 
Sbjct: 118 YIGPFACIEDGAEIGDNTYIHPQVTVGAHARVGENSILYPQVTVYHDCRVGNNCIIHAGA 177

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
            IG DGFG+A       KI  IG  II+D VEIGAN+ +DR T+  T++ +  K+DN +Q
Sbjct: 178 VIGADGFGFAPSPEGYEKIPQIGITIIEDNVEIGANTCVDRATMGATVVHKGAKLDNLIQ 237

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           + HNV +G   ++ SQVG+AGS  IG+  + GGQ G+AG++K+GD+V + ++SG+  +  
Sbjct: 238 LAHNVEVGSHTVMASQVGVAGSAKIGEWCMFGGQVGVAGHIKVGDHVNVGAQSGIPGNTK 297

Query: 315 AGQQYGGMPARPIGEYLRHMVMLSK-PSKY 343
           +G    G PA    ++ R   +  K P  Y
Sbjct: 298 SGSTLMGYPAIEPKQFARSSAIFKKLPEMY 327


>gi|327399441|ref|YP_004340310.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Hippea
           maritima DSM 10411]
 gi|327182070|gb|AEA34251.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Hippea
           maritima DSM 10411]
          Length = 344

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 173/309 (55%), Gaps = 8/309 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  + S++PI  A   +++++ + K+   ++  +A  II   DI      ++  ++ D P
Sbjct: 19  EVKLNSVAPIETAKENELAFLSNPKYEKYLKTTQAGCIIVKPDIDIKEYPHLNFIICDNP 78

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            ++FA     +Y           +  I+ Q+++    +I+    +     +   V+IG+ 
Sbjct: 79  YLAFAKIIRFVYA------PKPPKPYIASQSYIDATAEIDKTARVEEFTYIGKNVKIGKH 132

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           T V P   +G    IG NC I    +I   ++IG++VI+ +G  IG+DGFGYA   +  H
Sbjct: 133 TRVMPFVYVGDNTTIGDNCLIYPHVTIREDTVIGDNVIIQAGAVIGSDGFGYATDENGNH 192

Query: 212 -KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  IG V+I+D VEIG+ + IDR  +  T+I + TKIDN VQI HNV +G   IIV+Q
Sbjct: 193 LKIPQIGNVVIEDDVEIGSGTTIDRAALQSTVIKKGTKIDNLVQIAHNVEVGENSIIVAQ 252

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GI+GST +G NV++ GQ GIAG+LKI DNV I +KSG+ K I     Y G+PA    ++
Sbjct: 253 TGISGSTKVGKNVILAGQTGIAGHLKIADNVIITAKSGIGKSISKPGAYSGIPAYEHSKW 312

Query: 331 LRHMVMLSK 339
           L++  +  K
Sbjct: 313 LKNSAVAPK 321


>gi|62185095|ref|YP_219880.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila abortus S26/3]
 gi|81312739|sp|Q5L612|LPXD_CHLAB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|62148162|emb|CAH63919.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydophila abortus S26/3]
          Length = 359

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 174/317 (54%), Gaps = 11/317 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP---FIPKNIPCLLS 89
           E  I  +  I+ A    ++++ + K+   I+  +A AII S+        + KN   ++S
Sbjct: 25  ETPISGVEEISAAKAHHVTFLDNEKYARFIKITEAGAIILSKAQAQKYGHLNKNF-LIVS 83

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           + P ++F     +          S F G I P A +     I   V I P AV+     I
Sbjct: 84  EFPSIAFQKCIELFISPV----DSGFPG-IHPTAVIHPTASIGKDVCIEPYAVICQHACI 138

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVS 208
           G  TY+G GSVIGA   +G +C +     +   + IG  VI+  G  IG+ GFGY     
Sbjct: 139 GDSTYIGTGSVIGAYSTLGEHCLVHPKVVVRERVEIGKRVIIQPGAVIGSCGFGYITNAF 198

Query: 209 DIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
             HK + H+G+VII+D VEIGAN+ IDRG   +++I E TKIDNQVQI H+V +G   +I
Sbjct: 199 GRHKHLKHLGKVIIEDDVEIGANTTIDRGRFKNSVIREGTKIDNQVQIAHHVEVGKHSMI 258

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
           V+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K I +   YGG PARP 
Sbjct: 259 VAQAGIAGSTKIGNHVIIGGQTGITGHISITDHVIMMAQTGVTKSISSPGIYGGAPARPY 318

Query: 328 GEYLRHMVMLSKPSKYK 344
            E  R +  +    K +
Sbjct: 319 QEIHRQVAKIRSLPKLE 335


>gi|217970570|ref|YP_002355804.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Thauera
           sp. MZ1T]
 gi|217507897|gb|ACK54908.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Thauera
           sp. MZ1T]
          Length = 344

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 116/335 (34%), Positives = 183/335 (54%), Gaps = 22/335 (6%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +L   +G  +  +  G+  +  +  + +A  GD++++ +RK+L+ + +C ASA+I + 
Sbjct: 4   LHELVDRLGGEIAGD--GDVAVSRVGTLDKAGEGDLAFLANRKYLSQVGECAASALIVTP 61

Query: 75  DIVPFIP-KNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           D+   +  +N+  +L+  P + FA    +  P        +   GI   A +   +    
Sbjct: 62  DLREALAGRNL--ILTADPYLYFARVAQLFNPP------PAARPGIHALAAVASTLPAS- 112

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHS 192
            V + P A +   V +G    +GP   +G G RIGR   + A  SIY   +IG   ILHS
Sbjct: 113 -VQVGPGASIEEDVVLGEDVVIGPNCHVGRGTRIGRGTRLYANVSIYHDCVIGEDCILHS 171

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           GV IG DGFG+AR  S    KI   GRV++ + VEIGAN+ +DRG +DDT+IG+  K+DN
Sbjct: 172 GVVIGADGFGFAREKSGAWVKIPQTGRVVLGNDVEIGANTTVDRGALDDTVIGDGVKLDN 231

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            +QI HNV +G   I+    G+AGS  IG   +IGGQ GI+G+L I D+V +++ + V K
Sbjct: 232 LIQIAHNVRVGEHTIMAGCAGVAGSARIGARCMIGGQAGISGHLSIADDVVVSAWTLVAK 291

Query: 312 DIPA-GQQYGGMPARPIGEY------LRHMVMLSK 339
            I   G   G +P +  G++      LRH+  L++
Sbjct: 292 SIAKPGVYTGNLPLQTHGDWVKNFSHLRHLDALAR 326


>gi|88812387|ref|ZP_01127637.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrococcus mobilis Nb-231]
 gi|88790394|gb|EAR21511.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Nitrococcus mobilis Nb-231]
          Length = 354

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 114/332 (34%), Positives = 171/332 (51%), Gaps = 14/332 (4%)

Query: 11  KGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
            G +L +LA+  GA L  E  G + I  ++ +  A +  +S++ + +    +    A A+
Sbjct: 5   NGASLAELARVTGARL--EGDGTKRILRVASLQDAGSDSLSFLATDRQRRYLTHTHAGAV 62

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE-GGISPQAFLGEDV 129
           I     +   P  +  L+ D P V+FA A       A H+  +S    GI P A++  + 
Sbjct: 63  ILRPQDLAMAP--VAALVCDDPHVAFARA-------AQHLTGASRPLAGIHPTAWVHPEA 113

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSV 188
            +E  V I P A +  GV + R+  V  G VIG  V IG +  + A  +IY +++IG  V
Sbjct: 114 LLEGRVSIGPHASIAAGVYLARRVSVAAGCVIGEAVEIGEDTRLMANVTIYPNTIIGRRV 173

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           +LHSG  +G+DGFGYA       K+  +GRVII D VEIGAN+A+DRG + DT+I E  K
Sbjct: 174 VLHSGAVLGSDGFGYANDAGCWIKVPQLGRVIIGDDVEIGANTAVDRGALGDTVIEEGVK 233

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDN VQI HN  +G    +     ++GST +G    I G  G+AG+L I D  Q+   + 
Sbjct: 234 IDNLVQIAHNARVGAHTAMAGCSAVSGSTRVGKYCSIAGGAGLAGHLHICDRTQVTGMTM 293

Query: 309 VLKDI-PAGQQYGGMPARPIGEYLRHMVMLSK 339
           +  DI   G    G    P   + R+ V  ++
Sbjct: 294 ITHDIREPGSYSSGTQMAPTRRWRRNAVRFNR 325


>gi|56478861|ref|YP_160450.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aromatoleum aromaticum EbN1]
 gi|81598543|sp|Q5NZG5|LPXD_AZOSE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|56314904|emb|CAI09549.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (FirA
           protein) (EC 2.3.1.-) [Aromatoleum aromaticum EbN1]
          Length = 336

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 120/330 (36%), Positives = 178/330 (53%), Gaps = 23/330 (6%)

Query: 15  LMKLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII-- 71
           L +L + +G  LL D     R + +L    +A  GD++++ + K+ + +  C ASA+I  
Sbjct: 4   LDELVERLGGELLGDPATAVRRVATLE---QAGEGDLAFLANPKYQSRLAACGASAVILA 60

Query: 72  -CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
             ++D+       +P +++  P + FA    +  P        +F  G+ P A +   V 
Sbjct: 61  PAARDLT-----GLPRIVTADPYIYFARVAQLFNPP------EAFVPGVHPAASVASPVP 109

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVI 189
               V IA  A +   VE+G    +GPG  IG G RIG    + A  +IY   ++G   I
Sbjct: 110 AS--VTIAAGASIDVDVELGEHVVIGPGCRIGRGARIGAGSRLNANVTIYHDCVLGRDCI 167

Query: 190 LHSGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           +H+G  IG DGFG+AR       KI  +GRV+I D VEIGAN+ IDRG +DDT+I    K
Sbjct: 168 VHAGAVIGADGFGFARERDGSWVKIPQVGRVVIGDDVEIGANTTIDRGALDDTVISGGVK 227

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DNQ+QIGHNV IG    I   VGIAGST IG   +IGGQ GI G+L+I D+V +++ + 
Sbjct: 228 LDNQIQIGHNVRIGAHTAIAGCVGIAGSTTIGARCMIGGQAGIIGHLEIVDDVVVSAGTL 287

Query: 309 VLKDI-PAGQQYGGMPARPIGEYLRHMVML 337
           V K I   G     +P +   E++++   L
Sbjct: 288 VTKSIRRPGVYTANLPVQGHAEWVKNFAHL 317


>gi|254422378|ref|ZP_05036096.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus sp. PCC 7335]
 gi|196189867|gb|EDX84831.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus sp. PCC 7335]
          Length = 351

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 173/321 (53%), Gaps = 14/321 (4%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFI-----PK 82
           D + GER +  L+ I  A    +SY+ S KF + +   +A A+I   D  P +      +
Sbjct: 22  DPSAGERTLTGLAAIEEAGADKLSYVESAKFASRLSTTQAGALILPND--PTMQAQASTR 79

Query: 83  NIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAV 142
           NI  +    P + FA A S  Y      +      GI P A +   V++ + V + P+AV
Sbjct: 80  NILWISVKDPRLVFARAISYFY------QPYRRSAGIHPSAVIEPGVEMGEDVAVGPLAV 133

Query: 143 VYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGF 201
           V+ GV++G +T +  G+V+  G  IGR+  + A   ++  + IG++ ++HSG  IG++GF
Sbjct: 134 VHEGVKLGDRTCIHAGAVVYPGAMIGRDTVLHANCVVHERTQIGDNCVIHSGAVIGSEGF 193

Query: 202 GYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHI 261
           G+    +   K+   G  +I+  VEIG NS +DR  + +T IG NTKIDN V I H+  +
Sbjct: 194 GFVPTATGWEKMHQSGITVIEAGVEIGCNSTVDRPAVGETRIGRNTKIDNMVHIAHSCQV 253

Query: 262 GCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGG 321
           G    + +QVG+AG T IG  V++ GQ GIA   K+GD    +++SG++ ++  G+   G
Sbjct: 254 GEAVAMAAQVGMAGGTTIGSRVILAGQVGIANKAKLGDGAVASAQSGIVSNVAPGEIVSG 313

Query: 322 MPARPIGEYLRHMVMLSKPSK 342
            PA P   +L+   ++ +  K
Sbjct: 314 SPAMPHKTFLKSSAIIKRLPK 334


>gi|153807527|ref|ZP_01960195.1| hypothetical protein BACCAC_01807 [Bacteroides caccae ATCC 43185]
 gi|149129889|gb|EDM21101.1| hypothetical protein BACCAC_01807 [Bacteroides caccae ATCC 43185]
          Length = 346

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 175/329 (53%), Gaps = 10/329 (3%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKATLIKVDNAYESLA---KLL---NLYEMSKPKKEGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG+ C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENAVIGDNTQIYPHTFVGDGVKIGKGCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T+I    KIDN VQI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVIHSGAKIDNLVQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  +G   ++ +QVGIAGST IG+  + GGQ GIAG++KIGD V + ++SGV   I +
Sbjct: 239 AHNDEVGSHTVMAAQVGIAGSTKIGEWCMFGGQVGIAGHIKIGDRVNLGAQSGVPSSIKS 298

Query: 316 GQQYGGMPARPIGEYLRHMVMLSK-PSKY 343
             Q  G P   +  Y +  ++  K P  Y
Sbjct: 299 DNQLIGTPPMELKPYFKAAIVTKKLPDMY 327


>gi|117924717|ref|YP_865334.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Magnetococcus sp. MC-1]
 gi|117608473|gb|ABK43928.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Magnetococcus sp. MC-1]
          Length = 321

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 181/327 (55%), Gaps = 28/327 (8%)

Query: 16  MKLAQSIGASLLDENFGERM-IYSLSPIARASTGDISYIISRKFLNNIEKCKASA-IICS 73
           MKL+  + + L    +GE + I +++P+  A+ GD+S++  R FL   EK +A+A ++ +
Sbjct: 1   MKLS-DLASQLQLPMYGEDVPIKAVAPVEWAAQGDLSFVGERSFL---EKGRAAAALLVT 56

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            ++     +  P L+S  P +    AG +L  Q      SS   G+ P A +    +I  
Sbjct: 57  AEVAEAGVEGQPYLISPAPALDAGRAGVLLGMQPF----SSAVTGVHPTAVVDPSARIGA 112

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSG 193
           GV + P  VV        +  +G G V+  GV + + C +GAGS           I+HSG
Sbjct: 113 GVSLGPYVVVEA------EAILGDGVVLHPGVVVHQRCQVGAGS-----------IIHSG 155

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG DGFGY        +I H G V+I++ VEIGAN+ IDR    +T IG  T+IDNQV
Sbjct: 156 AVIGADGFGYQFVEGSHQRIPHFGCVVIEEGVEIGANTTIDRARFGETRIGAGTRIDNQV 215

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL-KD 312
           QIGHNV +G  C+IVSQVGIAGS  IGD V+I GQ G+A ++++G   +IA+ +G+    
Sbjct: 216 QIGHNVQVGKHCVIVSQVGIAGSCVIGDYVVIAGQAGLAPHVEVGRGARIAASTGLAGGR 275

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +PAG+ + G   +P  + +  +  + K
Sbjct: 276 VPAGETWSGWWGQPHRDSMLQLSAMRK 302


>gi|166155329|ref|YP_001653584.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis L2b/UCH-1/proctitis]
 gi|226740715|sp|B0BBM4|LPXD_CHLTB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|165931317|emb|CAP06889.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis L2b/UCH-1/proctitis]
          Length = 354

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 176/322 (54%), Gaps = 20/322 (6%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPF- 79
           A  L   F   G  ++  +  I  A T  I+++ + K+  +++  +A AII S+      
Sbjct: 12  ADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKY 71

Query: 80  --IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   + S+ P        S+++ + + +  +  + G   I P A +     IED 
Sbjct: 72  RDLNKNF-LITSESP--------SLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDH 122

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I P AVV     +G   ++G GSVIGA   +G++  I     I   + IG  VI+  G
Sbjct: 123 VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGQHSYIHPRVVIRERVSIGKRVIIQPG 182

Query: 194 VRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+ GFGY       HK + H+G+VII+D VEIGAN+ IDRG    +++ E +KIDN 
Sbjct: 183 AVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNL 242

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI H V +G   +IV+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K 
Sbjct: 243 VQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS 302

Query: 313 IPAGQQYGGMPARPIGEYLRHM 334
           I +   YGG PARP  E  R +
Sbjct: 303 ITSPGIYGGAPARPYQEIHRQV 324


>gi|312130383|ref|YP_003997723.1| udp-3-o-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Leadbetterella byssophila DSM 17132]
 gi|311906929|gb|ADQ17370.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Leadbetterella byssophila DSM 17132]
          Length = 326

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 115/329 (34%), Positives = 181/329 (55%), Gaps = 10/329 (3%)

Query: 16  MKLAQSIGASLLD---ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           MK +    A +L+   E  GE +I + + I     G IS++ + K+   I   ++SA+I 
Sbjct: 1   MKFSVEQIAKILEGEVEGDGEVLIDNFAKIEEGKPGSISFLANIKYEPYIYTTESSAVIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           S++ +P        +    P +S +   +  Y Q + ++      GI P++ + +  ++ 
Sbjct: 61  SKEFIPKSAIKSSLIRVKDPYLSVSKLMA-AYQQMLKVKKV----GIHPKSIISDSAELG 115

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILH 191
           + V +  +A +     IG +  +G G+ IG  V+IG    I  G+ +    +IG + +LH
Sbjct: 116 EEVFVDALAYIGDHSVIGSEVNIGAGAYIGLRVKIGAGTIIHPGAKVMDDCVIGENCVLH 175

Query: 192 SGVRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
            GV IG++GFG+A   + + + I  +G V++ D V IGAN+ IDR T+  T IG+  K+D
Sbjct: 176 PGVVIGSEGFGFAPDENGVFQDIPQLGNVVLGDNVSIGANTTIDRATMGSTRIGKGVKLD 235

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N VQIGHNV IG   +I SQ G++GST IG N +I GQ G  G++KI D  +I +KSGV 
Sbjct: 236 NLVQIGHNVEIGENTVIASQTGVSGSTKIGRNCMIAGQVGFVGHIKIADGTKIGAKSGVA 295

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           K I     Y G P  P+ +YLR M+ LSK
Sbjct: 296 KSIEEPGAYSGHPLLPLKQYLRLMINLSK 324


>gi|260890300|ref|ZP_05901563.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leptotrichia hofstadii F0254]
 gi|260859920|gb|EEX74420.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leptotrichia hofstadii F0254]
          Length = 338

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 164/319 (51%), Gaps = 34/319 (10%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPC-----L 87
           E     ++P   ++  ++++    K L NI+KC A A+I     VP +P N+P      +
Sbjct: 20  ELSFTRIAPFFHSTEKELTFAADEKMLKNIDKCSAGAVI-----VPDLP-NLPANKTFIV 73

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED-------GVVIAPM 140
           +   P     I  +   P+        FE  I   A + E   +          V I   
Sbjct: 74  VKGNPRELMPILLNYFKPKL-----QPFENQIENSAQIDESANVSKINTYIGHNVKIGKN 128

Query: 141 AVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDG 200
           AV+YP V I   T +G   +I + V +     +G G+           IL  G  IG+DG
Sbjct: 129 AVIYPNVSIFEGTEIGDDCIIYSNVTVREFTKVGRGT-----------ILQPGAVIGSDG 177

Query: 201 FGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVH 260
           FG+ +   +  KI  IG VII ++VEIGANS +DRG I DTII + TKIDN V I HN  
Sbjct: 178 FGFVKINGNNVKIEQIGHVIIGEEVEIGANSCVDRGAIGDTIIKKGTKIDNLVHIAHNDI 237

Query: 261 IGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYG 320
           IG  C+IV+Q GI+GS  +G+N  + GQ G+AG+LKIG NV IA+KSGV  D+P G+Q  
Sbjct: 238 IGENCLIVAQTGISGSVEVGNNSTLAGQVGVAGHLKIGSNVVIAAKSGVTNDVPDGKQMS 297

Query: 321 GMPARPIGEYLRHMVMLSK 339
           G P R   E LR  + + K
Sbjct: 298 GYPLREHIEDLRVKMAMGK 316


>gi|166154454|ref|YP_001654572.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis 434/Bu]
 gi|301335713|ref|ZP_07223957.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis L2tet1]
 gi|226740714|sp|B0B7F9|LPXD_CHLT2 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|165930442|emb|CAP03935.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis 434/Bu]
          Length = 354

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 176/322 (54%), Gaps = 20/322 (6%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPF- 79
           A  L   F   G  ++  +  I  A T  I+++ + K+  +++  +A AII S+      
Sbjct: 12  ADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKY 71

Query: 80  --IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   + S+ P        S+++ + + +  +  + G   I P A +     IED 
Sbjct: 72  RDLNKNF-LITSESP--------SLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDH 122

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I P AVV     +G   ++G GSVIGA   +G++  I     I   + IG  VI+  G
Sbjct: 123 VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGQHSYIHPRVVIRERVSIGKRVIIQPG 182

Query: 194 VRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+ GFGY       HK + H+G+VII+D VEIGAN+ IDRG    +++ E +KIDN 
Sbjct: 183 AVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNL 242

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI H V +G   +IV+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K 
Sbjct: 243 VQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS 302

Query: 313 IPAGQQYGGMPARPIGEYLRHM 334
           I +   YGG PARP  E  R +
Sbjct: 303 ITSPGIYGGAPARPYQEIHRQV 324


>gi|229513892|ref|ZP_04403354.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae TMA 21]
 gi|229349073|gb|EEO14030.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae TMA 21]
          Length = 351

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 172/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+  +P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVAEPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIDEKGMYSSGIPLQTNKEWRK 315


>gi|153820496|ref|ZP_01973163.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae NCTC 8457]
 gi|126508959|gb|EAZ71553.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae NCTC 8457]
          Length = 341

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKTSERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|167754457|ref|ZP_02426584.1| hypothetical protein ALIPUT_02753 [Alistipes putredinis DSM 17216]
 gi|167659082|gb|EDS03212.1| hypothetical protein ALIPUT_02753 [Alistipes putredinis DSM 17216]
          Length = 345

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 160/302 (52%), Gaps = 8/302 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  ++++S I     G ++Y+ + K+  ++ K +AS ++ ++D  P  P     +  +  
Sbjct: 22  EAKVHTVSSIEEGEPGALTYLTNPKYEKHLYKTRASIVLVNKDFTPSEPVTATLIKVED- 80

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                   ++L    M+  A   + GIS +A + E   + +   +   AV+  G  IG  
Sbjct: 81  -----TGAAVLKLLQMYQAAKPRKQGISERASISERATLGEDCYVGDFAVIEAGARIGAD 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGY-ARGVSDI 210
             + P   IG GV +G    +  G  IY   +IG+  ILH+G  IG DGFG+        
Sbjct: 136 CQIYPQVYIGDGVTVGDGTILYPGVKIYEGCVIGSRCILHAGAVIGADGFGFIPNAAGGF 195

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  +G V+++D VEIGAN+ IDR   D TII    K+DN +QIGHNV IG   +  +Q
Sbjct: 196 DKIPQLGNVVVEDDVEIGANTCIDRAKTDSTIIRRGVKLDNLIQIGHNVQIGENTVSSAQ 255

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAG++ +G N  + GQ GIA ++ IGD V I SKSG+ KD+P G+   G PA P  +Y
Sbjct: 256 TGIAGTSKVGHNCFLAGQVGIADHVTIGDRVCIGSKSGLDKDVPDGEVRFGYPALPGMQY 315

Query: 331 LR 332
            R
Sbjct: 316 HR 317


>gi|257459706|ref|ZP_05624815.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter gracilis RM3268]
 gi|257443131|gb|EEV18265.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter gracilis RM3268]
          Length = 316

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 114/319 (35%), Positives = 174/319 (54%), Gaps = 19/319 (5%)

Query: 16  MKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           MKL++      ++ N  +  I +++ +  A   ++SY  S K    +   KA+A++    
Sbjct: 1   MKLSKIAEILNIELNGADAEITAINSLQNARQSELSYCDSDKNEKFLSATKAAAVLVKCG 60

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
               +P  +  L  + P ++FAI  +     A  +  S     I+  A +G++V I  GV
Sbjct: 61  TA--VPNGVRALECENPHLAFAILSAHF---AKPLIRSGVPAKIAASAQIGQNVHI--GV 113

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGV 194
                        IG    +  G+ IG  V IG +C I A + IY+ ++IG   I+H+  
Sbjct: 114 ----------NSTIGENCVILSGAYIGDDVHIGSDCVIHANAVIYNDAIIGERCIIHANA 163

Query: 195 RIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
            IG+DGFGYA   +  H KI H G V++QD+VEIGA + IDR     TI+   +KIDN V
Sbjct: 164 VIGSDGFGYAHTKTGEHVKIYHNGNVVLQDEVEIGACTTIDRAVFGSTIVKRGSKIDNLV 223

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QIGHN  +G  C+IVSQVG+AGST +G NV++GGQ G  G++ +GD  QIA++ G+ KD+
Sbjct: 224 QIGHNCELGQNCLIVSQVGLAGSTTLGRNVVMGGQSGSGGHVSVGDFAQIAARGGISKDL 283

Query: 314 PAGQQYGGMPARPIGEYLR 332
             G+ Y G P   + E+ +
Sbjct: 284 AGGKNYAGHPIMELSEWFK 302


>gi|237721313|ref|ZP_04551794.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_2_4]
 gi|229449109|gb|EEO54900.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_2_4]
          Length = 346

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 173/320 (54%), Gaps = 9/320 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKTTLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFVGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST IG+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKIGEWCMIGGQVGIAGHSKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLRHMV 335
           G Q  G P   + +Y +  V
Sbjct: 299 GSQLIGTPPMELKQYFKASV 318


>gi|296122607|ref|YP_003630385.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Planctomyces limnophilus DSM 3776]
 gi|296014947|gb|ADG68186.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Planctomyces limnophilus DSM 3776]
          Length = 366

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 167/304 (54%), Gaps = 9/304 (2%)

Query: 40  SPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLL---SDKPEVSF 96
           + I +A +G+++++   + ++ +++  ASA++        +  + P L+    + P+ +F
Sbjct: 34  AAIEQAKSGELTFLSEDRHISRLKETSASAVVIHPSQSARVNADYPRLVLLEVEDPQAAF 93

Query: 97  AIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVG 156
                +       +  S  + GISP AF+    +I +   I P A +   V IG    + 
Sbjct: 94  -----LQVLPLFRIIRSRLKRGISPSAFISSTARIGENCAIGPGAYIGEDVIIGDDCDIH 148

Query: 157 PGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIVH 215
           PG+ IGAG R+GR+C I + + +Y  + +G+ VI+H+   +G DGFGY        K+  
Sbjct: 149 PGASIGAGSRLGRDCQIYSNAVLYHEVSLGDRVIIHANAVLGADGFGYRFEQGRFIKVPQ 208

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
           +G VII+  VEIGA + IDRG +D T+IG  TKIDN V IGHN  +G   +  +QVG+AG
Sbjct: 209 LGGVIIESDVEIGAGATIDRGAVDATVIGAGTKIDNMVMIGHNCRVGRNNVFAAQVGLAG 268

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           S   GD V +GGQ G+  +  +G    + +K+GV +++P G+ + G PA P  E  R + 
Sbjct: 269 SCSTGDYVRLGGQVGVKDHTHMGTGCMVGAKAGVHRNVPDGETWIGYPASPEAEQKRLVF 328

Query: 336 MLSK 339
            L +
Sbjct: 329 TLKR 332


>gi|15604964|ref|NP_219748.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis D/UW-3/CX]
 gi|76788965|ref|YP_328051.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis A/HAR-13]
 gi|237802666|ref|YP_002887860.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis B/Jali20/OT]
 gi|237804588|ref|YP_002888742.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311044|ref|ZP_05353614.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis 6276]
 gi|255317345|ref|ZP_05358591.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis 6276s]
 gi|255348602|ref|ZP_05380609.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis 70]
 gi|255503142|ref|ZP_05381532.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis 70s]
 gi|255506820|ref|ZP_05382459.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis D(s)2923]
 gi|119371926|sp|Q3KMB9|LPXD_CHLTA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|288561911|sp|P0CD76|LPXD_CHLTR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|3328653|gb|AAC67836.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis D/UW-3/CX]
 gi|76167495|gb|AAX50503.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis A/HAR-13]
 gi|231272888|emb|CAX09799.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231273900|emb|CAX10692.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis B/Jali20/OT]
 gi|289525282|emb|CBJ14758.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis Sweden2]
 gi|296434831|gb|ADH17009.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis E/150]
 gi|296438551|gb|ADH20704.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis E/11023]
 gi|297748373|gb|ADI50919.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis D-EC]
 gi|297749253|gb|ADI51931.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis D-LC]
          Length = 354

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 175/322 (54%), Gaps = 20/322 (6%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPF- 79
           A  L   F   G  ++  +  I  A T  I+++ + K+  +++  +A AII S+      
Sbjct: 12  ADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKY 71

Query: 80  --IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   + S+ P        S+++ + + +  +  + G   I P A +     IED 
Sbjct: 72  RDLNKNF-LITSESP--------SLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDH 122

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I P AVV     +G   ++G GSVIGA   +G +  I     I   + IG  VI+  G
Sbjct: 123 VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPG 182

Query: 194 VRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+ GFGY       HK + H+G+VII+D VEIGAN+ IDRG    +++ E +KIDN 
Sbjct: 183 AVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNL 242

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI H V +G   +IV+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K 
Sbjct: 243 VQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS 302

Query: 313 IPAGQQYGGMPARPIGEYLRHM 334
           I +   YGG PARP  E  R +
Sbjct: 303 ITSPGIYGGAPARPYQEIHRQV 324


>gi|299148540|ref|ZP_07041602.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_23]
 gi|298513301|gb|EFI37188.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_23]
          Length = 346

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 173/320 (54%), Gaps = 9/320 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKTTLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFVGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST IG+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKIGEWCMIGGQVGIAGHSKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLRHMV 335
           G Q  G P   + +Y +  V
Sbjct: 299 GSQLIGTPPMELKQYFKASV 318


>gi|134104594|pdb|2IU8|A Chain A, Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Complex I)
 gi|134104595|pdb|2IU8|B Chain B, Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Complex I)
 gi|134104596|pdb|2IU8|C Chain C, Chlamydia Trachomatis Lpxd With 25mm Udpglcnac (Complex I)
 gi|134104597|pdb|2IU9|A Chain A, Chlamydia Trachomatis Lpxd With 100mm Udpglcnac (Complex
           Ii)
 gi|134104598|pdb|2IU9|B Chain B, Chlamydia Trachomatis Lpxd With 100mm Udpglcnac (Complex
           Ii)
 gi|134104599|pdb|2IU9|C Chain C, Chlamydia Trachomatis Lpxd With 100mm Udpglcnac (Complex
           Ii)
 gi|134104600|pdb|2IUA|A Chain A, C. Trachomatis Lpxd
 gi|134104601|pdb|2IUA|B Chain B, C. Trachomatis Lpxd
 gi|134104602|pdb|2IUA|C Chain C, C. Trachomatis Lpxd
          Length = 374

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 175/322 (54%), Gaps = 20/322 (6%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPF- 79
           A  L   F   G  ++  +  I  A T  I+++ + K+  +++  +A AII S+      
Sbjct: 32  ADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKY 91

Query: 80  --IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   + S+ P        S+++ + + +  +  + G   I P A +     IED 
Sbjct: 92  RDLNKNF-LITSESP--------SLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDH 142

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I P AVV     +G   ++G GSVIGA   +G +  I     I   + IG  VI+  G
Sbjct: 143 VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPG 202

Query: 194 VRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+ GFGY       HK + H+G+VII+D VEIGAN+ IDRG    +++ E +KIDN 
Sbjct: 203 AVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNL 262

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI H V +G   +IV+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K 
Sbjct: 263 VQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS 322

Query: 313 IPAGQQYGGMPARPIGEYLRHM 334
           I +   YGG PARP  E  R +
Sbjct: 323 ITSPGIYGGAPARPYQEIHRQV 344


>gi|160887040|ref|ZP_02068043.1| hypothetical protein BACOVA_05054 [Bacteroides ovatus ATCC 8483]
 gi|156107451|gb|EDO09196.1| hypothetical protein BACOVA_05054 [Bacteroides ovatus ATCC 8483]
          Length = 346

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 111/317 (35%), Positives = 172/317 (54%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKATLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + IG GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFIGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST +G+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKVGEWCMIGGQVGIAGHAKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + +Y +
Sbjct: 299 GSQLIGTPPMELKQYFK 315


>gi|221135081|ref|ZP_03561384.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Glaciecola sp. HTCC2999]
          Length = 355

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 182/336 (54%), Gaps = 16/336 (4%)

Query: 12  GIALMKLAQSIGASLL--DE----NFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
            ++L +LAQ IGA++   DE    +  + MI  ++P+ RA  G++ ++  +K+ +++ + 
Sbjct: 3   AVSLEQLAQHIGATIASSDERALASASDIMITRVAPLDRALAGEVGFLNDKKYKSSLAET 62

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           +ASA+I ++ +     + I  ++ D   V FA+A  +L P      A      I P AF+
Sbjct: 63  QASAVILTEKLATDY-QGIALVVKDA-YVGFALAAQLLNPTPKPHYA------IHPSAFV 114

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-I 184
            E  ++   V I P AV+  GV +G    +G G+VI    +IG +  I    ++Y S  +
Sbjct: 115 DETAQLGQNVSIGPNAVIEAGVVLGDNVSIGAGAVIRVNAQIGHDSYIHPNVTVYHSCQL 174

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G+ V++HS   +G DG+GYA        I   G V I +  EIGA++ IDRG +DDT+IG
Sbjct: 175 GHHVVVHSNTSVGCDGYGYAPHGGKWITIPQTGIVRIGNYTEIGASTTIDRGALDDTVIG 234

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
           E+  IDNQV I HNV +G G  +     +AGS  IG NV+I G   I G++ I DNVQI 
Sbjct: 235 EHVIIDNQVHIAHNVVVGDGACLCGGTMMAGSVNIGKNVIIAGTVAINGHITICDNVQIT 294

Query: 305 SKSGVLKDIPAGQQY-GGMPARPIGEYLRHMVMLSK 339
             + V  DI     Y  GMP  P  E+ R+ V + +
Sbjct: 295 GNTMVTSDITEPGVYSSGMPHSPYSEWRRNSVRIKQ 330


>gi|260171651|ref|ZP_05758063.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D2]
 gi|315919963|ref|ZP_07916203.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313693838|gb|EFS30673.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 346

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 112/320 (35%), Positives = 173/320 (54%), Gaps = 9/320 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKTTLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDSTQIYPHTFVGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST IG+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKIGEWCMIGGQVGIAGHSKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLRHMV 335
           G Q  G P   + +Y +  V
Sbjct: 299 GSQLIGTPPMELKQYFKASV 318


>gi|15642248|ref|NP_231881.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|147675586|ref|YP_001217765.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae O395]
 gi|153823579|ref|ZP_01976246.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae B33]
 gi|183179450|ref|ZP_02957661.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae MZO-3]
 gi|227082374|ref|YP_002810925.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae M66-2]
 gi|229507676|ref|ZP_04397181.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae BX 330286]
 gi|229512129|ref|ZP_04401608.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae B33]
 gi|229519264|ref|ZP_04408707.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae RC9]
 gi|229607180|ref|YP_002877828.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae MJ-1236]
 gi|254849380|ref|ZP_05238730.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae MO10]
 gi|255747053|ref|ZP_05420998.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholera CIRS 101]
 gi|262161402|ref|ZP_06030512.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae INDRE 91/1]
 gi|262167727|ref|ZP_06035429.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae RC27]
 gi|298500375|ref|ZP_07010180.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae MAK 757]
 gi|20138762|sp|Q9KPW2|LPXD_VIBCH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|9656811|gb|AAF95394.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|126518895|gb|EAZ76118.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae B33]
 gi|146317469|gb|ABQ22008.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae O395]
 gi|183012861|gb|EDT88161.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae MZO-3]
 gi|227010262|gb|ACP06474.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae M66-2]
 gi|227014146|gb|ACP10356.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae O395]
 gi|229343953|gb|EEO08928.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae RC9]
 gi|229352094|gb|EEO17035.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae B33]
 gi|229355181|gb|EEO20102.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae BX 330286]
 gi|229369835|gb|ACQ60258.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae MJ-1236]
 gi|254845085|gb|EET23499.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae MO10]
 gi|255735455|gb|EET90855.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholera CIRS 101]
 gi|262023792|gb|EEY42491.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae RC27]
 gi|262028713|gb|EEY47367.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae INDRE 91/1]
 gi|297541068|gb|EFH77122.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae MAK 757]
          Length = 351

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKTSERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|307546384|ref|YP_003898863.1| UDP-3-O-acyl N-acetylglucosamine deacetylase [Halomonas elongata
           DSM 2581]
 gi|307218408|emb|CBV43678.1| UDP-3-O- [Halomonas elongata DSM 2581]
          Length = 345

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 166/302 (54%), Gaps = 10/302 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++A  +GA L  +  G + +  L+ +  A    I+++ +R +L ++   +A+A++ 
Sbjct: 8   LTLAEIATRLGAELRGD--GAQRVSGLATLRDAGPEHITFLANRAYLKDLADTRAAAVLL 65

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
                   P  +  L    P + +A    +  P A    A     G+   A + ED ++ 
Sbjct: 66  HPSHAQTCP--VASLTLANPYLGYAELSRLFDPLANRESA-----GVHLSAVVAEDAQLG 118

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           +GV + P AV+  GV +     +GPG V+GA  RIG N  + A  ++Y  + IG   ILH
Sbjct: 119 EGVSVGPQAVIESGVILDDGVIIGPGCVVGADTRIGANSRLHANVTLYHGVVIGARAILH 178

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG DGFG+A      HKI  +G V++ D VE+G+ S+IDRG + DT+IG++ KID+
Sbjct: 179 SGCVIGGDGFGFAHDGKGWHKIAQLGGVVLGDDVEVGSCSSIDRGALGDTLIGDDVKIDS 238

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           QVQI HNV IG    +   VGIAGST +G + ++GG  G++G+L I D VQ+   S V  
Sbjct: 239 QVQIAHNVQIGEHSALAGCVGIAGSTRVGRHCMLGGGVGLSGHLTICDGVQVTGMSLVTN 298

Query: 312 DI 313
            I
Sbjct: 299 SI 300


>gi|153831005|ref|ZP_01983672.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae 623-39]
 gi|229522196|ref|ZP_04411613.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae TM 11079-80]
 gi|262190012|ref|ZP_06048315.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae CT 5369-93]
 gi|148873513|gb|EDL71648.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae 623-39]
 gi|229341121|gb|EEO06126.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae TM 11079-80]
 gi|262034108|gb|EEY52545.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae CT 5369-93]
          Length = 351

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|95929402|ref|ZP_01312145.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfuromonas acetoxidans DSM 684]
 gi|95134518|gb|EAT16174.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfuromonas acetoxidans DSM 684]
          Length = 343

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/332 (35%), Positives = 180/332 (54%), Gaps = 12/332 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L +LA  I   ++ ++  E  I  L+PI  A  GDI++I + K+L  + K  ASAI+  
Sbjct: 3   TLKELAALIDGDIIGDDSVE--ITRLAPIDGAGPGDITFIANPKYLPFVSKTAASAILVD 60

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +   P   ++I  L+   P ++FA   + L  Q            ++P A LG+      
Sbjct: 61  R---PLDREDIAYLVCKNPYLAFAKVLTHLNVQRPEPLGVLPGAQVAPSAVLGK------ 111

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHS 192
           G+ + P AV+  GV+IG  + + P  V+   V+IG +C I AGS +    ++G+ VI+  
Sbjct: 112 GITVYPGAVIGEGVQIGDGSILYPNVVVYDQVKIGCDCQIHAGSVVREGCVVGDRVIVQP 171

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
              IG+DGFG+A      +KI  +G V+I+D VEIGA S IDR  +  T IGE  K+DN 
Sbjct: 172 NAVIGSDGFGFAPDGEVYYKIPQVGIVVIEDDVEIGAGSCIDRAAMGVTRIGEGCKLDNM 231

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQ+ HNV +G   ++ SQ GIAGS  +G +   GGQ  I G++ +GDNV +  + G+  +
Sbjct: 232 VQVAHNVTVGPHTVMASQSGIAGSAKVGRHCTFGGQSAITGHITVGDNVTLGGRGGIAGN 291

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
           I   Q   G+PA P  E+L+  ++  K  + K
Sbjct: 292 IDGNQVVSGIPAIPHKEWLKSSMVFPKLPQMK 323


>gi|296435759|gb|ADH17933.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis G/9768]
 gi|296436683|gb|ADH18853.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis G/11222]
 gi|296437619|gb|ADH19780.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis G/11074]
 gi|297140118|gb|ADH96876.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia trachomatis G/9301]
          Length = 354

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 174/322 (54%), Gaps = 20/322 (6%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPF- 79
           A  L   F   G  ++  +  I  A T  I+++ + K+   ++  +A AII S+      
Sbjct: 12  ADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKYLKSSEAGAIIISRTQFQKY 71

Query: 80  --IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   + S+ P        S+++ + + +  +  + G   I P A +     IED 
Sbjct: 72  RDLNKNF-LITSESP--------SLVFQKCLELFVTPVDSGFPGIHPTAVIHPTAIIEDH 122

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I P AVV     +G   ++G GSVIGA   +G +  I     I   + IG  VI+  G
Sbjct: 123 VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPG 182

Query: 194 VRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+ GFGY       HK + H+G+VII+D VEIGAN+ IDRG    +++ E +KIDN 
Sbjct: 183 AVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNL 242

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI H V +G   +IV+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K 
Sbjct: 243 VQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS 302

Query: 313 IPAGQQYGGMPARPIGEYLRHM 334
           I +   YGG PARP  E  R +
Sbjct: 303 ITSPGIYGGAPARPYQEIHRQV 324


>gi|153825349|ref|ZP_01978016.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae MZO-2]
 gi|229524252|ref|ZP_04413657.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae bv. albensis VL426]
 gi|149741033|gb|EDM55102.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae MZO-2]
 gi|229337833|gb|EEO02850.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae bv. albensis VL426]
          Length = 351

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|150008714|ref|YP_001303457.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parabacteroides distasonis ATCC 8503]
 gi|255014512|ref|ZP_05286638.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_7]
 gi|166199092|sp|A6LDS1|LPXD_PARD8 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|149937138|gb|ABR43835.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parabacteroides distasonis ATCC 8503]
          Length = 347

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 169/311 (54%), Gaps = 8/311 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           + + S I     G ++++ + K+ ++I   +AS ++ + D  P  P     +   K E +
Sbjct: 24  VSNFSKIEEGKPGTLTFLANLKYAHHIYNTEASIVLVNNDFKPEQPIRATLV---KVENA 80

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +A    +L    +  ++ S + G+   AF+     + D   +   A +  GV++G+   V
Sbjct: 81  YAALAMLL---NLVEQSKSKKKGVDSTAFIAASATVSDDCYVGNFAYIGEGVKMGKNCMV 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P + IG  V +G NC     +++Y + +IGN+ ILH+G  +G DGFG+A       KI 
Sbjct: 138 YPHAYIGDHVTVGDNCVFYPHATVYENCIIGNNCILHAGSVVGADGFGFAPEGETYKKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            +G VII+D VEIGAN+ IDR  +D TII    K+DN VQI HNV +G   ++ +QVGIA
Sbjct: 198 QLGNVIIEDDVEIGANTTIDRAVMDSTIIHRGVKLDNLVQIAHNVEVGENTVMAAQVGIA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS  +G + + GGQ G+AG++ + D+V   +++GV+ D+       G PA     ++R  
Sbjct: 258 GSVKVGKHCMFGGQVGLAGHIHVADHVVFGAQAGVISDVKEATTLLGAPAINAKNFMRSS 317

Query: 335 VMLSK-PSKYK 344
            + ++ P  Y+
Sbjct: 318 AIFNRLPDIYR 328


>gi|121729977|ref|ZP_01682395.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae V52]
 gi|121628281|gb|EAX60793.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae V52]
 gi|327484766|gb|AEA79173.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase [Vibrio
           cholerae LMA3894-4]
          Length = 351

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIDEKGMYSSGIPLQTNKEWRK 315


>gi|237715524|ref|ZP_04546005.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D1]
 gi|262408534|ref|ZP_06085080.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_22]
 gi|294646506|ref|ZP_06724143.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides ovatus SD CC 2a]
 gi|294807534|ref|ZP_06766331.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides xylanisolvens SD CC 1b]
 gi|229444233|gb|EEO50024.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D1]
 gi|262353399|gb|EEZ02493.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_22]
 gi|292638125|gb|EFF56506.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides ovatus SD CC 2a]
 gi|294445235|gb|EFG13905.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides xylanisolvens SD CC 1b]
          Length = 346

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/317 (34%), Positives = 172/317 (54%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKATLIRVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFVGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST +G+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKVGEWCMIGGQVGIAGHAKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + +Y +
Sbjct: 299 GSQLIGTPPMELKQYFK 315


>gi|293369395|ref|ZP_06615980.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides ovatus SD CMC 3f]
 gi|298482179|ref|ZP_07000367.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D22]
 gi|292635562|gb|EFF54069.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides ovatus SD CMC 3f]
 gi|298271736|gb|EFI13309.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. D22]
          Length = 346

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/317 (34%), Positives = 172/317 (54%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKATLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFVGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST +G+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKVGEWCMIGGQVGIAGHAKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + +Y +
Sbjct: 299 GSQLIGTPPMELKQYFK 315


>gi|154490827|ref|ZP_02030768.1| hypothetical protein PARMER_00744 [Parabacteroides merdae ATCC
           43184]
 gi|154088575|gb|EDN87619.1| hypothetical protein PARMER_00744 [Parabacteroides merdae ATCC
           43184]
          Length = 351

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 171/314 (54%), Gaps = 8/314 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  + + S I     G ++++ + K+ + I + +AS ++ + D  P  P     +     
Sbjct: 21  EVKVNNFSKIEEGKPGTLTFLANPKYEHFIYQTEASIVLVNNDFTPAEPIKATLVKVANA 80

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
             S AI  +      M  +A+  + GI   AF+     + +G  +   A +   V+IG+ 
Sbjct: 81  YASLAILLN------MAEQANVKKAGIDATAFIAGSATVGEGCYVGNFAYIGEDVKIGKN 134

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           + + P + IG  V IG NC++   ++IY+  +IGN+ ILH+G  IG+DGFG+A    +  
Sbjct: 135 SRIYPHAYIGDHVTIGDNCTVYPHATIYNGCVIGNNCILHAGSVIGSDGFGFAPEGDNYK 194

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  +G V+++D VEIGAN+ IDR  +D TII    K+DN VQI HNV +G   ++ +QV
Sbjct: 195 KIPQLGNVVLEDDVEIGANTTIDRAVMDSTIIRRGVKLDNLVQIAHNVEVGENTVMAAQV 254

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GIAGS  IG + + GGQ G++G++ + D+V   ++ GV+ D+       G PA     ++
Sbjct: 255 GIAGSVKIGSHCMFGGQAGLSGHIHVADHVVFGAQCGVISDVKEPATLLGAPAINAKAFM 314

Query: 332 RHMVMLSK-PSKYK 344
           R   + ++ P  Y+
Sbjct: 315 RSSAIFNRLPDMYR 328


>gi|154149221|ref|YP_001406722.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter hominis ATCC BAA-381]
 gi|153805230|gb|ABS52237.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Campylobacter hominis ATCC BAA-381]
          Length = 314

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/328 (35%), Positives = 171/328 (52%), Gaps = 23/328 (7%)

Query: 16  MKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           MKL +      ++ N  +  I +L+ +  A  G++SY  S K    I + KASAI+    
Sbjct: 1   MKLNEICKILGINFNGADIEISALNSLTNAKPGELSYCDSDKNAKFINESKASAILVKN- 59

Query: 76  IVPFIPKNIPCLLSDKPEVSFAI-AGSILYPQAMHMEASSF--EGGISPQAFLGEDVKIE 132
               +      L+ + P ++FAI +G    P     + S       I P  ++G +VKI 
Sbjct: 60  -ADMVQNGATALVCENPHLAFAILSGYYKKPLIREKKPSQIAQSATIMPNVYIGSNVKIG 118

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHS 192
           +  +I   A +   V+IG K  + P  VI    +IG  C           L+ N VI   
Sbjct: 119 EDTIIMAGAFIGDDVQIGEKCIIHPNVVIYNDTKIGNRCH----------LLANCVI--- 165

Query: 193 GVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
               G+DGFGYA      H KI H G V+++D VEIGA + IDR   + T I + TKIDN
Sbjct: 166 ----GSDGFGYAHTKDGRHIKIYHNGNVVLEDDVEIGACTTIDRAVFETTTIKKCTKIDN 221

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
            VQIGHN  +G  C+IVSQ G+AGST +G NV++GGQ G  G++ +GD  QIA++ GV K
Sbjct: 222 LVQIGHNCILGENCLIVSQTGLAGSTTLGRNVVMGGQSGSGGHVSVGDFAQIAARGGVSK 281

Query: 312 DIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           ++P G+ Y G P   + ++L+    + K
Sbjct: 282 NLPGGKAYSGYPILELKDWLKLNAKIQK 309


>gi|295086788|emb|CBK68311.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides xylanisolvens XB1A]
          Length = 346

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 110/317 (34%), Positives = 172/317 (54%), Gaps = 9/317 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
            P        +  D    S A    +L    ++  +   + GI   AF+    KI + V 
Sbjct: 65  TPEHEIKATLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAFVAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG +C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFVGDGVKIGNSCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  T++    K+DN +QI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATVVHSGVKLDNLIQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +Q GIAGST +G+  +IGGQ GIAG+ KIGD V + ++SGV  DI +
Sbjct: 239 AHNDEIGSHTVMAAQAGIAGSTKVGEWCMIGGQVGIAGHAKIGDKVGLGAQSGVPGDIKS 298

Query: 316 GQQYGGMPARPIGEYLR 332
           G Q  G P   + +Y +
Sbjct: 299 GSQLIGTPPMELKQYFK 315


>gi|224825023|ref|ZP_03698129.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Lutiella nitroferrum 2002]
 gi|224602694|gb|EEG08871.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Lutiella nitroferrum 2002]
          Length = 349

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 157/305 (51%), Gaps = 8/305 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           ++  L+P+  A TG+IS++ S KF   +E   ASA+I S  +        P +L+D P +
Sbjct: 22  LVERLAPLEDAKTGEISFLASAKFRRQLETTAASALIMSPKLAEETGYGGPLILTDDPYL 81

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
            FA   ++ +P      A     GI   A +GE  +I+    I     +   V IG++  
Sbjct: 82  YFARVATLFHP------APPARPGIHASAVVGEGCRIDASSEIGANVSIGRDVTIGQRCR 135

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           + PG VIG GV IG   ++    ++Y   LIG+ V +HSG  IG DGFG A       KI
Sbjct: 136 ILPGVVIGDGVVIGDEVTLHPNVTVYHGCLIGSRVGIHSGTVIGADGFGLAWARDHWFKI 195

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
              GRV+I+D VEIGAN+ +DRG + DTII    KIDN VQI HNV IG    I   VGI
Sbjct: 196 PQTGRVVIEDDVEIGANTTVDRGAMADTIIRRGAKIDNLVQIAHNVQIGEHTAIAGCVGI 255

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYG-GMPARPIGEYLR 332
           AGST IG    +GG     G++++ D   I   + V K I     Y    P   + E+L 
Sbjct: 256 AGSTKIGAYCTVGGAAMFVGHIEVTDRTHIGGGTLVSKSIKKPDNYASSYPLSTMKEWLP 315

Query: 333 HMVML 337
           + V L
Sbjct: 316 NAVHL 320


>gi|262383598|ref|ZP_06076734.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_33B]
 gi|298375989|ref|ZP_06985945.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_19]
 gi|301311524|ref|ZP_07217451.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 20_3]
 gi|262294496|gb|EEY82428.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 2_1_33B]
 gi|298267026|gb|EFI08683.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 3_1_19]
 gi|300830610|gb|EFK61253.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 20_3]
          Length = 347

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 168/311 (54%), Gaps = 8/311 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           + + S I     G ++++ + K+ ++I   +AS ++ + D  P  P     +   K E +
Sbjct: 24  VSNFSKIEEGKPGTLTFLANLKYAHHIYNTEASIVLVNNDFKPEQPIRATLV---KVENA 80

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +A    +L    +  ++ S + G+   AF+     + D   +   A +  GV++G+   V
Sbjct: 81  YAALAMLL---NLVEQSKSKKKGVDSTAFIAASATVSDDCYVGNFAYIGEGVKMGKNCMV 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P + IG  V +G NC     +++Y +  IGN+ ILH+G  +G DGFG+A       KI 
Sbjct: 138 YPHAYIGDHVTVGDNCVFYPHATVYENCTIGNNCILHAGSVVGADGFGFAPEGETYKKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            +G VII+D VEIGAN+ IDR  +D TII    K+DN VQI HNV +G   ++ +QVGIA
Sbjct: 198 QLGNVIIEDDVEIGANTTIDRAVMDSTIIRRGVKLDNLVQIAHNVEVGENTVMAAQVGIA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS  +G + + GGQ G+AG++ + D+V   +++GV+ D+       G PA     ++R  
Sbjct: 258 GSVKVGKHCMFGGQVGLAGHIHVADHVVFGAQAGVISDVKEATTLLGAPAINAKNFMRSS 317

Query: 335 VMLSK-PSKYK 344
            + ++ P  Y+
Sbjct: 318 AIFNRLPDIYR 328


>gi|153213801|ref|ZP_01949009.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae 1587]
 gi|124115725|gb|EAY34545.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae 1587]
          Length = 351

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + ++  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPRYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|3411206|gb|AAC35947.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
           [Chlamydia trachomatis]
          Length = 354

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 175/322 (54%), Gaps = 20/322 (6%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPF- 79
           A  L   F   G  ++  +  I  A T  I+++ + K+  +++  +A AII S+      
Sbjct: 12  ADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKY 71

Query: 80  --IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   + S+ P        S+++ + + +  +  + G   I P A +     IED 
Sbjct: 72  RDLNKNF-LITSESP--------SLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDH 122

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I P AVV     +G   ++G GSVIGA   +G++  I     I   + IG  VI+  G
Sbjct: 123 VCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGQHSYIHPRVVIRERVSIGKRVIIQPG 182

Query: 194 VRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+ GFGY       HK + H+G+VII+D VEIGAN+ IDR     +++ E +KIDN 
Sbjct: 183 AVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRARFKHSVVREGSKIDNL 242

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQI H V +G   +IV+Q GIAGST IG++V+IGGQ GI G++ I D+V + +++GV K 
Sbjct: 243 VQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKS 302

Query: 313 IPAGQQYGGMPARPIGEYLRHM 334
           I +   YGG PARP  E  R +
Sbjct: 303 ITSPGIYGGAPARPYQEIHRQV 324


>gi|121586256|ref|ZP_01676046.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae 2740-80]
 gi|121549522|gb|EAX59548.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae 2740-80]
          Length = 351

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGLNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|71083613|ref|YP_266332.1| glucosamine N-acyltransferase [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062726|gb|AAZ21729.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase RP009
           [Candidatus Pelagibacter ubique HTCC1062]
          Length = 326

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 176/328 (53%), Gaps = 8/328 (2%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF ++  + +  + Q I    L+ +  ++ I  +  +  +   DI++  S+K+ N  +  
Sbjct: 5   FFKNNGPLNISDILQLINLDDLNID-NDQEINDIKDLLTSKKNDITFFHSKKYKNFAKNT 63

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KAS  + ++ +   +PK+   L+ +   VS +   S  YP       SS        A  
Sbjct: 64  KASFCLTTEILKDELPKSCLPLIVENVLVSTSKVTSKFYP-------SSINDNFDYTARD 116

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
             + K +D V      ++   V +G    +G  S+I   V IG NCSIG+   I ++LI 
Sbjct: 117 IAETKFKDKVKCGKNVLIGDNVTLGSNCLIGHNSIIEQNVSIGDNCSIGSNVIIRNTLID 176

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V +     IG  GFG+        +  HIG VII +  EIG    IDRG++ +T+IG+
Sbjct: 177 NNVTVLDNCVIGKHGFGFFPVSKKNLRYPHIGIVIIGENSEIGCGCTIDRGSMSNTVIGK 236

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
           N+ +DNQ+ I HNV IG   II  QVGIAGS+ IG+NV IGGQ GI+G+L IG+NV+IA 
Sbjct: 237 NSFLDNQIHIAHNVKIGDNSIIAGQVGIAGSSIIGNNVRIGGQAGISGHLTIGNNVEIAG 296

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRH 333
            SGV+K+I    +  G PA+ I ++L+ 
Sbjct: 297 GSGVIKNIKDNSKVMGYPAKNIRDFLKE 324


>gi|254225761|ref|ZP_04919366.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae V51]
 gi|125621667|gb|EAZ49996.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae V51]
          Length = 351

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKTSERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  +G   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGLNVSIGANAVIESGVQLGDNVVIGAGCFVGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  IG V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGAVIGADGFGYANERGEWIKIPQIGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTIIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|288928091|ref|ZP_06421938.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330925|gb|EFC69509.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella sp. oral taxon 317 str. F0108]
          Length = 343

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 177/331 (53%), Gaps = 12/331 (3%)

Query: 17  KLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD 75
           ++AQ +   ++ DEN     ++S + I     G IS++ + K+ + I + +AS ++ ++D
Sbjct: 7   QIAQVVDGEIVGDENAA---VHSFAKIEEGRPGAISFLSNPKYTHYIYETEASVVLVNKD 63

Query: 76  IVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
                P     +  D    ++     +L    M+  A   + GI P AF+  D  + +  
Sbjct: 64  TKLEKPVKTTLIKVDN---AYECVAKLL---QMYEAAKPKKTGIDPLAFVSPDATVGENC 117

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILHSGV 194
            + P A V  GV +G  T V P + +   VR+G +C I     +Y  ++ GN VILHSG 
Sbjct: 118 YVGPFAYVGSGVVVGNGTQVYPHATLCDNVRVGNDCIIYPQVCLYHDVVVGNRVILHSGC 177

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
            IG DGFG+A   +   KI  IG V I+D VEIGAN+ +DR T+  T I +  K+DN VQ
Sbjct: 178 VIGADGFGFAPSANGYDKIPQIGTVTIEDDVEIGANTCVDRSTMGSTYIRKGVKLDNLVQ 237

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           I HN  IG   ++ +QVG+AGST +G   + GGQ G++G++ IG+ V + ++SGV  ++ 
Sbjct: 238 IAHNTDIGENTVMSAQVGVAGSTKVGQWCMFGGQVGVSGHINIGNKVFLGAQSGVPGNLK 297

Query: 315 AGQQYGGMPARPIGEYLR-HMVMLSKPSKYK 344
            GQQ  G P   +  Y + H +    P  YK
Sbjct: 298 DGQQLIGTPPMELKPYFKSHAIFRRLPDMYK 328


>gi|256841250|ref|ZP_05546757.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parabacteroides sp. D13]
 gi|256737093|gb|EEU50420.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parabacteroides sp. D13]
          Length = 347

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 169/311 (54%), Gaps = 8/311 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           + + S I     G ++++ + K+ ++I   +AS ++ + D  P  P     +   K E +
Sbjct: 24  VSNFSKIEEGKPGTLTFLANLKYAHHIYNTEASIVLVNNDFKPEQPIRATLV---KVENA 80

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
           +A    +L    +  ++ S + G+   AF+     + D   +   A +  GV++G+   V
Sbjct: 81  YAALAMLL---NLVEQSKSKKKGVDSTAFIAASAIVSDDCYVGNFAYIGEGVKMGKNCMV 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P + IG  V +G NC     +++Y + +IGN+ ILH+G  +G DGFG+A       KI 
Sbjct: 138 YPHAYIGDHVTVGDNCVFYPHATVYENCIIGNNCILHAGSVVGADGFGFAPEGETYKKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            +G VII+D VEIGAN+ IDR  +D TII    K+DN VQI HNV +G   ++ +QVGIA
Sbjct: 198 QLGNVIIEDDVEIGANTTIDRAVMDSTIIHRGVKLDNLVQIAHNVEVGENTVMAAQVGIA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS  +G + + GGQ G+AG++ + D+V   +++GV+ D+       G PA     ++R  
Sbjct: 258 GSVKVGKHCMFGGQVGLAGHIHVADHVVFGAQAGVISDVKEATTLLGAPAINAKNFMRSS 317

Query: 335 VMLSK-PSKYK 344
            + ++ P  Y+
Sbjct: 318 AIFNRLPDIYR 328


>gi|149197782|ref|ZP_01874831.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine [Lentisphaera araneosa
           HTCC2155]
 gi|149139003|gb|EDM27407.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine [Lentisphaera araneosa
           HTCC2155]
          Length = 339

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 117/318 (36%), Positives = 167/318 (52%), Gaps = 23/318 (7%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ--DIVPFIPKNIPCLLSDKPE 93
           I  +S +   S   IS++ ++++++ I+  +A+ I+  +  D   F    I C   + P 
Sbjct: 25  IKEVSALIDGSINSISFLGNKRYISQIKDSQAAIILVDKEFDTQGFDKLFISC---EDPS 81

Query: 94  VSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKT 153
            SF    +   P  +      ++ GI P A + E+ +I + V I P A++  G  IG   
Sbjct: 82  ASFTKVANYFAPPTIE-----YQAGIDPAANIAENAQIGEDVYIGPGAIIMDGATIGNN- 135

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYSS-------LIGNSVILHSGVRIGNDGFGYARG 206
                +VI A   +G    IGA S +Y +       +IG  VILHS   IG DGFG+  G
Sbjct: 136 -----AVICANAYVGHQAEIGAYSILYPNSTVRERCIIGQRVILHSSCVIGTDGFGFIPG 190

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG V + D VE+G+ + IDR     TI+GE TK+DN +QIGHNV IG  C 
Sbjct: 191 KDGHKKIPQIGIVQLHDDVEVGSCTTIDRARFGKTIVGEGTKLDNIIQIGHNVIIGKHCF 250

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           IVS V IAGS  IG+ V I GQ GI+G+L+IGD   I  K+GV +D+  G+   GMPA  
Sbjct: 251 IVSLVAIAGSVQIGNFVTIAGQAGISGHLQIGDGCTIMGKAGVTRDLNPGEVVMGMPATS 310

Query: 327 IGEYLRHMVMLSKPSKYK 344
             E++     L K SK +
Sbjct: 311 RREFIADRAQLRKISKLE 328


>gi|332707229|ref|ZP_08427282.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Lyngbya
           majuscula 3L]
 gi|332353963|gb|EGJ33450.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Lyngbya
           majuscula 3L]
          Length = 350

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/319 (34%), Positives = 170/319 (53%), Gaps = 15/319 (4%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD---IVPFIPKNIPCLLSDKP 92
           I  ++PI +A+ G +SYI   KF + +EK +ASA+I S D         + I  + + +P
Sbjct: 30  ITGVAPIDQATPGTLSYIEGPKFAHMVEKTQASALILSLDEALQAKATERGIAWVGTSEP 89

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGG--ISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            + FA A +  Y          F+    I P A +  D ++   V I P  ++  GV+IG
Sbjct: 90  RLLFAHAIACFY--------QPFQPAPVIHPTAVIDPDAQLGTDVYIGPFVIISAGVKIG 141

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSD 209
            +  + P  V+   V IG    + A  +I+  S IGN  ++HSG  IG +GFG+      
Sbjct: 142 NQVCIHPNVVLYPEVEIGDRTVLHANCTIHERSRIGNDCVIHSGAVIGAEGFGFVPTPQG 201

Query: 210 IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVS 269
            +K+   G  +++D VE+G NS IDR  + +T IG NTK+DN V IGH   +G  C + +
Sbjct: 202 WYKMQQSGYTVLEDGVEVGCNSTIDRPAVGETRIGRNTKLDNLVHIGHGSEVGQNCALAA 261

Query: 270 QVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGE 329
           QVG++G   +G+ VL+ GQ GIA  +K+GD   + +KSG+ KD+  G    G PA     
Sbjct: 262 QVGLSGGVKVGNQVLLAGQVGIANQVKVGDGAIVTAKSGIHKDVEPGSIVSGYPAISNKL 321

Query: 330 YLRHMVMLSK-PSKYKIKR 347
           +L+   + ++ P  YKI +
Sbjct: 322 WLKISAIYNRLPEMYKILK 340


>gi|292670473|ref|ZP_06603899.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Selenomonas noxia ATCC 43541]
 gi|292647883|gb|EFF65855.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Selenomonas noxia ATCC 43541]
          Length = 341

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 164/313 (52%), Gaps = 32/313 (10%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDK 91
           G RMI  L+ +  A   D+++ +           KA A++  +    F   + P +  + 
Sbjct: 20  GTRMIRGLASLDEAGANDLAFAVPPHIDAARAGAKAGALLLPKGTEGF---SCPVIFVED 76

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMA---------- 141
           P+ +FA   +   P   H+       G+S +A++G DV+I +GV I P A          
Sbjct: 77  PKAAFAKLLTSFTPPIEHVV------GVSDEAYIGCDVQIGEGVTILPFAYIDDHAVLGA 130

Query: 142 --VVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGND 199
              VYP   IG+ + +G  +VI     +  +C IGA  +I+SS +           IG D
Sbjct: 131 GVTVYPHAYIGQYSEIGDHTVIYPNATVREHCRIGARCTIHSSAV-----------IGAD 179

Query: 200 GFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNV 259
           GFG+        K+  +G V+I+D VEIGA+  IDR T+  T+IG+ TKIDN V IGHN 
Sbjct: 180 GFGFTTEAGVHTKVPQVGGVVIEDDVEIGAHVGIDRATLGATVIGKGTKIDNLVHIGHNC 239

Query: 260 HIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY 319
            IG  C+IV+Q GI+GST +G NV  GGQ G  G++ IG N   A++SG++ D+P G   
Sbjct: 240 SIGANCLIVAQTGISGSTKVGHNVTFGGQVGTVGHINIGANSVYAARSGIIADMPEGVFC 299

Query: 320 GGMPARPIGEYLR 332
            G P +P  E+LR
Sbjct: 300 AGFPVQPHTEWLR 312


>gi|194439914|ref|ZP_03071976.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 101-1]
 gi|253774794|ref|YP_003037625.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160298|ref|YP_003043406.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B str. REL606]
 gi|300932133|ref|ZP_07147418.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 187-1]
 gi|194421160|gb|EDX37185.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 101-1]
 gi|242376010|emb|CAQ30693.1| UDP-3-O-[3-hydroxymyristoyl]glucosamine N-acetyltransferase
           [Escherichia coli BL21(DE3)]
 gi|253325838|gb|ACT30440.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972199|gb|ACT37870.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B str. REL606]
 gi|253976408|gb|ACT42078.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli BL21(DE3)]
 gi|300460109|gb|EFK23602.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 187-1]
 gi|323959940|gb|EGB55587.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H489]
          Length = 341

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 119/324 (36%), Positives = 176/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +G   K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIGATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDTII
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTII 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|20138541|sp|O66817|LPXD_AQUAE RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
          Length = 326

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 112/299 (37%), Positives = 166/299 (55%), Gaps = 28/299 (9%)

Query: 58  FLNNIE-----KCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQA----- 107
           F  N+E     K KASA++  +++     K+ P +     +++ A      +P+      
Sbjct: 40  FCRNMEEVEKAKEKASAVVTQEEV-----KDFPHIKVKDVKLALAEFLEHFFPEEHPWGF 94

Query: 108 MHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRI 167
           +   AS  E  I   +F+G+ V I   V I     +YP   +G  T +G  +VI +GV I
Sbjct: 95  LRTPASEKELEIGMGSFIGDFVVIGKNVKIGRNVKIYPFTYVGDNTVIGDNTVIFSGVHI 154

Query: 168 GRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEI 227
            RN           ++IG +V +HSG  IG DGFGY      I KI HIG VII+D VEI
Sbjct: 155 YRN-----------TVIGRNVRIHSGAVIGADGFGYHITQEGIKKIPHIGGVIIEDNVEI 203

Query: 228 GANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGG 287
           GAN+ IDR  I++T+IG+NTKIDN V + HN  +G   I+VSQVG++GS   G NV++ G
Sbjct: 204 GANTTIDRALIENTLIGKNTKIDNLVMVAHNCKVGENNILVSQVGLSGSVKTGKNVILAG 263

Query: 288 QCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGG-MPARPIGEYLR-HMVMLSKPSKYK 344
           Q G+A +++IGDNV + +KSGV  ++   + YG  +PA     + R ++ +L  P  +K
Sbjct: 264 QVGVADHVEIGDNVIVTAKSGVANNLAPNKTYGANLPAIEWSRWKRIYVYLLRLPELFK 322


>gi|325300468|ref|YP_004260385.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bacteroides salanitronis DSM 18170]
 gi|324320021|gb|ADY37912.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Bacteroides salanitronis DSM 18170]
          Length = 346

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 168/314 (53%), Gaps = 8/314 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +++ + I     G IS++ + K+ + I   +++ ++ ++D  P  P +   +  D    S
Sbjct: 24  VHTFAKIEEGVPGAISFLSNPKYTHYIYTTQSTIVLVNKDFEPEQPVSATLIKVDNAYES 83

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
            A    +L    ++ +    + GI P A +    KI   V I P A +  G EIG    +
Sbjct: 84  LA---QLL---TLYEQNKPKKTGIDPLASIAPTAKIGKDVYIGPFACIEAGAEIGDNACI 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   +G+ V+IG N ++    +IY    IGN+ ILH+G  IG DGFG+A       KI 
Sbjct: 138 HPHVTVGSHVKIGSNTTLYPHVTIYQDCRIGNNCILHAGCVIGADGFGFAPSAEGYDKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG V+I+D VEIGAN+ +DR T+  TII +  K+DN +QI HNV IG   ++ SQ G+A
Sbjct: 198 QIGIVVIEDNVEIGANTCVDRATMGATIIHKGVKLDNLIQIAHNVEIGSHTVMASQGGVA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS  IG+  +  GQ G+AG++K+GD V I ++SG+  +  +G    G PA     + R  
Sbjct: 258 GSAKIGEWCVFAGQVGVAGHIKVGDRVTIGAQSGIPGNTKSGSTLMGYPAIDPKLFARSA 317

Query: 335 VMLSK-PSKYKIKR 347
           V+  K P  Y+  R
Sbjct: 318 VIYKKLPDMYEDMR 331


>gi|91775873|ref|YP_545629.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylobacillus flagellatus KT]
 gi|119371945|sp|Q1H149|LPXD_METFK RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|91709860|gb|ABE49788.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Methylobacillus flagellatus KT]
          Length = 350

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 118/330 (35%), Positives = 171/330 (51%), Gaps = 22/330 (6%)

Query: 10  HKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASA 69
           +K  +L ++  ++G  LL ++  + +I  ++ +A A  G IS++   K+ + +    ASA
Sbjct: 2   NKSYSLREIVSTLGGELLGKD--DVLISRVASLANAQPGQISFLTDSKYRSVLATTNASA 59

Query: 70  IICSQDIVPFIPKN-----IPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAF 124
           +I         P+N     +P +L+D P   FA    +L P+        +  G+   A 
Sbjct: 60  VI-------LTPQNRDITALPRILTDNPYAYFAKVSDLLNPK------PEYVAGVDDTAV 106

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SL 183
           +    ++     I   AVV   V +G    V PG VIG GV IG +  + A  +IY   +
Sbjct: 107 IAPSAQVPASCTIMAKAVVGANVVLGEHVVVHPGCVIGEGVEIGAHSVLHANVTIYHHCM 166

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG    + SG  IG DGFGYA       KI  +GRV+I+  V+IGAN+ IDRG IDDTII
Sbjct: 167 IGERCNIFSGSVIGGDGFGYAPEEGRWVKIPQVGRVVIEHDVDIGANTTIDRGAIDDTII 226

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
            E  KIDN VQIGHN  IG   +I   VGIAGS  +G +  IGG   I G+L+I D V +
Sbjct: 227 HEGCKIDNLVQIGHNCRIGAHSVIAGCVGIAGSAVLGKHCRIGGAAMILGHLEIADGVTV 286

Query: 304 ASKSGVLKDI-PAGQQYGGMPARPIGEYLR 332
           +  S + + +  AG     MP +   E+LR
Sbjct: 287 SPGSMITRSLMKAGTYTALMPFQSHDEWLR 316


>gi|22297576|ref|NP_680823.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Thermosynechococcus elongatus BP-1]
 gi|34222675|sp|Q8DMS9|LPXD_THEEB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|22293753|dbj|BAC07585.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Thermosynechococcus elongatus BP-1]
          Length = 338

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 170/320 (53%), Gaps = 10/320 (3%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L  +A+  GA+L     G+R +  ++P+  A+  DIS++ + K+   ++  +A+A+    
Sbjct: 3   LADVAERFGATLDCPEHGDRPVLGVAPLETATATDISFLANPKYTALLQTTQAAAVFVRP 62

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
           D         P L    P ++FA      YPQ   +        I P A LG DV +   
Sbjct: 63  DFQG--EAACPLLRVPHPYLAFAKCIEWFYPQPKPV------AKIHPTAILGADVVLGAE 114

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSG 193
           V I    V+   V IG +T +     +   V IG +C I +  ++   + +G+ VIL + 
Sbjct: 115 VTIGAYTVIGDRVRIGDRTVIDSHCTLYDDVVIGSDCRIYSHCALRERVQLGDRVILQNS 174

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           V +G+DGFGY       H KI  +G V+I + VEIGA + IDR T+ +T +   TKIDN 
Sbjct: 175 VVLGSDGFGYVPLPDGRHYKIPQVGTVVIGNDVEIGAGTTIDRATLGETTVANGTKIDNL 234

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
             + HN  IG   I+ +QVG+AGST+IG++V++ GQ G AG+L IGD   +++KSG+   
Sbjct: 235 TMVAHNCTIGENAILCAQVGLAGSTHIGNHVVLAGQVGAAGHLTIGDRTVVSAKSGISSS 294

Query: 313 IPAGQQYGGMPARPIGEYLR 332
           +P   + GG+PA     YL+
Sbjct: 295 VPPDSRMGGIPAMDQTLYLK 314


>gi|163856837|ref|YP_001631135.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bordetella petrii DSM 12804]
 gi|226740706|sp|A9INS9|LPXD_BORPD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|163260565|emb|CAP42867.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bordetella petrii]
          Length = 364

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 115/329 (34%), Positives = 174/329 (52%), Gaps = 29/329 (8%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV------PFIPKNI----- 84
           I  +  +A A   +IS++ + ++ + +   +A+A+I + D        P  P        
Sbjct: 40  IRGIGTLASAGPEEISFLTNPRYQSQLAGTRAAAVIVTPDAAQALANDPSAPACARVVCP 99

Query: 85  -PCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVV 143
            P LL  +    F  A     P ++H           P A +  D  IED V I P  VV
Sbjct: 100 HPYLLYARLAQWFDAARRPRLPASVH-----------PLAVVAPDAVIEDDVRIGPHCVV 148

Query: 144 YPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFG 202
             G  IGR + +GPG VIG G  +G +C + A  ++Y+++ IG   ILHSGV +G DGFG
Sbjct: 149 EAGASIGRGSTLGPGCVIGEGSSLGPDCLLHARVTLYANVRIGARAILHSGVVLGADGFG 208

Query: 203 YAR----GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHN 258
           +A     G     KI  +G V I D VEIGAN+ IDRG ++DT IG+  K+DNQ+ +GHN
Sbjct: 209 FAPDPTLGQGAWGKIAQLGGVRIGDDVEIGANTTIDRGALEDTDIGDGVKLDNQIMLGHN 268

Query: 259 VHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQ 318
           V +G    + + VG+AGST IG    IGG   ++G+L +GD+V I+  + V  +I    +
Sbjct: 269 VRVGAHTAMAACVGVAGSTVIGSRCTIGGAAMLSGHLTLGDDVHISGGTAVTSNILQPGR 328

Query: 319 YGGM-PARPIGEYLRHMVMLSKPSKYKIK 346
           Y G+ P    GE+ R+  +L + S+ + +
Sbjct: 329 YTGVYPYAEHGEWQRNAAVLQQLSQLRRR 357


>gi|88798267|ref|ZP_01113853.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Reinekea sp. MED297]
 gi|88779043|gb|EAR10232.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Reinekea sp. MED297]
          Length = 345

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 108/321 (33%), Positives = 167/321 (52%), Gaps = 7/321 (2%)

Query: 27  LDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPC 86
           +++   E +I + +P+ +AS GD+S++ S K+  ++    ASA+  S+  V   P+    
Sbjct: 17  IEDAMLETVIQAAAPLDKASEGDLSFLSSAKYRRDLAATAASAVFLSEKEVEHCPEGTIA 76

Query: 87  LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPG 146
           L+   P +++A A S L+ Q   + +      + P A LGE V I    V+     +  G
Sbjct: 77  LVVADPYLAYARA-SHLFDQRPKLTSIHPSAAVDPSATLGEGVAIGANAVVCAGVQLADG 135

Query: 147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARG 206
           VE+G    V   +VIGA   +  N +I      +  +IG   +  SGV IG  GFGYA  
Sbjct: 136 VEVGHGCVVEDNTVIGARTVLRPNVTIQ-----HDCIIGADCVFQSGVVIGGSGFGYAPN 190

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                 I  +GRV+I D+VE+GANS IDRG I+DT+I ++  IDN VQ+GHNV I  G  
Sbjct: 191 QGRWQAIAQLGRVVIGDRVEVGANSTIDRGAIEDTVIADDVIIDNLVQLGHNVRIDEGVA 250

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GGMPAR 325
           + SQVGI+GST++G    I GQ G AG++ I        ++ V K       Y  G+PA 
Sbjct: 251 MASQVGISGSTHVGAGCTIAGQAGFAGHIDIAAGSHFTGRAMVTKGTKEPGLYSSGLPAT 310

Query: 326 PIGEYLRHMVMLSKPSKYKIK 346
              E+ + +  + +    + +
Sbjct: 311 TNREWRKQIARIRQLESLQTR 331


>gi|78187199|ref|YP_375242.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase, LpxD
           [Chlorobium luteolum DSM 273]
 gi|119371950|sp|Q3B382|LPXD_PELLD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|78167101|gb|ABB24199.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlorobium luteolum DSM 273]
          Length = 352

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 172/322 (53%), Gaps = 11/322 (3%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI-VPFIPKNIPCLLSD 90
           G+ +I   + I  A+ G++S+I + K+L  +    AS +I  + + V         L   
Sbjct: 23  GDAVIAGPAKIESAARGEVSFIANEKYLRYLSLTSASLVIVHRSVDVSLYAGERSFLKVS 82

Query: 91  KPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            P  +F     +   Q      +  + G++P A +G  V + +GV +   AV+     IG
Sbjct: 83  DPYTAF-----VFVLQKFARPRTLAKPGVAPTAAIGGGVSLGEGVAVGEHAVIGDRCSIG 137

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSD 209
             T + P +VI   V+IG  C+I    +IY  +LIG+ V++H+G  IG DGFG+A     
Sbjct: 138 AGTVIAPNAVIMHDVKIGEGCTIFPQVTIYDGTLIGDRVVIHAGSVIGADGFGFAPQPDG 197

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            + KI  +G V I D  EIGAN+ IDR T+  T+I +  K+DN VQ+ HN  IG   +I 
Sbjct: 198 SYVKIPQMGVVEIGDDAEIGANATIDRATMGSTVIAKGVKVDNLVQVAHNCRIGEHTVIA 257

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD-IPAGQQYGGMPARPI 327
           +Q GI+GST +G   +IGGQ G AG+L++ D   +A+++GV K  +  G    G PA+P+
Sbjct: 258 AQAGISGSTIMGRGCMIGGQAGFAGHLELADRTHVAAQAGVSKSFLEPGTALRGYPAQPM 317

Query: 328 GEYLRHMVMLSK--PSKYKIKR 347
            E LRH  ML      K KI R
Sbjct: 318 REQLRHEAMLRHLGSMKEKIDR 339


>gi|194334298|ref|YP_002016158.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Prosthecochloris aestuarii DSM 271]
 gi|194312116|gb|ACF46511.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Prosthecochloris aestuarii DSM 271]
          Length = 357

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 117/319 (36%), Positives = 170/319 (53%), Gaps = 9/319 (2%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI-VPFIPKNIPCLLSD 90
           G+  I   + I +AS G+++++ + K+   I   KAS +I S+ + V      +  L   
Sbjct: 23  GDVAITGPARIEQASKGNVTFVANEKYSKYISTTKASLLIVSRQMPVDQYSDRLTFLKVK 82

Query: 91  KPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            P  +F     IL   A     +S   GI+P A +G +V +   V I   AV+  G  IG
Sbjct: 83  DPYTAFVF---ILKKFAAPRRLAS--PGIAPTAVVGSNVSMGSNVSIGDYAVIGDGCTIG 137

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSD 209
               + P  V+  GV +G  C +      Y ++ IGN V LHSGV IG DGFG+A     
Sbjct: 138 DNAIIAPHCVLMDGVSLGDGCMLFPHVVCYDAVRIGNRVTLHSGVVIGADGFGFAPQSDG 197

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            + KI  +G V I D VE+GAN+ IDR T+  T++    KIDN VQIGHN  IG   +I 
Sbjct: 198 SYIKIPQMGIVEIGDDVEVGANTTIDRATMGSTVVEHGAKIDNLVQIGHNCRIGNDTVIA 257

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP-AGQQYGGMPARPI 327
           SQ G++GS  IG   +IGGQ G+AG+L + D+ Q+A+K+G+ K     GQ   G PA+ +
Sbjct: 258 SQTGVSGSVSIGSQCMIGGQVGMAGHLSLADHTQVAAKAGITKSFTRPGQVLRGYPAQTM 317

Query: 328 GEYLRHMVMLSKPSKYKIK 346
            E LR  V++    + K +
Sbjct: 318 KEQLRQEVLIRNLDRMKTR 336


>gi|153870285|ref|ZP_01999718.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Beggiatoa sp. PS]
 gi|152073250|gb|EDN70283.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Beggiatoa sp. PS]
          Length = 340

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 113/326 (34%), Positives = 175/326 (53%), Gaps = 16/326 (4%)

Query: 13  IALMKLAQSIGASL---LDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASA 69
           ++L +LA  IGA L   L EN     I  ++ +  A T  +S+  +  +   + K +A+A
Sbjct: 4   LSLAELATHIGAKLEGILTENV---PIIGIASLRCAGTQQVSFFANGLYREQLSKTRAAA 60

Query: 70  IICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDV 129
           +I +     F    +P L+ + P + +A A     P            GI P A++  + 
Sbjct: 61  VILASKEKRFC--QVPMLVMENPYLGYARAARFFNP------PPQISPGIHPSAYVSPEA 112

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSV 188
            +   V I P AV+  G  +G++  +GPG VI  GV++   C + A  ++ + + +G  V
Sbjct: 113 ILAPTVSIGPQAVIEAGAILGQQVQIGPGCVISQGVQLEDECQMMANVTLCTGTRLGKRV 172

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           I+H G  IG DGFG A       K+  +G V+I D VEIGAN+ ID+G +++T+IG+  K
Sbjct: 173 IIHPGAVIGADGFGNANDNGQWVKVPQLGGVLIADDVEIGANTTIDKGALENTVIGQGVK 232

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DNQ+QIGHNV IG    I   VG+AGST IG   +IGG  GI+G+L++ D V + + S 
Sbjct: 233 LDNQIQIGHNVQIGEHTAIAGCVGVAGSTRIGRYCMIGGGVGISGHLELVDYVHVTAGSI 292

Query: 309 VLKDIPAGQQY-GGMPARPIGEYLRH 333
           VL+ I     Y  G P +P   + R+
Sbjct: 293 VLQSIRTPGVYSSGTPLQPNSRWHRN 318


>gi|116621963|ref|YP_824119.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Solibacter usitatus Ellin6076]
 gi|116225125|gb|ABJ83834.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 342

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 110/330 (33%), Positives = 171/330 (51%), Gaps = 13/330 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + + +LA+ +GA+   E  GER +  ++ +  A T +++++ +RK     E   A  +I 
Sbjct: 1   MRVRELAEWLGATF--EGDGERELTGVATLESAGTEEVAFVGNRKAAEMAEASAAGCLIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             +     P     + + +P  +FA A +  YP A        + G+ P A +G+DV++ 
Sbjct: 59  PMEWPS--PAYRTVIRAAEPRTAFARAMNRFYPTA------ELKPGVHPTAVVGKDVEMA 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
             V + P A V  G  IG  + +G G ++G  V+I   C +    ++Y ++ IG   +LH
Sbjct: 111 AMVYVGPHATVGDGTRIGVASSIGAGCIVGKRVQIAEGCVLHPNVTVYDNVDIGRGSVLH 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG DGFGY       HK   +GRV I D VEIGANS +DR  +  T IGE TK+DN
Sbjct: 171 SGCVIGADGFGYVMEHGRWHKFPQVGRVEIGDFVEIGANSCVDRAALGVTSIGEGTKLDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL- 310
            V +GHN  IG   ++ +Q G +G   + D  +IGGQ GI    +I     + S  GVL 
Sbjct: 231 MVHVGHNCRIGKHVVVAAQTGFSGGVVVEDYAVIGGQVGIGDKARIETRAVLGSGCGVLT 290

Query: 311 -KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            K + +G+   G PARP+  +L  +  L +
Sbjct: 291 SKIVRSGETVWGTPARPLKRHLEELASLGR 320


>gi|182414152|ref|YP_001819218.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Opitutus terrae PB90-1]
 gi|177841366|gb|ACB75618.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Opitutus terrae PB90-1]
          Length = 353

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 105/299 (35%), Positives = 162/299 (54%), Gaps = 15/299 (5%)

Query: 34  RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPK-NIPCLLSDKP 92
             I  ++P+  A+ GD+S++ + K+  ++   +AS ++   D  P  P+ N   L+   P
Sbjct: 25  ETIRGIAPLQEAAAGDLSFLGNAKYKADVAGTRASLVLLPPDY-PGQPQPNQLFLIVANP 83

Query: 93  EVSFA-IAGSILYPQAMHMEASSFEG---GISPQAFLGEDVKIEDGVVIAPMAVVYPGVE 148
            V+ A + G        H+E  ++     G+ P A +  D  +     + P  V+  G  
Sbjct: 84  SVALARLCG--------HIEQQTWPTPVPGVHPLASVAADAHVAPSATVGPFCVIESGAV 135

Query: 149 IGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGV 207
           IG  T++     +G   +IG  C I  G  I S  ++G  V LH+GV IG+DGFGY    
Sbjct: 136 IGEGTHLQAQVFVGRNAQIGAKCWIAPGVVIQSECVVGERVRLHAGVVIGSDGFGYEFVA 195

Query: 208 SDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
               K+  +G V+I++ VEIGAN  IDR     T+IGE TK+DN VQIGHNV +G  C++
Sbjct: 196 GRHEKVPQVGTVVIENDVEIGANCTIDRARFSRTVIGEGTKLDNLVQIGHNVIVGKHCLL 255

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
            +QVGI+GST +GD V++GGQ G+ G++ IG  V+   +SG+   +  G    G P+ P
Sbjct: 256 CAQVGISGSTTVGDYVVLGGQAGVGGHITIGKGVKAGGQSGISTSVEPGSFVNGTPSLP 314


>gi|260866328|ref|YP_003232730.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|257762684|dbj|BAI34179.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|323176494|gb|EFZ62086.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 1180]
          Length = 341

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/324 (36%), Positives = 176/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDTII
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTII 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
              S V++ I     Y  G+P +P
Sbjct: 286 TGMSMVMRPITEPGVYSSGIPLQP 309


>gi|297580893|ref|ZP_06942818.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae RC385]
 gi|297534719|gb|EFH73555.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae RC385]
          Length = 351

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 171/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPSPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  +G   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGLNVSIGANAVIESGVQLGDNVVIGAGCFVGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGAVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTIIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|92112706|ref|YP_572634.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chromohalobacter salexigens DSM 3043]
 gi|119371927|sp|Q1R023|LPXD_CHRSD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|91795796|gb|ABE57935.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chromohalobacter salexigens DSM 3043]
          Length = 347

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 111/331 (33%), Positives = 176/331 (53%), Gaps = 15/331 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
             L +LA+ + A L+ ++  +R +  L+ +  A   DI+++ ++ +L  +   +A+A++ 
Sbjct: 9   FTLGELAERLKARLVGDS--DRRVTGLATLLDAGPNDITFLANKTYLKYLPDTRAAAVL- 65

Query: 73  SQDIVPFIPKNIPC--LLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
              + P    + PC  L  + P + +A    +  P A          G+ P A + E  +
Sbjct: 66  ---VHPAHGTDAPCARLELENPYLGYAELSRLFDPLAGQAPE-----GVHPSAVVAESAR 117

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVI 189
           I + V + P  V+  G  IG    +G GS++GA   IG +  + A  ++Y  + +G   I
Sbjct: 118 IGEHVSVGPQCVIEAGAVIGDGCVIGAGSIVGADSEIGADSRLHANVTVYHGVSVGRRAI 177

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           LHSG  IG DGFG+A      HKI  +G VI+ D VEIG+ S+IDRG + DT+IG + KI
Sbjct: 178 LHSGCVIGADGFGFAHDGQGWHKIAQLGGVIVGDDVEIGSCSSIDRGALGDTVIGNDVKI 237

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           D+QVQI HNV IG    +   VGIAGST +G + ++GG  G++G+L + D VQ+   S V
Sbjct: 238 DSQVQIAHNVQIGDHSALAGCVGIAGSTRVGSHCMLGGGVGLSGHLTLCDGVQVTGMSLV 297

Query: 310 LKDI-PAGQQYGGMPARPIGEYLRHMVMLSK 339
              I   G    G  A P G + ++ V   +
Sbjct: 298 TNSIHEPGVYSSGTGAMPNGLWRKNAVRFKQ 328


>gi|284008510|emb|CBA75025.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Arsenophonus nasoniae]
          Length = 342

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 169/316 (53%), Gaps = 12/316 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G  +I S++P+  A  G I+++   ++L  + KCKA+A++ 
Sbjct: 4   IRLADLAQKLDAQLHGD--GNIIITSIAPMHLAKEGQITFLSDSRYLTQLAKCKAAAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            Q  +P     I  L+   P +++A    IL       +       I P A + EDV++ 
Sbjct: 62  KQKDLP--DSKIAALVVKDPYLAYARLAQILDTTPKPAQ------NIHPSAVIAEDVQLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           + V +   AV+  GV +G +  +G G  IG  VRIG++  + A  SIY ++ IG   ++ 
Sbjct: 114 EDVAVGANAVIESGVTLGNQVIIGAGCFIGKNVRIGQSTRLWANVSIYHNVEIGKQCLIQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA       KI  +G VII + VEIGA + IDRG +D+TIIG    IDN
Sbjct: 174 SGTVIGSDGFGYANEKGQWVKIPQLGTVIIGNNVEIGACTTIDRGALDNTIIGNGVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q QI HNV IG    I   V +AGS  IG   +IGG   I G+++I D V I     V++
Sbjct: 234 QCQIAHNVIIGDHTAIAGGVVMAGSLKIGQYCMIGGASVINGHMEICDKVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARP 326
            I     Y  G+P +P
Sbjct: 294 PISEPGIYSSGIPLQP 309


>gi|325287867|ref|YP_004263657.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cellulophaga lytica DSM 7489]
 gi|324323321|gb|ADY30786.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cellulophaga lytica DSM 7489]
          Length = 341

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 106/312 (33%), Positives = 167/312 (53%), Gaps = 8/312 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  +++L+ I     G ++++ + K+  ++   +AS  I ++D  P   K     L    
Sbjct: 21  EITVHTLAKIEEGKAGSLTFLANPKYTPHLYTTEASITIVNKDFSP--EKEFTTTLIKVE 78

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
           +   +    + Y   +  + S    GI    ++ E     + V +     +   V IG+ 
Sbjct: 79  DAYQSFTKLLTYYDQVKNDKS----GIEQPVYVDESSSYGENVYLGAFTYIGKNVTIGKN 134

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVS-DI 210
             + P   I   V IG N S+ +G+ I S S+IGN+ ++H+GV IG+DGFG++       
Sbjct: 135 AKIYPNVYISDNVTIGDNVSLFSGAKICSDSIIGNNCVIHTGVIIGSDGFGFSPNTDGTF 194

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  IG VI++D V++GA + IDR T+  TII +  K+DNQ+QI HNV IG   +I +Q
Sbjct: 195 TKIPQIGNVILEDNVDVGAGTTIDRATMGSTIIKKGVKLDNQIQIAHNVEIGENTVIAAQ 254

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAGST IG N +IGGQ GI G++ IGDNV+I ++SG+ K+I   +   G PA   G++
Sbjct: 255 TGIAGSTKIGKNCMIGGQVGIVGHISIGDNVRIQAQSGIGKNIKDNEVLQGSPAMNYGDF 314

Query: 331 LRHMVMLSKPSK 342
            +  V      K
Sbjct: 315 NKSYVHFKNLPK 326


>gi|163755584|ref|ZP_02162703.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [Kordia
           algicida OT-1]
 gi|161324497|gb|EDP95827.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [Kordia
           algicida OT-1]
          Length = 342

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 107/306 (34%), Positives = 164/306 (53%), Gaps = 8/306 (2%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           LS I   + G ++++ + K+   I   +AS  I ++D      + +   L    +   + 
Sbjct: 27  LSKIEEGTEGSLTFLANPKYTQYIYSTRASITIVNKDFAA--EEELTTTLIKVEDAYKSF 84

Query: 99  AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPG 158
           +  + Y   + +       GI   AF+ E       +     + +   V+IG    V P 
Sbjct: 85  SKLLEYYNKVKLNKV----GIEQPAFISETASYGKELYFGAFSYMGDNVQIGDYVKVYPN 140

Query: 159 SVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVS-DIHKIVHI 216
           + IG  V IG N  I AG+ IYS S+IG++ ++HSG  +G DGFG+A     +  K+   
Sbjct: 141 AYIGDNVTIGNNVVIFAGAKIYSESVIGDNCVIHSGAIVGADGFGFAPNEKGEYQKVPQT 200

Query: 217 GRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGS 276
           G VI++  V+IGA + IDR T+  TII +  K+DNQ+QI HNV IG   +I +Q GIAGS
Sbjct: 201 GNVILEANVDIGAGTTIDRATLGSTIIRKGVKLDNQIQIAHNVEIGKNTVIAAQTGIAGS 260

Query: 277 TYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVM 336
           T IG+N +IGGQ GI G++ IGDNV+I ++SG+ ++I  G+   G PA   G+Y +  V 
Sbjct: 261 TKIGENCMIGGQVGIVGHITIGDNVKIQAQSGIGRNIKDGETLQGSPALNYGDYNKSYVY 320

Query: 337 LSKPSK 342
                K
Sbjct: 321 FKNLPK 326


>gi|229528747|ref|ZP_04418137.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae 12129(1)]
 gi|254286442|ref|ZP_04961399.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae AM-19226]
 gi|150423391|gb|EDN15335.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           cholerae AM-19226]
 gi|229332521|gb|EEN98007.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           cholerae 12129(1)]
          Length = 351

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 170/326 (52%), Gaps = 20/326 (6%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    FG+   ++ +++P+ +A  G ++++ + K+  ++  C A+ I
Sbjct: 4   LTLAELATITGGEL----FGDPTALVSAVAPMDKAQLGHVTFLSNPKYSKHLGDCTATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGED 128
           +         P N   L+   P V+FA     L   P   H        GI+P A + ED
Sbjct: 60  MVKASERELCPSN--ALVVADPYVAFAKVAQALDSTPYPAH--------GIAPSAVIAED 109

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNS 187
            K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+ 
Sbjct: 110 AKLGHNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSD 169

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N 
Sbjct: 170 CLIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNV 229

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
            IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   I G+++I D V I    
Sbjct: 230 IIDNQLQIAHNVHIGYGSALAGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMG 289

Query: 308 GVLKDIPAGQQY-GGMPARPIGEYLR 332
            V++ I     Y  G+P +   E+ +
Sbjct: 290 MVMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|319955641|ref|YP_004166908.1| udp-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Cellulophaga algicola DSM 14237]
 gi|319424301|gb|ADV51410.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cellulophaga algicola DSM 14237]
          Length = 342

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 112/332 (33%), Positives = 175/332 (52%), Gaps = 11/332 (3%)

Query: 16  MKLAQSIGASLLD---ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           MK   S  A +L+   E   +  +  L+ I     G ++++ + K+  +I   K+S  I 
Sbjct: 1   MKFTASQIAGILEGELEGNPDITVNKLAKIEEGEQGSLTFLANPKYTQHIYTTKSSITIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           ++D V         +  D    SF+    +L     + +  + + GI   +F+       
Sbjct: 61  NRDFVAEHDLTTTLIKVDDAYESFS---KLL---EYYNQVKNNKTGIESPSFIAASTTYG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
               +   A +   V +G    + P   +G  V +G N  + AG+ IYS S+IGN+ ++H
Sbjct: 115 KDCYVGAFAYIGENVILGDNVKIYPNVYVGDNVHLGDNVIVFAGAKIYSESIIGNNCVIH 174

Query: 192 SGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SGV +G+DGFG+A     +  K+   G VII+D V+IGA + IDR T+  TII +  K+D
Sbjct: 175 SGVIVGSDGFGFAPNADGEYKKVPQTGNVIIEDNVDIGAGTTIDRATLGSTIIRKGVKLD 234

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           NQ+QI HNV IG   +I +Q G+AGST IG + LIGGQ GI G++ IGDNV+I ++SG+ 
Sbjct: 235 NQIQIAHNVEIGEHTVIAAQTGVAGSTKIGKHCLIGGQVGIVGHITIGDNVRIQAQSGIG 294

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           K+I  G+   G PA   G++ +  V      K
Sbjct: 295 KNIKTGEIIQGSPALNYGDFYKSYVHFKNLPK 326


>gi|149374427|ref|ZP_01892201.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Marinobacter algicola DG893]
 gi|149361130|gb|EDM49580.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Marinobacter algicola DG893]
          Length = 345

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 161/311 (51%), Gaps = 11/311 (3%)

Query: 4   LNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIE 63
           +   ++ +   L  +A  +GA L      E  I  L+ +  AS G I+++ +  +   + 
Sbjct: 1   MELKMTKRSYRLGDIASELGAELKGNPDTE--INGLATLQAASPGQIAFLANPSYGRYLA 58

Query: 64  KCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQA 123
           +  ASA+I SQ      P N+  LL D P + +A       P      A   E GI P A
Sbjct: 59  ETSASAVILSQSTADQCPTNV--LLLDNPYLGYARLSHWFDP------APVAEPGIHPSA 110

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL 183
            +    ++ D   I P AVV     +G    VG G +IGA  +IG    +    ++   +
Sbjct: 111 VVASSARVSDTACIGPQAVVEAEAVVGDNVVVGAGCIIGARCQIGEQTILRPRVTLAHDI 170

Query: 184 I-GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTI 242
           + G    + SG  IG+DGFG+A      H+I  +GRVI+ D VE+GAN+ IDRG +DDT+
Sbjct: 171 VMGKRCHILSGAVIGSDGFGFANEKGAWHRIAQLGRVILGDDVEVGANTTIDRGALDDTV 230

Query: 243 IGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQ 302
           IG+  K+DN +QI HNV IG    + + VGIAGST IG + + GGQ G+AG+L I D V 
Sbjct: 231 IGDGVKLDNLIQIAHNVSIGDHSAMAAMVGIAGSTRIGSHCVFGGQSGVAGHLTIADQVH 290

Query: 303 IASKSGVLKDI 313
           +   + V  DI
Sbjct: 291 LTGMTLVSGDI 301


>gi|171909621|ref|ZP_02925091.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Verrucomicrobium spinosum DSM 4136]
          Length = 350

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 118/336 (35%), Positives = 170/336 (50%), Gaps = 22/336 (6%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L++LA+ +G +   +      I   + +  A  GD+++    ++  ++   +AS ++ 
Sbjct: 3   ITLLELAELLGVTPPADG-ANVSITGFASLGDARPGDLTFFSDARYRQHLSSTQASVVLV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGE-DVKI 131
           + D    +P ++  L+   P  +F         Q    + +    GI P A + E D   
Sbjct: 62  TAD-CGQVPDHLTALVVPNPPAAFE-----KVVQKYGFQPTPAVPGIHPTAVVAEPDFGG 115

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------I 184
             G+ I   AVV  GV +G         +IGAG  +G N  IG G+ +Y ++       I
Sbjct: 116 STGISIGAHAVVEAGVRLGNNV------IIGAGCYVGHNVEIGEGTRLYPNVTVQEACQI 169

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G  V +HS   IG DGFGY     +  K+   G V I D VEIGA + IDR     T IG
Sbjct: 170 GRRVTIHSNTVIGADGFGYEFVNGEHRKVRQTGIVQIDDDVEIGAGTTIDRARFGRTWIG 229

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
           + TKIDNQVQ+ HNV +G  C+IV+ VGI GS  IGD V+IGGQ GI  ++KIG    IA
Sbjct: 230 QGTKIDNQVQVAHNVVVGKHCVIVASVGICGSVQIGDYVVIGGQVGIIEHVKIGSGASIA 289

Query: 305 SKSGVLKDIPAGQ-QYGGMPARPIGEYLRHMVMLSK 339
           +++ V KD+P G+  Y G PA P  E  R M    K
Sbjct: 290 ARTVVTKDLPPGRAAYMGFPAAPAKEERRRMAAARK 325


>gi|189423831|ref|YP_001951008.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter lovleyi SZ]
 gi|189420090|gb|ACD94488.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Geobacter lovleyi SZ]
          Length = 345

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 115/327 (35%), Positives = 180/327 (55%), Gaps = 12/327 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L +LA  +G ++  +  G   I  L+P+  A+   ++++ + K+   +   KA  ++ +
Sbjct: 5   TLQELADYLGGTVRGD--GTVKINGLAPLEGAAPDKVTFLANPKYAAKVADTKAGGVLMA 62

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
                +  +NI  L +  P + FA   ++ Y Q  H        G+ P+A +G +V + +
Sbjct: 63  PGGESY-GRNIIELAN--PYLGFAKLLTLFYTQP-HPPL-----GVLPEAVVGINVALGE 113

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
           G+ I P AV+   V IG +  V PG+VI  GV IG +C I A + I     +G    L  
Sbjct: 114 GISIYPGAVIGNNVSIGDRVVVYPGAVIYDGVVIGDDCVIHANAVIRERCRLGKRCKLQP 173

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
           G  +G+DGFGYA      + I  IG V+++D VEIGAN+ +DR  ++ T+I   TK+DN 
Sbjct: 174 GAVVGSDGFGYAPDGPSYYPIPQIGIVVLEDDVEIGANATVDRAALEVTLIRRGTKLDNL 233

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           VQ+ HN  IG   ++ SQVGI+GS+ IG++V + GQ G+AG+L IGDNV + ++SGV   
Sbjct: 234 VQVAHNCQIGEDTMLCSQVGISGSSKIGNHVTLTGQVGVAGHLTIGDNVIVGAQSGVPGS 293

Query: 313 IPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +     Y G P  P  E+LR M  L +
Sbjct: 294 LEGNAYYSGTPTMPHKEWLRVMGTLPR 320


>gi|71907382|ref|YP_284969.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dechloromonas aromatica RCB]
 gi|119371930|sp|Q47F82|LPXD_DECAR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|71847003|gb|AAZ46499.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dechloromonas aromatica RCB]
          Length = 347

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 180/338 (53%), Gaps = 26/338 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L  +A  +G  +L ++  +  I  ++P+A A  GDI+++ + KF + +  CKASA+I 
Sbjct: 9   LTLADIAAQLGGDVLGDS--QTPISRVAPLATAGEGDITFLANPKFRSQLSACKASAVIL 66

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D+    P   P +++  P   +A   ++L P    +       G+   A +  +  + 
Sbjct: 67  RPDVAEEFPG--PRIVTGNPYAYYARVATLLNPYQSGLS------GVHASAVV--ESPVP 116

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
           D V IAP       V IG+   +G   VI AG  IG   SIGAG+ +Y+++       IG
Sbjct: 117 DSVAIAP------NVYIGKDVTLGENVVINAGCVIGDGVSIGAGTVLYANVTVYYGCSIG 170

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
              I+HSG  IG+DGFG+A       KI  IGRV+I + VEIGAN+ IDRG ++DT+IG+
Sbjct: 171 QQCIIHSGAVIGSDGFGFAPEGQSWIKIPQIGRVVIGNDVEIGANTTIDRGALEDTVIGD 230

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
             K+DN V IGHN  IG   ++    G+AGST  G++ ++GG   I+G+L I     I+ 
Sbjct: 231 GCKLDNLVHIGHNCKIGNNSVLAGCTGVAGSTVFGEHCVVGGAGMISGHLNIAAGTTISG 290

Query: 306 KSGVLKDIPAGQQYGGM-PARPIGEYLRHMVMLSKPSK 342
            + V+K I     Y  + P     E+LR+   + + SK
Sbjct: 291 GTTVMKSILNPGVYTSVFPLDTHEEWLRNASHIRRLSK 328


>gi|110597919|ref|ZP_01386201.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chlorobium ferrooxidans DSM 13031]
 gi|110340496|gb|EAT58982.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chlorobium ferrooxidans DSM 13031]
          Length = 351

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/320 (36%), Positives = 170/320 (53%), Gaps = 11/320 (3%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV--PFIPKNIPCLLS 89
           GE  I   + I  A  G +S+I + K++  +   +AS +I  + +    F  K     +S
Sbjct: 23  GEGKITGPAKIELAGPGQVSFIANEKYIRFLGTTEASLVIVHRSVSVDEFTEKRSFLKVS 82

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           D P  +F     I  P  +         GI+  A +G    I DGV +   AV+     I
Sbjct: 83  D-PYTAFVFLLKIFAPPRVITAP-----GIASSAVIGSGTTIADGVSVGEYAVIGDNCSI 136

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYA-RGV 207
           GR T +G  SV+  GV +G +  +    ++Y  + +GN V++HSG  IG DGFG+A +  
Sbjct: 137 GRNTVIGSHSVLLNGVTLGEDVLLFPRVTLYEGTALGNRVVVHSGSVIGADGFGFAPQSD 196

Query: 208 SDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
               KI  +G V I D VEIGANS IDR T+  T+IG   KIDN VQI HN  IG   +I
Sbjct: 197 GSYVKIPQMGVVEIGDDVEIGANSTIDRATMGSTVIGRGVKIDNLVQIAHNCTIGDDTVI 256

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD-IPAGQQYGGMPARP 326
            +Q GI+GS  +G + LIGGQ G AG+L++ DN+Q+A+K+G+ K  +  G    G PA+P
Sbjct: 257 AAQAGISGSVVVGRHCLIGGQAGFAGHLELADNIQVAAKTGISKSFMQPGTVLRGTPAQP 316

Query: 327 IGEYLRHMVMLSKPSKYKIK 346
           + + L+   M+      K K
Sbjct: 317 MRDQLKLEAMMRNLGAMKEK 336


>gi|91209249|ref|YP_539235.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli UTI89]
 gi|117622464|ref|YP_851377.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli APEC O1]
 gi|218557120|ref|YP_002390033.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli S88]
 gi|237704338|ref|ZP_04534819.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia sp. 3_2_53FAA]
 gi|119371934|sp|Q1RG10|LPXD_ECOUT RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|91070823|gb|ABE05704.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase; third
           step of endotoxin (lipidA) synthesis [Escherichia coli
           UTI89]
 gi|115511588|gb|ABI99662.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli APEC O1]
 gi|218363889|emb|CAR01554.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli S88]
 gi|226902250|gb|EEH88509.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia sp. 3_2_53FAA]
 gi|294490697|gb|ADE89453.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli IHE3034]
 gi|307629755|gb|ADN74059.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli UM146]
 gi|315285254|gb|EFU44699.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 110-3]
 gi|323950822|gb|EGB46699.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H252]
 gi|323955140|gb|EGB50915.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H263]
          Length = 341

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 175/322 (54%), Gaps = 24/322 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +QD +PF       L+   P +++A    IL       +       I+P A + E  K+ 
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPKPAQ------NIAPSAVIDETAKLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
           + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       IG
Sbjct: 114 NNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG 167

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
            + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+IG 
Sbjct: 168 QNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVIGN 227

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
              IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +  
Sbjct: 228 GVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTG 287

Query: 306 KSGVLKDIPAGQQY-GGMPARP 326
              V++ I     Y  G+P +P
Sbjct: 288 MGMVMRPITEPGVYSSGIPLQP 309


>gi|17230566|ref|NP_487114.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Nostoc
           sp. PCC 7120]
 gi|20138623|sp|Q8YSL0|LPXD_ANASP RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|17132168|dbj|BAB74773.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Nostoc
           sp. PCC 7120]
          Length = 349

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 173/328 (52%), Gaps = 11/328 (3%)

Query: 25  SLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD---IVPFIP 81
           SL      +  I  ++ I  A++ ++SYI   KF + I +  ASA+I  Q+         
Sbjct: 16  SLTQNPNNDPEITGMAAIDEATSANLSYIEGAKFASFIAQTNASALILPQNEAMQAQAQA 75

Query: 82  KNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMA 141
           + I  + + +P + FA A ++ Y      +  +    I P A +    KI + V I P  
Sbjct: 76  RGIVWMTTPEPRLLFAKAIALFY------QPYTPTPEIHPTAVIHPTAKIGNDVYIGPHV 129

Query: 142 VVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDG 200
           V+ PGVEIG    + P  VI   V+IG    + A  +I   S IG   I+HSG  IG +G
Sbjct: 130 VIQPGVEIGNGVIIHPNVVIYPYVKIGDRSILHANCTIEERSQIGADCIIHSGAVIGGEG 189

Query: 201 FGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVH 260
           FG+    +  +K+   G V+++D+V+IG N+ IDR ++ +T +G +TKIDN VQI H   
Sbjct: 190 FGFVPTRTGWYKMEQSGYVVLEDRVDIGCNTTIDRPSVGETRVGYDTKIDNLVQIAHGCQ 249

Query: 261 IGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYG 320
           IG GC I +Q G+AG   +G  V++ GQ GIA   K+GD    ++++G+L D+  G+   
Sbjct: 250 IGAGCAIAAQTGMAGGVKLGKRVILAGQVGIANQAKMGDGSTASAQTGILHDVKPGEVVS 309

Query: 321 GMPARPIGEYLRHMVMLSK-PSKYKIKR 347
           G PA P   YL+   + S+ P  Y+  R
Sbjct: 310 GTPAIPHKIYLKIGAIYSRLPEMYQAFR 337


>gi|296273312|ref|YP_003655943.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Arcobacter nitrofigilis DSM 7299]
 gi|296097486|gb|ADG93436.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Arcobacter nitrofigilis DSM 7299]
          Length = 313

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/317 (31%), Positives = 168/317 (52%), Gaps = 32/317 (10%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  I  L+ +  ++  +++++ + K+ N++EK  A+A++  +D V  +PKN   L+ D+P
Sbjct: 17  EIEISGLNTLVDSTANELTFLENSKYTNDLEKTTAAAVLVKKDFVTKVPKNTIALVCDEP 76

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV--VIAPMAVVYPGVEIG 150
            V  A+A  +  P+ +                        DG+  V+   + + P V +G
Sbjct: 77  YVKLALASKLFAPKLVE----------------------SDGIDCVVGDNSTIMPNVYLG 114

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFGY 203
           + + +G    I +G  I  N +IG  + IY ++       IGN  I+H+G  IG+DGFG+
Sbjct: 115 KNSIIGNNCTIMSGAYIADNVNIGNNTIIYPNVTVYRDCNIGNDCIIHAGTVIGSDGFGF 174

Query: 204 ARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGC 263
           A+      KI   G V I + VEIG+N++IDR     TII +  ++DN V IGHN  +G 
Sbjct: 175 AQSKGKYIKIYQNGNVEIGNDVEIGSNTSIDRAAFKSTIISDGVRLDNLVHIGHNCKLGV 234

Query: 264 GCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA-GQQYGGM 322
           GCI+  QVG++GS+ + + V++GGQ   +G+L+I     IA++ GV K I    +Q+ G 
Sbjct: 235 GCILTGQVGLSGSSILHEYVIMGGQSATSGHLEIAPFTTIAARGGVTKSIKEPKKQWAGF 294

Query: 323 PARPIGEYLRHMVMLSK 339
           P      +L+    +SK
Sbjct: 295 PLFEHKTWLKLQAKISK 311


>gi|224369341|ref|YP_002603505.1| LpxD [Desulfobacterium autotrophicum HRM2]
 gi|223692058|gb|ACN15341.1| LpxD [Desulfobacterium autotrophicum HRM2]
          Length = 350

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 163/295 (55%), Gaps = 25/295 (8%)

Query: 49  DISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLL--SDKPEVSFAIAGSILYPQ 106
           DI++    +FLN +++ +A A+I   D   F  + + C L  S  P + F        P 
Sbjct: 41  DITFADDPRFLNRLDQTRAGAVIVPWDFTGFDRETLTCSLVRSKNPRLHFFRIVERFNP- 99

Query: 107 AMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVR 166
                A     GI+P A +G++     G+ IAP      GV IG    +G    + AGV 
Sbjct: 100 -----AKKTVPGIAPTATIGKNFAGGKGITIAP------GVTIGDNVTLGDHVQLMAGVF 148

Query: 167 IGRNCSIGAGSSIY-------SSLIGNSVILHSGVRIGNDGFGY--ARGVSDIHKIVHIG 217
           +G N ++G+ + +         ++IG  VI+H G  IG+DGFG+  +RG+ +  K++H G
Sbjct: 149 VGDNVTMGSYTIVKPNVTIMDKTMIGQGVIIHPGTVIGSDGFGFTPSRGIHE--KLIHAG 206

Query: 218 RVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGST 277
            V I D+VEIGA + IDRGT+  T +    K DN V I HNV IG   +IV+QVGIAGST
Sbjct: 207 FVQIDDQVEIGACNTIDRGTLGRTWLQSGVKTDNLVHIAHNVVIGENTLIVAQVGIAGST 266

Query: 278 YIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR 332
            +G NV++ G+ GI+G+L IGDN  +   +GV+ D+P G+   G+P  P   +L+
Sbjct: 267 TLGKNVIVAGKAGISGHLTIGDNAIVGPGAGVVSDVPPGEIVSGVPQMPHKLWLK 321


>gi|327402278|ref|YP_004343116.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Fluviicola taffensis DSM 16823]
 gi|327317786|gb|AEA42278.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Fluviicola taffensis DSM 16823]
          Length = 348

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 172/308 (55%), Gaps = 12/308 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLS-DK 91
           E  +  L+ I    TG +S++ + K+   I   ++S  I +   VP   K +P  L+  K
Sbjct: 21  EITVNGLAKIEEGVTGTLSFLSNPKYEEYIYTTQSSICIVNSTFVP--SKALPQTLTLVK 78

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
            E ++A    +L    ++ +    +  I   +F+ E  KI +G+ +   A +   V IG+
Sbjct: 79  VEDAYACFAKLL---EVYNQMRQKQPKIEIPSFISESAKIGEGLYLGAFAYIGENVVIGK 135

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYA---RGV 207
              + P + IG G  IG +C+I AG  IY+ + IGN  +LH+GV IG+DGFG+A   +GV
Sbjct: 136 NVKIYPQAYIGDGTVIGDDCTIHAGVKIYADTKIGNRCVLHAGVVIGSDGFGFAPDEKGV 195

Query: 208 SDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII 267
               K+  IG VI++D VEIG+NS ID  T+  TI+ +  KIDN V + HNV +G    I
Sbjct: 196 --FSKVPQIGNVILEDDVEIGSNSTIDCATMGSTILRKGVKIDNLVHLAHNVEVGSHSAI 253

Query: 268 VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
            +Q G+AGS  IG +VL+GGQ GI+G+L + D  +I ++SG+   I   +   G PA P+
Sbjct: 254 AAQAGVAGSAKIGKHVLVGGQAGISGHLHVADGTRIVAQSGIPNTIKKAEILMGSPAIPM 313

Query: 328 GEYLRHMV 335
            +Y +  V
Sbjct: 314 DDYKKSFV 321


>gi|91761966|ref|ZP_01263931.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717768|gb|EAS84418.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 326

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 175/327 (53%), Gaps = 8/327 (2%)

Query: 6   FFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKC 65
           FF +     +  + Q I  + L+ +  ++ I  +  +  +   DI++  S+K+ N  +  
Sbjct: 5   FFRNCGPFKISDITQLINLNDLNID-NDQEINDIKDLLTSKKNDITFFHSKKYKNFAKNT 63

Query: 66  KASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFL 125
           KAS  + ++ +   +PK+   L+ +   VS +   S  YP +++         I+   F 
Sbjct: 64  KASFCLTTEILKDELPKSCTPLIVENVLVSTSKVTSKFYPTSINDNFDYTARDIAETKF- 122

Query: 126 GEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIG 185
                 +D        ++   V +G    +G  ++I   V IG NCSIG+   I ++LI 
Sbjct: 123 ------KDKAKYGNNVLIGDNVTLGSNCLIGHNTIIEQNVSIGDNCSIGSNVIIRNTLID 176

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
           N+V +     IG  GFG+        +  HIG VII +  EIG    IDRG++ +T+IG+
Sbjct: 177 NNVTVLDNCVIGKHGFGFFPINEKNLRYPHIGIVIIGENSEIGCGCTIDRGSMSNTVIGK 236

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
           N+ +DNQ+ I HNV IG   II  QVGIAGS+ IG+NV IGGQ GI+G+L IG+NV+IA 
Sbjct: 237 NSFLDNQIHIAHNVKIGDNSIIAGQVGIAGSSIIGNNVRIGGQAGISGHLTIGNNVEIAG 296

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLR 332
            SGV+KDI    +  G PA+ I ++L+
Sbjct: 297 GSGVIKDIKDNSKVMGYPAKNIRDFLK 323


>gi|224026395|ref|ZP_03644761.1| hypothetical protein BACCOPRO_03151 [Bacteroides coprophilus DSM
           18228]
 gi|224019631|gb|EEF77629.1| hypothetical protein BACCOPRO_03151 [Bacteroides coprophilus DSM
           18228]
          Length = 346

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/318 (33%), Positives = 166/318 (52%), Gaps = 11/318 (3%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN     +++ + I     G +S++ + K+ + I   ++S ++ ++D  P        +
Sbjct: 19  DEN---ATVHTFAKIEEGIPGALSFLSNPKYTHYIYDTQSSIVLVNKDFEPEHEIKATLI 75

Query: 88  LSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGV 147
             D    S A          ++  +   + GI P A +  + KI   V I P A +  G 
Sbjct: 76  KVDNAYESLAKL------MTLYEMSQPKKQGIDPLASIASNAKIGKDVYIGPFACIEEGA 129

Query: 148 EIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARG 206
            IG  TY+ P   +G   ++G N  +    +IY    IGN+ ILH+G  +G DGFG+A  
Sbjct: 130 IIGDNTYIHPHVTVGCNAKVGNNTILYPHVTIYHDCRIGNNCILHAGSVVGADGFGFAPS 189

Query: 207 VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCI 266
                KI  IG  I++D VEIGAN+ IDR T+  TII + TK+DN VQI HNV +G   +
Sbjct: 190 PEGYEKIPQIGIAILEDDVEIGANTCIDRATMGATIIHKGTKLDNLVQIAHNVEVGSHTV 249

Query: 267 IVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARP 326
           + SQ G+AGS  IG+  + GGQ G+AG++K+GD+V + ++SG+  +  +G    G PA  
Sbjct: 250 MASQAGVAGSAKIGEWCMFGGQVGVAGHIKVGDHVTVGAQSGIPGNTKSGSTLMGYPAID 309

Query: 327 IGEYLRHMVMLSK-PSKY 343
             ++ R   +  K P  Y
Sbjct: 310 PKQFARSAAIYKKLPDMY 327


>gi|302037955|ref|YP_003798277.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Candidatus Nitrospira defluvii]
 gi|300606019|emb|CBK42352.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Candidatus Nitrospira defluvii]
          Length = 360

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/334 (33%), Positives = 177/334 (52%), Gaps = 24/334 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +L   +G  L+     +  +  ++ +  A  GD++++ S + L + +     A++ 
Sbjct: 10  LTLRELHSYVGGELVGSP--DATVTGVASLEEAGPGDLAFLTSERNLKSPQTAVIGALLV 67

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            + + P  P   P L+ D P  +FA A    + +           GI+     GEDV   
Sbjct: 68  GRRL-PDCPS--PQLVVDNPAYAFARAAQQFFTRPTRSR------GIAQGITRGEDV--- 115

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-------G 185
               I   A ++PGV +G +  +G    +  GV IG +  IG  + +Y +++       G
Sbjct: 116 ---TIGADASIWPGVTVGDRVSIGARVTLYPGVFIGDDSVIGDDALLYPNVVVREGCRLG 172

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
             VI+HSG  IG+DGFGY +      KI  +G V+I+D VE+G+N +IDR T  +T+I  
Sbjct: 173 ARVIVHSGTVIGSDGFGYVQYQGRHQKIPQLGGVLIEDDVELGSNVSIDRATFGNTVIKR 232

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
            TKIDN VQI HNV +G   I+V+QVGIAGST +G  V++GGQ G+A +L+IGD V IA+
Sbjct: 233 GTKIDNLVQIAHNVTVGEHNILVAQVGIAGSTTLGKYVMVGGQAGLADHLQIGDQVMIAA 292

Query: 306 KSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           KSGV + +   Q   G P      +L+   ++ +
Sbjct: 293 KSGVTRSLEPNQIVSGAPVMAHATFLKAQAVIPQ 326


>gi|258621006|ref|ZP_05716040.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           mimicus VM573]
 gi|258586394|gb|EEW11109.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           mimicus VM573]
          Length = 377

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 113/323 (34%), Positives = 173/323 (53%), Gaps = 14/323 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA   G  L  +     ++ +++P+ +A  G+++++ + K+  ++  CKA+ I+ 
Sbjct: 4   LTLAELATITGGELYGDPAA--LVSAVAPMDKAQLGNVTFLSNPKYSKHLSDCKATVIMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGISPQAFLGEDVKI 131
                   P N   L+   P V+FA        QA+    A ++  GI+P A + ED K+
Sbjct: 62  KASERELCPGN--ALVVADPYVAFA-----KVTQALDSTPAPAY--GIAPSAVIAEDAKL 112

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
              V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+  ++
Sbjct: 113 GSNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSDCLI 172

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
            SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N  ID
Sbjct: 173 QSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNVIID 232

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           NQ+QI HNVHIG G  +     IAGST IG   +IGG   + G+++I D V I     V+
Sbjct: 233 NQLQIAHNVHIGYGSALAGGTIIAGSTRIGKYCIIGGASVLNGHIEIADGVTITGMGMVM 292

Query: 311 KDIPAGQQY-GGMPARPIGEYLR 332
           + I     Y  G+P +   E+ +
Sbjct: 293 RSIEEKGMYSSGIPLQTNKEWRK 315


>gi|312883818|ref|ZP_07743537.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309368567|gb|EFP96100.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 343

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/322 (33%), Positives = 174/322 (54%), Gaps = 12/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           ++L +LA     +L  +   +  + +++P+ +A  GD++++   K+   + +CKAS ++ 
Sbjct: 4   LSLAELASITSGTLYGD--ADVTVSAVAPMQKAQEGDVTFLSDAKYAKYLPECKASVVMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            ++       N+  L+ + P V+FA     L    +  +       I   A +  DVK+ 
Sbjct: 62  KENQRELCQSNV--LVVEDPYVAFARVVQALDSTPLPADK------IEASAVIASDVKLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILH 191
            GV I   AV+  GVE+G    +G G  IG G +IG N  + A  SIY  +I G+  ++ 
Sbjct: 114 TGVCIGANAVIETGVELGDNVIIGAGCFIGKGAKIGANTKLWANVSIYHDVILGSECLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG+DGFGYA    +  KI  +G V I ++VEIGA ++IDRG ++DT+I +N  IDN
Sbjct: 174 SNAVIGSDGFGYANDKGEWIKIPQLGSVKIGNRVEIGACTSIDRGALEDTVIEDNVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNVHIG G  +     +AGST IG   +IGG   + G+++I D V I     V++
Sbjct: 234 QLQIAHNVHIGYGSAMAGGTIVAGSTKIGKYCMIGGASVLNGHIEITDGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            I     Y  G+P +P  E+ +
Sbjct: 294 SIDQKGVYSSGIPLQPNKEWRK 315


>gi|332097585|gb|EGJ02562.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella dysenteriae 155-74]
          Length = 341

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 176/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ+           I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQSAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|198283294|ref|YP_002219615.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667954|ref|YP_002425882.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247815|gb|ACH83408.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520167|gb|ACK80753.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 353

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 122/332 (36%), Positives = 170/332 (51%), Gaps = 27/332 (8%)

Query: 11  KGIALM-KLAQSIGASLL-DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKAS 68
           +G+ L+  LAQ  GA L  D  +    I +++P+  A +GD+++         ++  KA 
Sbjct: 3   RGVYLLGDLAQVAGAELRGDAGY---QISAVAPLDTAGSGDLTFYHDMHLRGLLKTSKAG 59

Query: 69  AI-ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAM------HMEASSFEGGISP 121
           AI I  +D   F       LL+D P  +FA     +YPQ        H    + +  + P
Sbjct: 60  AILIAPRDAEQFSGNR---LLTDNPYAAFARVMQHIYPQVAPRPGLHHTAQLARDAQVDP 116

Query: 122 QAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS 181
            A +   V+I  G VIA    +  G  +G    VG GS +  GV+I   C +GAG     
Sbjct: 117 DARIDAHVQIGAGAVIAKGVWLEAGTFVGAGAEVGQGSHLYPGVKIYGGCKVGAG----- 171

Query: 182 SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDT 241
                  +LH+GV IG DGFG+A       KI  +GRV+I + VE+GANS IDRG + DT
Sbjct: 172 ------CVLHAGVVIGADGFGFAEADGRFLKIPQVGRVLIGNNVEVGANSCIDRGALADT 225

Query: 242 IIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNV 301
           +I +  KIDN VQIGHNV IG   ++  Q GIAGS  IG +  IGGQ GIAG+L+I D  
Sbjct: 226 VIEDGVKIDNLVQIGHNVQIGAHTVVAGQTGIAGSARIGRHCRIGGQVGIAGHLEIADGC 285

Query: 302 QIASKSGVLKDIPAGQQYGG-MPARPIGEYLR 332
            IA +S V   +     Y G +P +    + R
Sbjct: 286 VIAGQSAVTHSLRRAGVYSGVIPVQEASHWRR 317


>gi|296101348|ref|YP_003611494.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295055807|gb|ADF60545.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 341

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 12/316 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I +++ +  A  G+I++++S K+  ++ +C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITAVASMQSAKAGNITFMVSPKYREHLAQCQASAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +QD +PF       L+   P +++A    IL       +  +    I P A LG +V   
Sbjct: 62  TQDDLPFATG--AALVVKNPYLTYARMAQILDTTPQPAQNIAASAAIDPTAQLGNNV--- 116

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
               +   AV+  GV +G    +GPG  +G   +IG    + A  S+Y  + IG + ++ 
Sbjct: 117 ---AVGANAVIESGVVLGDNVVIGPGCFVGKNTKIGAGTRLWANVSVYHEVEIGENCLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG+DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDTIIG    IDN
Sbjct: 174 SSTVIGSDGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +     V++
Sbjct: 234 QCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARP 326
            I     Y  G+P +P
Sbjct: 294 PITEPGVYSSGIPLQP 309


>gi|163782594|ref|ZP_02177591.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N acyltransferase
           [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882167|gb|EDP75674.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N acyltransferase
           [Hydrogenivirga sp. 128-5-R1-1]
          Length = 324

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 167/312 (53%), Gaps = 36/312 (11%)

Query: 38  SLSPIARASTGDISYIISRKFLN--NIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           S   I RA  G +S ++  + ++  N  K        +  +  F P+  P  +S+K E+ 
Sbjct: 41  SEEDIGRALAGGVSALVVNREVDFPNYIKVDDVRYALALFLDRFYPEEHPVGVSEKAEIG 100

Query: 96  FAIA-GSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
             ++ G  +Y              ++P  FLGE+V +ED V       VYP   IG  T 
Sbjct: 101 NNVSLGKDVY--------------VAPFVFLGENVVLEDNVK------VYPFTYIGANTV 140

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
           VG GSVI +GV +  N           +LIG  V +HSG  IG DGFGY  G   I K+ 
Sbjct: 141 VGEGSVIFSGVHVYPN-----------TLIGKGVRIHSGSVIGADGFGYHIGREGIRKLN 189

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
           HIG VII+D VEIGAN+ +DR  ID T +G+ TK+DN V I HN  IG G IIV QVGI+
Sbjct: 190 HIGNVIIEDFVEIGANTTVDRAMIDSTRVGKFTKLDNLVMIAHNCDIGEGNIIVGQVGIS 249

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGG-MPARPIGEYLR- 332
           GS   G  V++ GQ G+A +++IGDNV + +KSGV + + AG+ YG  +PA     + R 
Sbjct: 250 GSVKTGKGVVLAGQVGVADHIEIGDNVTVTAKSGVSRSLEAGKVYGATLPAVEWSRWKRI 309

Query: 333 HMVMLSKPSKYK 344
           +  +L  P   K
Sbjct: 310 YASLLRLPELLK 321


>gi|218246356|ref|YP_002371727.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cyanothece sp. PCC 8801]
 gi|257059402|ref|YP_003137290.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cyanothece sp. PCC 8802]
 gi|226740720|sp|B7JUM7|LPXD_CYAP8 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|218166834|gb|ACK65571.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cyanothece sp. PCC 8801]
 gi|256589568|gb|ACV00455.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Cyanothece sp. PCC 8802]
          Length = 348

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 167/318 (52%), Gaps = 12/318 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQD---IVPFIPKNIPCLLSDKP 92
           I +++ +  A TG +SYI   KF   ++K  ASA+I  +D         K+I  + + +P
Sbjct: 29  ITAVAAVDEAVTGQLSYIEGGKFAAMVQKTAASALILPRDEALQAQATEKDIAWITTPEP 88

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            + FA A  + Y Q  H        GI P A +   VK+   + I P  V+  GV IG  
Sbjct: 89  RLLFAHAIKLFY-QPFHPSP-----GIHPTAVIDSSVKLGKDIYIGPHVVIEQGVTIGDN 142

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
             +    VI  GV IG    + A  +I+  S IG++ ++HSG  IG++GFG+        
Sbjct: 143 ACIHANVVIYPGVSIGDRTILHANCTIHERSQIGDNCVIHSGAAIGSEGFGFVPTPDGWF 202

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           K+   G V+++D VEIG NSA+DR  +  T +G NTKIDN VQ+ HN  I   C+  SQV
Sbjct: 203 KMEQSGYVVLEDGVEIGCNSAVDRPAVGTTRVGRNTKIDNLVQVAHNCQISENCVFASQV 262

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           G+AG   +G  V++ GQ G+A    IGD V  ++++G+  DI  G+     PA P   YL
Sbjct: 263 GLAGGVKVGKRVILAGQVGVANQANIGDGVIASAQTGIPHDIAPGEIVSSSPAVPNKLYL 322

Query: 332 RHMVMLSK-PSKYK-IKR 347
           +   +  + P  Y+ +KR
Sbjct: 323 KASAIYKRLPEMYQTLKR 340


>gi|163788972|ref|ZP_02183416.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Flavobacteriales bacterium ALC-1]
 gi|159875636|gb|EDP69696.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Flavobacteriales bacterium ALC-1]
          Length = 342

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 165/309 (53%), Gaps = 8/309 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           ++ LS I   + G +S++ + K+   I   +AS  I + D  P  P  I   L    +  
Sbjct: 24  VFKLSKIEEGAKGSLSFLSNDKYTPYIYTTEASITIVNSDFEPEKP--ISTTLIKVEDAY 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
              +  + Y   + +  +    GI    F+ E  K  D + I   A +   VEIG    +
Sbjct: 82  EGFSKLLEYYNQIKLNKT----GIEQPCFISETSKTPDSIYIGAFAYIGNNVEIGDNVKI 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVS-DIHKI 213
            P + IG  V++G N  I AG  +Y+  +IG + +++SG  IG DGFG+A     +  KI
Sbjct: 138 FPNAYIGDNVKLGDNTIIFAGGKVYADCIIGKNCVVNSGAIIGADGFGFAPSKEGEYSKI 197

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             IG VI++D V++GA + IDR T+  TII    K+DNQ+QI HNV IG   +I +Q G+
Sbjct: 198 PQIGNVILEDYVDVGAGTTIDRATMGSTIIRSGVKLDNQIQIAHNVEIGKNTVIAAQTGV 257

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           AGST IGD  LIGGQ GIAG+L IG+NV++ ++SG+ +++   +   G P+    ++ + 
Sbjct: 258 AGSTKIGDGCLIGGQVGIAGHLVIGNNVRVQAQSGIGRNVKDNEILQGSPSFGYSDWSKS 317

Query: 334 MVMLSKPSK 342
            V      K
Sbjct: 318 YVHFKNLPK 326


>gi|193215982|ref|YP_001997181.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chloroherpeton thalassium ATCC 35110]
 gi|193089459|gb|ACF14734.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chloroherpeton thalassium ATCC 35110]
          Length = 349

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 168/308 (54%), Gaps = 9/308 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI-VPFIPKNIPCLLSDKPEV 94
           I  +  I  A  GD++++ + K+   +   +AS ++  + + + F   +   +  D P +
Sbjct: 27  IERVGKIEGAKKGDLTFVSNPKYEKFVSATQASVVLVPKKLELNFELNDRAFIKVDDPYI 86

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           +F     +   + M         G+   A + E V + + V I     +    E+G  T 
Sbjct: 87  AF-----VFLLEKMSPPREMIPLGVHSTAVISESVVMGENVSIGANVYIGNNCEVGDGTV 141

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYA-RGVSDIHK 212
           +GPG+VI  GV++G+NC +    +IY    +G+ +I+HSG  IG DGFG+A +      K
Sbjct: 142 IGPGTVILDGVKVGKNCKLYPNVTIYDGCRLGDRIIIHSGTSIGADGFGFAPKPDGSYRK 201

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  IG V+I+D+VE+GAN  IDR T+ +T++    KIDN VQ+ HN  IG   +I SQ G
Sbjct: 202 IPQIGIVVIEDEVELGANLCIDRATLGETVVRRGAKIDNLVQVAHNCVIGSNTVIASQAG 261

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD-IPAGQQYGGMPARPIGEYL 331
           ++GST IG+N ++ GQ G  G+++I D V + +K+GV K  +  GQ   G PA+ I E +
Sbjct: 262 VSGSTKIGNNCMVAGQVGFVGHIEIADGVNVGAKAGVSKSFLEKGQTIRGAPAQAIREQM 321

Query: 332 RHMVMLSK 339
           +   +L K
Sbjct: 322 KQEALLRK 329


>gi|119371946|sp|Q1D385|LPXD_MYXXD RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
          Length = 349

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 177/324 (54%), Gaps = 16/324 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G  LL +    ++I+ L+ +  A  GD+S+  + ++    E  +ASA++   
Sbjct: 5   LGELAAHVGGELLGDP--SQLIHGLNGLEEAGPGDVSFYGNPRYRRQFEATRASAVLVGA 62

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
           D+ P   + +  +    P +++A    + +  A    A+    G+ P A++  +  +   
Sbjct: 63  DVPPR--EGVALVRVANPHLAYAKLLRLFH--APERPAA----GVRPGAWVHPEATVHPE 114

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSG 193
            V+ P A V  G  +G +T + PG+ +G    +G +C +    ++    ++G  VILH+ 
Sbjct: 115 AVLLPGASVDRGGRVGARTVLYPGAYVGEQAEVGEDCVLYPNVTVRERCIVGARVILHAS 174

Query: 194 VRIGNDGFGYA-----RGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
             +G DGFG+A         +  KI  +G V I+D VE+GA + IDR T+ +T++G   K
Sbjct: 175 SVVGADGFGFAFNPEGEAGPEHFKIPQVGIVRIEDDVEVGACTCIDRATVGETVVGRGAK 234

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQI HNV +G   +I +Q G++GS  +G  V++ GQ G+ G++++GD  ++ ++SG
Sbjct: 235 LDNLVQIAHNVRVGPLSLICAQAGVSGSAEVGTGVVLAGQVGVVGHIRVGDLAKVGAQSG 294

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V  D+P GQ   G PA P  E+LR
Sbjct: 295 VAHDVPDGQVVSGSPAVPHREWLR 318


>gi|332293179|ref|YP_004431788.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171265|gb|AEE20520.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Krokinobacter diaphorus 4H-3-7-5]
          Length = 341

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 163/307 (53%), Gaps = 10/307 (3%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           L+ I     G ++++ + K+ + I   +AS  I   D  P  P   P L+  + E ++  
Sbjct: 27  LAKIEEGIPGSLTFLANPKYTSFIYTTEASIAIVGNDFEPEQPVK-PTLI--RVEDAYKS 83

Query: 99  AGSIL-YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGP 157
              +L Y   + +  S    GI    F+ E     DG+ +   + +   V IG    + P
Sbjct: 84  FSKLLEYYNQVKLNKS----GIEQPCFISETATYGDGLYLGAFSYLGENVTIGSNVKIYP 139

Query: 158 GSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVS-DIHKIVH 215
              IG  V IG NC + AGS +YS  +IGN+V +HSG  +G DGFG+      +  K+  
Sbjct: 140 NVYIGDNVTIGDNCVLFAGSKVYSDCVIGNTVYIHSGAIVGADGFGFTPNEKGEYSKVPQ 199

Query: 216 IGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG 275
            G VII+D V+IGA + IDR T+  T+I    K+DNQ+QI HNV IG    I +Q GIAG
Sbjct: 200 TGNVIIEDHVDIGAGTTIDRATLGSTVIRTGVKLDNQIQIAHNVEIGSHTAIAAQTGIAG 259

Query: 276 STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
           ST IG + LIGGQ GI+G+L IGDNV+I ++SG+ ++I   +   G P+    ++ R  V
Sbjct: 260 STKIGKHCLIGGQVGISGHLTIGDNVRIQAQSGIGRNIKDNEVLQGSPSFNYADWNRSYV 319

Query: 336 MLSKPSK 342
                 K
Sbjct: 320 HFKNLPK 326


>gi|258627360|ref|ZP_05722144.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           mimicus VM603]
 gi|258580398|gb|EEW05363.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Vibrio
           mimicus VM603]
          Length = 350

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 175/325 (53%), Gaps = 18/325 (5%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    +G+   ++ +++P+ +A  G+++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----YGDPAALVSAVAPMDKAQLGNVTFLSNPKYSKHLSDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGISPQAFLGEDV 129
           +         P N   L+   P V+FA        QA+    A ++  GI+P A + ED 
Sbjct: 60  MVKASERELCPGN--ALVVADPYVAFA-----KVTQALDSTPAPAY--GIAPSAVIAEDA 110

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSV 188
           K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+  
Sbjct: 111 KLGSNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSDC 170

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N  
Sbjct: 171 LIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNVI 230

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   + G+++I D V I     
Sbjct: 231 IDNQLQIAHNVHIGYGSALAGGTIIAGSTRIGKYCIIGGASVLNGHIEIADGVTITGMGM 290

Query: 309 VLKDIPAGQQY-GGMPARPIGEYLR 332
           V++ I     Y  G+P +   E+ +
Sbjct: 291 VMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|261338823|ref|ZP_05966681.1| hypothetical protein ENTCAN_05018 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318646|gb|EFC57584.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Enterobacter cancerogenus ATCC 35316]
          Length = 341

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 170/316 (53%), Gaps = 12/316 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I +++ +  A  G+I++I+S K+  ++ +C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITAVASMQSAKAGNITFIVSPKYREHLAQCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +QD +PF       L+   P +++A    IL       +  +    I P A LG +V   
Sbjct: 62  TQDDLPFATG--AALVVKNPYLTYARMAQILDTTPQPAQNIAASAAIDPTAQLGNNV--- 116

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
               +   AV+  GV +G    +GPG  +G   +IG    + A  SIY  + +G + ++ 
Sbjct: 117 ---AVGANAVIESGVVLGDNVVIGPGCFVGKNTKIGAGSRLWANVSIYHDVEMGENCLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG+DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDTIIG    IDN
Sbjct: 174 SSTVIGSDGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +     V++
Sbjct: 234 QCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARP 326
            I     Y  G+P +P
Sbjct: 294 PITEPGVYSSGIPLQP 309


>gi|262170781|ref|ZP_06038459.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           mimicus MB-451]
 gi|261891857|gb|EEY37843.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           mimicus MB-451]
          Length = 350

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 175/325 (53%), Gaps = 18/325 (5%)

Query: 13  IALMKLAQSIGASLLDENFGE--RMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAI 70
           + L +LA   G  L    +G+   ++ +++P+ +A  G+++++ + K+  ++  CKA+ I
Sbjct: 4   LTLAELATITGGEL----YGDPAALVSAVAPMDKAQLGNVTFLSNPKYSKHLSDCKATVI 59

Query: 71  ICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH-MEASSFEGGISPQAFLGEDV 129
           +         P N   L+   P V+FA        QA+    A ++  GI+P A + ED 
Sbjct: 60  MVKASERELCPGN--ALVVADPYVAFA-----KVTQALDSTPAPAY--GIAPSAVIAEDA 110

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSV 188
           K+   V I   AV+  GV++G    +G G  IG   R+G N  + A  +IY  + IG+  
Sbjct: 111 KLGSNVSIGANAVIESGVQLGDNVVIGAGCFIGKQARLGDNTKLWANVTIYHKVEIGSDC 170

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           ++ SG  IG DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N  
Sbjct: 171 LIQSGTVIGADGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNVI 230

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDNQ+QI HNVHIG G  +     IAGST IG   +IGG   + G+++I D V I     
Sbjct: 231 IDNQLQIAHNVHIGYGSALAGGTIIAGSTRIGKYCIIGGASVLNGHIEIADGVTITGMGM 290

Query: 309 VLKDIPAGQQY-GGMPARPIGEYLR 332
           V++ I     Y  G+P +   E+ +
Sbjct: 291 VMRSIEEKGMYSSGIPLQTNKEWRK 315


>gi|256032569|pdb|3EH0|A Chain A, Crystal Structure Of Lpxd From Escherichia Coli
 gi|256032570|pdb|3EH0|B Chain B, Crystal Structure Of Lpxd From Escherichia Coli
 gi|256032571|pdb|3EH0|C Chain C, Crystal Structure Of Lpxd From Escherichia Coli
          Length = 341

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDTII
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTII 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|332885894|gb|EGK06138.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dysgonomonas mossii DSM 22836]
          Length = 348

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/314 (35%), Positives = 170/314 (54%), Gaps = 14/314 (4%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           + + S I     G ++++ + K+ + I    AS ++ + D V   P     +       +
Sbjct: 26  VNNFSRIEDGKPGTLTFLANPKYTHYIYTTDASIVLVNNDFVAERPIKATLVRCFNAYAA 85

Query: 96  FAIAGSI---LYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            AI   +   + PQ   +EA SF   ++  A LGE+V +     IA  AVV      G  
Sbjct: 86  LAILLDMVEKMKPQKKGIEAMSF---VADTAKLGENVYVGAFSYIAEGAVV------GNN 136

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
           + + P S IG  V IG N  I  G  IY   +IGN+ I+HSG  IG+DGFG+A       
Sbjct: 137 SQIYPQSYIGDNVTIGDNTIIYPGVKIYQGCIIGNNCIIHSGAVIGSDGFGFAPEGEIYK 196

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           KI  +G V I+D VEIGAN+ IDR  +D T+I +  K+DN +QI HNV +G   ++ +QV
Sbjct: 197 KIPQMGIVRIEDDVEIGANTTIDRAVMDATVIHKGVKLDNLIQIAHNVEVGENTVMAAQV 256

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GI+GST +G + + GGQ G+ G++ IGDN  I ++SG++ +I    +  G PA P+ ++ 
Sbjct: 257 GISGSTKVGKHCMFGGQVGLGGHITIGDNANIGAQSGIISNIAPEAKILGSPAVPVKDFF 316

Query: 332 RHMVMLSK-PSKYK 344
           R  ++  K P  Y+
Sbjct: 317 RSSIIFPKLPEMYR 330


>gi|312890012|ref|ZP_07749556.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Mucilaginibacter paludis DSM 18603]
 gi|311297544|gb|EFQ74669.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Mucilaginibacter paludis DSM 18603]
          Length = 347

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 109/315 (34%), Positives = 180/315 (57%), Gaps = 11/315 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNI-PCLLSDKPEV 94
           +  L+ I  A  G +S++ + K+ + +    AS +I + D+V  + +++ P L+  + E 
Sbjct: 24  VNQLAKIEEARPGSLSFLANPKYEHYLYTTNASVVIVNNDLV--LTEDVKPTLV--RVEN 79

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           +++ A ++L  +   ++ +  + GI   +F+    +I     I   A + P V+IG    
Sbjct: 80  AYS-AFTVLLEKYNTIKLN--KTGIEQPSFIHPSAQIGQNAYIGAFAYIGPDVKIGDNCK 136

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYA-RGVSDIHK 212
           + P + I  GV IG N ++ AG  IY    IGN VI+HSG  IG DGFG+A +      K
Sbjct: 137 IFPNTYIADGVIIGDNVTLYAGVKIYFDCHIGNRVIIHSGTVIGGDGFGFAPQSNGSYAK 196

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           +  IG VI++D VEIGAN+ IDR T+  TII    K+DN +Q+ HNV IG   ++ +Q G
Sbjct: 197 VSQIGNVILEDDVEIGANTTIDRATLGSTIIRRGVKLDNLIQVAHNVEIGADTVVAAQTG 256

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA-GQQYGGMPARPIGEYL 331
           I+GS  IG+N +IGGQ GI G++ I    Q+ +KSG+ + I   G+++ G PA    +++
Sbjct: 257 ISGSAKIGENCIIGGQVGIVGHINIAKGSQVQAKSGISRSIEVEGKKWAGAPASFYQDHM 316

Query: 332 RHMVMLSKPSKYKIK 346
           R  V+L++  + + K
Sbjct: 317 RSQVVLARLPELEKK 331


>gi|16128172|ref|NP_414721.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|82775569|ref|YP_401916.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella dysenteriae Sd197]
 gi|89107059|ref|AP_000839.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|157154842|ref|YP_001461348.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E24377A]
 gi|157159644|ref|YP_001456962.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli HS]
 gi|170021468|ref|YP_001726422.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli ATCC 8739]
 gi|170079815|ref|YP_001729135.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188493159|ref|ZP_03000429.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 53638]
 gi|191167040|ref|ZP_03028862.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B7A]
 gi|209917369|ref|YP_002291453.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli SE11]
 gi|218552760|ref|YP_002385673.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli IAI1]
 gi|218693644|ref|YP_002401311.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 55989]
 gi|238899577|ref|YP_002925373.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli BW2952]
 gi|254037598|ref|ZP_04871675.1| firA [Escherichia sp. 1_1_43]
 gi|256021611|ref|ZP_05435476.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella sp. D9]
 gi|256025491|ref|ZP_05439356.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia sp. 4_1_40B]
 gi|260853389|ref|YP_003227280.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|293418064|ref|ZP_06660686.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B185]
 gi|293476836|ref|ZP_06665244.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B088]
 gi|300816219|ref|ZP_07096442.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 107-1]
 gi|300824098|ref|ZP_07104218.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 119-7]
 gi|300901998|ref|ZP_07120025.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 84-1]
 gi|300920139|ref|ZP_07136590.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 115-1]
 gi|300923029|ref|ZP_07139096.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 182-1]
 gi|300949789|ref|ZP_07163763.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 116-1]
 gi|300956062|ref|ZP_07168387.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 175-1]
 gi|301305315|ref|ZP_07211411.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 124-1]
 gi|301330023|ref|ZP_07222707.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 78-1]
 gi|301646502|ref|ZP_07246377.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 146-1]
 gi|307136779|ref|ZP_07496135.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H736]
 gi|307311373|ref|ZP_07591015.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Escherichia coli W]
 gi|309787147|ref|ZP_07681759.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella dysenteriae 1617]
 gi|309796356|ref|ZP_07690765.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 145-7]
 gi|331640633|ref|ZP_08341781.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H736]
 gi|331666420|ref|ZP_08367301.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA271]
 gi|331680758|ref|ZP_08381417.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H591]
 gi|332282853|ref|ZP_08395266.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella sp. D9]
 gi|120183|sp|P21645|LPXD_ECOLI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase; AltName: Full=Protein firA; AltName:
           Full=Rifampicin resistance protein
 gi|119371976|sp|Q32JT0|LPXD_SHIDS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|41470|emb|CAA38568.1| FirA [Escherichia coli]
 gi|1552756|gb|AAB08608.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli]
 gi|1786376|gb|AAC73290.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|4902920|dbj|BAA77854.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli str. K12 substr. W3110]
 gi|73671296|gb|AAZ80059.1| LpxD [Escherichia coli LW1655F+]
 gi|81239717|gb|ABB60427.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Shigella dysenteriae Sd197]
 gi|157065324|gb|ABV04579.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli HS]
 gi|157076872|gb|ABV16580.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E24377A]
 gi|169756396|gb|ACA79095.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Escherichia coli ATCC 8739]
 gi|169887650|gb|ACB01357.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188488358|gb|EDU63461.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 53638]
 gi|190902933|gb|EDV62660.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B7A]
 gi|209910628|dbj|BAG75702.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli SE11]
 gi|218350376|emb|CAU96059.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli 55989]
 gi|218359528|emb|CAQ97066.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli IAI1]
 gi|226840704|gb|EEH72706.1| firA [Escherichia sp. 1_1_43]
 gi|238863735|gb|ACR65733.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli BW2952]
 gi|257752038|dbj|BAI23540.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260450617|gb|ACX41039.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Escherichia coli DH1]
 gi|291321289|gb|EFE60731.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B088]
 gi|291430782|gb|EFF03780.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B185]
 gi|300317092|gb|EFJ66876.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 175-1]
 gi|300405884|gb|EFJ89422.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 84-1]
 gi|300412836|gb|EFJ96146.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 115-1]
 gi|300420656|gb|EFK03967.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 182-1]
 gi|300450821|gb|EFK14441.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 116-1]
 gi|300523375|gb|EFK44444.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 119-7]
 gi|300531426|gb|EFK52488.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 107-1]
 gi|300839420|gb|EFK67180.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 124-1]
 gi|300843934|gb|EFK71694.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 78-1]
 gi|301075288|gb|EFK90094.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 146-1]
 gi|306908352|gb|EFN38850.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Escherichia coli W]
 gi|308120060|gb|EFO57322.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 145-7]
 gi|308924725|gb|EFP70220.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella dysenteriae 1617]
 gi|309700387|emb|CBI99675.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli ETEC H10407]
 gi|315059397|gb|ADT73724.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli W]
 gi|315134869|dbj|BAJ42028.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli DH1]
 gi|315254981|gb|EFU34949.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 85-1]
 gi|320200295|gb|EFW74881.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase
           [Escherichia coli EC4100B]
 gi|323157984|gb|EFZ44086.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli EPECa14]
 gi|323181687|gb|EFZ67101.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 1357]
 gi|323380044|gb|ADX52312.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Escherichia coli KO11]
 gi|323935019|gb|EGB31392.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E1520]
 gi|323939945|gb|EGB36143.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E482]
 gi|323945656|gb|EGB41705.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H120]
 gi|323970658|gb|EGB65914.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA007]
 gi|324017814|gb|EGB87033.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 117-3]
 gi|324118299|gb|EGC12194.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E1167]
 gi|331040379|gb|EGI12586.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H736]
 gi|331066631|gb|EGI38508.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA271]
 gi|331072221|gb|EGI43557.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H591]
 gi|332105205|gb|EGJ08551.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella sp. D9]
 gi|332341512|gb|AEE54846.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase LpxD
           [Escherichia coli UMNK88]
 gi|227512|prf||1705234A firA gene
          Length = 341

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDTII
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTII 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|225011118|ref|ZP_03701581.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Flavobacteria bacterium MS024-3C]
 gi|225004752|gb|EEG42711.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Flavobacteria bacterium MS024-3C]
          Length = 330

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 111/313 (35%), Positives = 167/313 (53%), Gaps = 8/313 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E +I  ++ +A A+   I++I S K+   IE  KA+A++ S  I    P +IP L     
Sbjct: 22  EVVISGVNDLANATVNQITFIGSAKYKRFIETTKAAAVVVSHGIEITNP-SIPLLYVKNA 80

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
           +++ A       P+    +   FE  I P A +   V + +GV +     + PGV +G+ 
Sbjct: 81  DLAMAQLLEAFSPK----QGPEFETNIHPTASIHHSVVLGEGVKVGAFVYIGPGVSVGKG 136

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGNDGFGY--ARGVSD 209
           T +     +    +IG NC+I +G+ I  +S IG+  I H+ V IG DGFGY  A   S 
Sbjct: 137 TQIYANVSVFDNSKIGENCTIWSGTVIRENSQIGHHCIFHNNVSIGADGFGYRPAPDGSG 196

Query: 210 IHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVS 269
           + KI HIG V+I + VEIGANS +D+   + TI+G+  KIDN VQI HN  +G  CI+  
Sbjct: 197 LIKIPHIGNVVIGNHVEIGANSCVDKAKFNSTILGDGCKIDNLVQIAHNCVLGRSCIMAG 256

Query: 270 QVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGE 329
             G+AGS  +G+ V+IGG   I  ++ IG    + + SGV+ D+P      G PA    E
Sbjct: 257 SSGLAGSVTLGNGVIIGGSASIKDHVTIGSGATVGAGSGVIADVPPKGSVLGYPATESRE 316

Query: 330 YLRHMVMLSKPSK 342
            L+  V L + +K
Sbjct: 317 MLKQWVALKRLAK 329


>gi|108758832|ref|YP_632888.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Myxococcus xanthus DK 1622]
 gi|108462712|gb|ABF87897.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Myxococcus xanthus DK 1622]
          Length = 354

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 177/324 (54%), Gaps = 16/324 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G  LL +    ++I+ L+ +  A  GD+S+  + ++    E  +ASA++   
Sbjct: 10  LGELAAHVGGELLGDP--SQLIHGLNGLEEAGPGDVSFYGNPRYRRQFEATRASAVLVGA 67

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
           D+ P   + +  +    P +++A    + +  A    A+    G+ P A++  +  +   
Sbjct: 68  DVPPR--EGVALVRVANPHLAYAKLLRLFH--APERPAA----GVRPGAWVHPEATVHPE 119

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSG 193
            V+ P A V  G  +G +T + PG+ +G    +G +C +    ++    ++G  VILH+ 
Sbjct: 120 AVLLPGASVDRGGRVGARTVLYPGAYVGEQAEVGEDCVLYPNVTVRERCIVGARVILHAS 179

Query: 194 VRIGNDGFGYA-----RGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
             +G DGFG+A         +  KI  +G V I+D VE+GA + IDR T+ +T++G   K
Sbjct: 180 SVVGADGFGFAFNPEGEAGPEHFKIPQVGIVRIEDDVEVGACTCIDRATVGETVVGRGAK 239

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           +DN VQI HNV +G   +I +Q G++GS  +G  V++ GQ G+ G++++GD  ++ ++SG
Sbjct: 240 LDNLVQIAHNVRVGPLSLICAQAGVSGSAEVGTGVVLAGQVGVVGHIRVGDLAKVGAQSG 299

Query: 309 VLKDIPAGQQYGGMPARPIGEYLR 332
           V  D+P GQ   G PA P  E+LR
Sbjct: 300 VAHDVPDGQVVSGSPAVPHREWLR 323


>gi|56750117|ref|YP_170818.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus elongatus PCC 6301]
 gi|81300258|ref|YP_400466.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus elongatus PCC 7942]
 gi|81596887|sp|Q5N5W9|LPXD_SYNP6 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|119371982|sp|Q31N90|LPXD_SYNE7 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|56685076|dbj|BAD78298.1| UDP-3-o-[3-hydroxymyristoyl] glucosamine n-acyltransferase
           [Synechococcus elongatus PCC 6301]
 gi|81169139|gb|ABB57479.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Synechococcus elongatus PCC 7942]
          Length = 355

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 176/341 (51%), Gaps = 16/341 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNN-IEKCKASAIICS 73
           L  L    G        G+  ++ ++ I  A +G +S++     L + IE+  ASA+I  
Sbjct: 7   LQHLEAKTGPCTAKAIAGDPELHGVAAINEAQSGQVSFLDQESGLQDWIEQTAASALILP 66

Query: 74  QDIVPFI-----PKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGED 128
            D  P +      +N+P + + +P ++FA A ++ Y Q     A     GI P A +   
Sbjct: 67  PD--PALQARAEARNLPWMTTAQPRLAFAAAIAVFY-QPFRPVA-----GIHPSAVIDPS 118

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNS 187
            ++ D V +    V+     IG    +    V+  GV +G  C I A S+I+  S IG  
Sbjct: 119 AQLGDRVSVGAHVVIGANCVIGNDVILHANVVLYPGVSLGDRCQIHANSTIHERSQIGQD 178

Query: 188 VILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
            ++HSG  IG +GFG+    S   K+   G V+++D VE+G NSAIDR  + +T IG  T
Sbjct: 179 CVIHSGAVIGAEGFGFVPTASGWFKMEQSGIVVLEDGVEVGCNSAIDRPAVGETRIGAQT 238

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           K+DN V IGH   IG  C + +QVG+AG   +GD V++ GQ G+A  +KIGD    +SKS
Sbjct: 239 KLDNLVHIGHGCQIGKACAMAAQVGLAGGVEVGDRVILAGQVGVANRVKIGDRAIASSKS 298

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK-PSKYKIKR 347
           G+  +I AG    G PA P  ++L+   + ++ P  Y+  R
Sbjct: 299 GIHGEIEAGAIVSGYPAIPNRQWLKTSAVYNRLPELYRSLR 339


>gi|260767815|ref|ZP_05876750.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           furnissii CIP 102972]
 gi|260617324|gb|EEX42508.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           furnissii CIP 102972]
          Length = 314

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 158/291 (54%), Gaps = 9/291 (3%)

Query: 44  RASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL 103
           RA  GDI+++ + K+  ++  CKA+ I+         P N   L+   P V+FA      
Sbjct: 3   RAQEGDITFLSNPKYSKHLASCKATVIMVKATERELCPSN--ALVVADPYVAFA-----K 55

Query: 104 YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGA 163
             QA+    +   GGI+P A + +D K+ + V I   AV+  GVE+G    +G G  IG 
Sbjct: 56  VTQALDTTPAPASGGIAPSAVVADDAKLGENVSIGANAVIESGVELGDHVIIGAGCFIGK 115

Query: 164 GVRIGRNCSIGAGSSIYSSLI-GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQ 222
             +IG +  + A  SIY +++ G   ++ S   IG+DGFGYA    +  KI  +G V I 
Sbjct: 116 NAKIGNHTKLWANVSIYHNVVLGEHCLVQSSTVIGSDGFGYANERGEWIKIPQLGSVRIG 175

Query: 223 DKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDN 282
           ++VEIGA + IDRG +DDT+I +N  +DNQ+QI HNVHIG G  +     +AGST IG  
Sbjct: 176 NRVEIGACTTIDRGALDDTVIEDNVILDNQLQIAHNVHIGYGTAMAGGTIVAGSTTIGKY 235

Query: 283 VLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GGMPARPIGEYLR 332
            +IGG   + G+++I D V I     V++ I     Y  G+P +   E+ +
Sbjct: 236 CIIGGASVLNGHIQIADGVTITGMGMVMRSIEEKGMYSSGIPLQTNKEWRK 286


>gi|295098670|emb|CBK87760.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 341

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 169/316 (53%), Gaps = 12/316 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I +++ +  A  G I++++S K+  ++ +C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITAVASMQSAKAGTITFMVSPKYREHLAQCQASAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +QD +PF       L+   P +++A    IL       +  +    I P A LG +V + 
Sbjct: 62  TQDDLPFATS--AALVVKNPYLTYARMAQILDTTPQPAQNIAASAAIDPTAQLGNNVSV- 118

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
                   AV+  GV +G    +GPG  +G   +IG    + A  S+Y  + IG + ++ 
Sbjct: 119 -----GANAVIESGVVLGDNVVIGPGCFVGKNTKIGAGSRLWANVSVYHEVEIGENCLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG+DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDTIIG    IDN
Sbjct: 174 SSTVIGSDGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +     V++
Sbjct: 234 QCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARP 326
            I     Y  G+P +P
Sbjct: 294 PITEPGVYSSGIPLQP 309


>gi|291288196|ref|YP_003505012.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290885356|gb|ADD69056.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 333

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 169/322 (52%), Gaps = 13/322 (4%)

Query: 17  KLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           +LA  IGA L  E+     I S S I   S G +  I+  K   +I    A+A +  +  
Sbjct: 5   ELAALIGAELNGEDV---EISSFSSIENISEGSLVAILGNKIPEDIYSSSAAAFLAKKG- 60

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
              +P     L +D  E++   A + LYP+           G++P A++ +   I + V 
Sbjct: 61  -ADVPAGKTYLFADDAELALVAAVNALYPK-------KHRDGVNPAAYVADSAIICENVF 112

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           +   A +    +IG  T +  G+VIG  V IG  C +   ++IY    + + VI+HS   
Sbjct: 113 VDAFAYIGSRAKIGEGTEIHAGAVIGEDVEIGSGCIVYPNATIYDGCRLKDRVIVHSSAV 172

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFGY +      KI HIG VI+++ VEIG+ S +DRG  D+T++GE TKIDNQVQ+
Sbjct: 173 IGGDGFGYYQKHGRNVKIPHIGSVILENDVEIGSGSCVDRGKFDNTVVGEGTKIDNQVQV 232

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HNV +G   I+  Q  IAGS+  GD V+IG + G++ ++ I   V +A+ +GV+ DI  
Sbjct: 233 AHNVKLGKHNILTGQAAIAGSSTTGDYVMIGARAGVSDHVNICSKVMLAAMAGVMSDIDK 292

Query: 316 GQQYGGMPARPIGEYLRHMVML 337
              Y G+P      ++R +  +
Sbjct: 293 PGIYAGIPVTSRKGWMREIAYV 314


>gi|15799861|ref|NP_285873.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 EDL933]
 gi|15829435|ref|NP_308208.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|24111614|ref|NP_706124.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 2a str. 301]
 gi|30061736|ref|NP_835907.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 2a str. 2457T]
 gi|74310799|ref|YP_309218.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella sonnei Ss046]
 gi|82542778|ref|YP_406725.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella boydii Sb227]
 gi|110640398|ref|YP_668126.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 536]
 gi|168752161|ref|ZP_02777183.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4113]
 gi|168755792|ref|ZP_02780799.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4401]
 gi|168782071|ref|ZP_02807078.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4076]
 gi|168789288|ref|ZP_02814295.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC869]
 gi|170683962|ref|YP_001742307.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli SMS-3-5]
 gi|187733476|ref|YP_001878981.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella boydii CDC 3083-94]
 gi|191172766|ref|ZP_03034303.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli F11]
 gi|193063291|ref|ZP_03044382.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E22]
 gi|193067623|ref|ZP_03048590.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E110019]
 gi|194428319|ref|ZP_03060861.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B171]
 gi|195939875|ref|ZP_03085257.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4024]
 gi|208809366|ref|ZP_03251703.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4206]
 gi|208812618|ref|ZP_03253947.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4045]
 gi|208821208|ref|ZP_03261528.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398323|ref|YP_002268787.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4115]
 gi|217325460|ref|ZP_03441544.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. TW14588]
 gi|218688054|ref|YP_002396266.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli ED1a]
 gi|218698599|ref|YP_002406228.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli IAI39]
 gi|218703433|ref|YP_002410952.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli UMN026]
 gi|227884908|ref|ZP_04002713.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli 83972]
 gi|254791312|ref|YP_003076149.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|260842411|ref|YP_003220189.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|261226933|ref|ZP_05941214.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255337|ref|ZP_05947870.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|291281001|ref|YP_003497819.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O55:H7 str. CB9615]
 gi|293403248|ref|ZP_06647345.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli FVEC1412]
 gi|293408271|ref|ZP_06652111.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B354]
 gi|298378784|ref|ZP_06988668.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli FVEC1302]
 gi|300900783|ref|ZP_07118927.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 198-1]
 gi|300938586|ref|ZP_07153319.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 21-1]
 gi|300984939|ref|ZP_07177204.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 200-1]
 gi|300993600|ref|ZP_07180456.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 45-1]
 gi|301025941|ref|ZP_07189425.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 69-1]
 gi|301049908|ref|ZP_07196833.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 185-1]
 gi|331645322|ref|ZP_08346433.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli M605]
 gi|331651084|ref|ZP_08352112.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli M718]
 gi|331661250|ref|ZP_08362182.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA206]
 gi|331661553|ref|ZP_08362477.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA143]
 gi|331671685|ref|ZP_08372483.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA280]
 gi|331681564|ref|ZP_08382201.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H299]
 gi|54037762|sp|P65323|LPXD_ECO57 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|54037763|sp|P65324|LPXD_SHIFL RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|54041445|sp|P65322|LPXD_ECOL6 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|119371933|sp|Q0TLF4|LPXD_ECOL5 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|119371975|sp|Q325W1|LPXD_SHIBS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|119371977|sp|Q3Z5H9|LPXD_SHISS RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|12512907|gb|AAG54481.1|AE005194_2 UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase; third
           step of endotoxin (lipidA) synthesis [Escherichia coli
           O157:H7 str. EDL933]
 gi|13359637|dbj|BAB33604.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|24050383|gb|AAN41831.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Shigella flexneri 2a str. 301]
 gi|30039978|gb|AAP15712.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Shigella flexneri 2a str. 2457T]
 gi|73854276|gb|AAZ86983.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Shigella sonnei Ss046]
 gi|81244189|gb|ABB64897.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Shigella boydii Sb227]
 gi|110341990|gb|ABG68227.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 536]
 gi|170521680|gb|ACB19858.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli SMS-3-5]
 gi|187430468|gb|ACD09742.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella boydii CDC 3083-94]
 gi|188013920|gb|EDU52042.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4113]
 gi|189000375|gb|EDU69361.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4076]
 gi|189357029|gb|EDU75448.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4401]
 gi|189371097|gb|EDU89513.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC869]
 gi|190906916|gb|EDV66518.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli F11]
 gi|192931199|gb|EDV83802.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E22]
 gi|192959035|gb|EDV89471.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E110019]
 gi|194413694|gb|EDX29974.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B171]
 gi|208729167|gb|EDZ78768.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4206]
 gi|208733895|gb|EDZ82582.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4045]
 gi|208741331|gb|EDZ89013.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4042]
 gi|209159723|gb|ACI37156.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC4115]
 gi|209745754|gb|ACI71184.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli]
 gi|209745756|gb|ACI71185.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli]
 gi|209745758|gb|ACI71186.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli]
 gi|209745760|gb|ACI71187.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli]
 gi|209745762|gb|ACI71188.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli]
 gi|217321681|gb|EEC30105.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. TW14588]
 gi|218368585|emb|CAR16322.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli IAI39]
 gi|218425618|emb|CAR06404.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli ED1a]
 gi|218430530|emb|CAR11396.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli UMN026]
 gi|227838046|gb|EEJ48512.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli 83972]
 gi|254590712|gb|ACT70073.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|257757558|dbj|BAI29055.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|281177404|dbj|BAI53734.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli SE15]
 gi|281599534|gb|ADA72518.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 2002017]
 gi|284919954|emb|CBG33009.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 042]
 gi|290760874|gb|ADD54835.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O55:H7 str. CB9615]
 gi|291430163|gb|EFF03177.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli FVEC1412]
 gi|291472522|gb|EFF15004.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli B354]
 gi|298281118|gb|EFI22619.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli FVEC1302]
 gi|300298337|gb|EFJ54722.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 185-1]
 gi|300306589|gb|EFJ61109.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 200-1]
 gi|300355732|gb|EFJ71602.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 198-1]
 gi|300395740|gb|EFJ79278.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 69-1]
 gi|300406523|gb|EFJ90061.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 45-1]
 gi|300456468|gb|EFK19961.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 21-1]
 gi|307552029|gb|ADN44804.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli ABU 83972]
 gi|313646760|gb|EFS11219.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 2a str. 2457T]
 gi|315294583|gb|EFU53930.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 153-1]
 gi|315300683|gb|EFU59910.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 16-3]
 gi|320173340|gb|EFW48543.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase [Shigella
           dysenteriae CDC 74-1112]
 gi|320180914|gb|EFW55836.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase [Shigella
           boydii ATCC 9905]
 gi|320190295|gb|EFW64945.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. EC1212]
 gi|320196944|gb|EFW71565.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase
           [Escherichia coli WV_060327]
 gi|320639985|gb|EFX09570.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. G5101]
 gi|320644755|gb|EFX13799.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H- str. 493-89]
 gi|320652911|gb|EFX21149.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H- str. H 2687]
 gi|320658299|gb|EFX26028.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320663609|gb|EFX30893.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668922|gb|EFX35717.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. LSU-61]
 gi|323160201|gb|EFZ46160.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli E128010]
 gi|323165880|gb|EFZ51662.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella sonnei 53G]
 gi|323190421|gb|EFZ75696.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli RN587/1]
 gi|323964928|gb|EGB60394.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli M863]
 gi|323975653|gb|EGB70749.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TW10509]
 gi|324014103|gb|EGB83322.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 60-1]
 gi|324112410|gb|EGC06387.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia fergusonii B253]
 gi|325496111|gb|EGC93970.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia fergusonii ECD227]
 gi|326339766|gb|EGD63574.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. 1044]
 gi|326345100|gb|EGD68843.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase
           [Escherichia coli O157:H7 str. 1125]
 gi|327255158|gb|EGE66761.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli STEC_7v]
 gi|330910029|gb|EGH38539.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli AA86]
 gi|331046079|gb|EGI18198.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli M605]
 gi|331051538|gb|EGI23587.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli M718]
 gi|331052292|gb|EGI24331.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA206]
 gi|331061468|gb|EGI33431.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA143]
 gi|331071530|gb|EGI42887.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli TA280]
 gi|331081785|gb|EGI52946.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli H299]
 gi|332095118|gb|EGJ00150.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella boydii 5216-82]
 gi|332098796|gb|EGJ03756.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella boydii 3594-74]
 gi|332762041|gb|EGJ92312.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 2747-71]
 gi|332762183|gb|EGJ92452.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 4343-70]
 gi|332765027|gb|EGJ95255.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri K-671]
 gi|332768682|gb|EGJ98862.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 2930-71]
 gi|333009248|gb|EGK28704.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri K-218]
 gi|333010674|gb|EGK30107.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri VA-6]
 gi|333011018|gb|EGK30437.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri K-272]
 gi|333021813|gb|EGK41062.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri K-227]
 gi|333022230|gb|EGK41469.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri K-304]
          Length = 341

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|312966316|ref|ZP_07780542.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 2362-75]
 gi|312289559|gb|EFR17453.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 2362-75]
          Length = 341

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|282890068|ref|ZP_06298601.1| hypothetical protein pah_c010o061 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500074|gb|EFB42360.1| hypothetical protein pah_c010o061 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 357

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 172/341 (50%), Gaps = 14/341 (4%)

Query: 10  HKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNN-----IEK 64
            K   L +LA+   A L+     + +I  ++ +  A   D S++   K+        + K
Sbjct: 3   QKAFTLAELAEMTQAKLVGNP--QHLITGVADLVTAGENDASFLSKPKYTTARYDEAMRK 60

Query: 65  CKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAF 124
            KA  +  S D      +N+  L+ + P  +F       + ++   +  S   GI   A 
Sbjct: 61  SKAGVVFISDDSAYDENRNV--LIVEDPSRAFQKTVEAFFEES---KGQSGFFGIHSTAV 115

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL- 183
           + E   I D V I P AV+  G +IG  T +G G  IG    IG +C      ++     
Sbjct: 116 VHETAVIGDNVTIGPHAVIDHGAQIGDNTAIGAGCYIGPHSFIGDDCFFYPNVTVRERCQ 175

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTI 242
           IGN VIL  G  IG  GFGY       H K+  IG V+I+D VEIG+N  IDR    +T 
Sbjct: 176 IGNRVILQPGAVIGACGFGYTTDARGQHTKLNQIGIVVIEDDVEIGSNVTIDRARFKETR 235

Query: 243 IGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQ 302
           +G+ +KI+N VQI H V IG  C++V+Q GIAGST IG++V+IGGQ  I G+L+I   V 
Sbjct: 236 VGKGSKINNAVQIAHGVTIGAHCLVVAQTGIAGSTKIGNHVVIGGQAAIGGHLEIVSGVI 295

Query: 303 IASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKY 343
           IA+KSGV K +    +YGG PA  + E+ R  V      KY
Sbjct: 296 IAAKSGVTKSLMKPGKYGGFPALSLSEHNRQSVQARNIGKY 336


>gi|227825148|ref|ZP_03989980.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidaminococcus sp. D21]
 gi|226905647|gb|EEH91565.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidaminococcus sp. D21]
          Length = 347

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 135/249 (54%), Gaps = 7/249 (2%)

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
           P  +FA    +  P        S E GIS  AF+    +I     I P A +    EIG 
Sbjct: 81  PRAAFAKLLMLFRP------PESVESGISQYAFVHPTARIGKNAAILPFAYIAEDAEIGD 134

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVSDI 210
              + P   IG   ++G +C+  +  ++  + +IG+ VIL +G  IG DGFGY       
Sbjct: 135 NAIIYPHVYIGRHAKVGSDCTFYSNVTVRENCIIGDRVILQAGCVIGGDGFGYITSEGKH 194

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            K++  G V++ D VEIG N+ IDR T+D T+IG+ TKIDN V +GHN  IG  CI+V+ 
Sbjct: 195 TKVLQTGNVVVGDDVEIGCNTCIDRATVDSTVIGKGTKIDNLVHVGHNDVIGENCILVAH 254

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
           VGI+GS  +G N   GGQ   AG+LKIG N   A ++G++ D+P    + G PA+   ++
Sbjct: 255 VGISGSVTVGHNTTFGGQAATAGHLKIGSNCTFAGRTGIISDVPDNVVWAGFPAQSHVDW 314

Query: 331 LRHMVMLSK 339
           LR M    K
Sbjct: 315 LRMMASQRK 323


>gi|149175416|ref|ZP_01854037.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Planctomyces maris DSM 8797]
 gi|148845684|gb|EDL60026.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Planctomyces maris DSM 8797]
          Length = 360

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 159/306 (51%), Gaps = 10/306 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I+    + +A   DI+++     L  +    A A++  + +     K+      + P  S
Sbjct: 24  IHGAESVLKAGPHDITFVGDELNLKRLRSSNAGAVLLEKRLEESFEKS----FGEAPFTS 79

Query: 96  FAI----AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
            A+    A  I   Q +       E G+S QA + ++V++ +   I P   + PGV IG+
Sbjct: 80  IAVVDAQAAFIKIIQKLRPSRPLPEIGVSLQAQISDNVELGENCQIYPQVTIRPGVRIGK 139

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDI 210
              + PG  IG    IG + +I A +  Y  + +GN V++H+   +G DGFGY       
Sbjct: 140 NCRIYPGVYIGEDCVIGDDVTIHANAVFYPDVKLGNRVLIHAAAVLGCDGFGYRFEAGRF 199

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI H+G V I+D VEIGA + IDRG I  T+IGE TKIDNQV I HN  IG      SQ
Sbjct: 200 IKIPHLGSVRIEDDVEIGAGTTIDRGMIGPTVIGEGTKIDNQVMIAHNCEIGKHNAFASQ 259

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
           VG AGS   GD V   GQ G+A ++ IGD   + +++GV +DIP G+ + G PA P  E 
Sbjct: 260 VGFAGSITTGDYVRCAGQVGVADHVHIGDQATLGARAGVHRDIPPGEVHIGTPAAPEKEQ 319

Query: 331 LRHMVM 336
            R +VM
Sbjct: 320 -RKIVM 324


>gi|325105582|ref|YP_004275236.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pedobacter saltans DSM 12145]
 gi|324974430|gb|ADY53414.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Pedobacter saltans DSM 12145]
          Length = 343

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 168/308 (54%), Gaps = 9/308 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           ++  L+ I  A  G ++++ + K+ + +    AS +I + D+   + K I   L   P  
Sbjct: 23  VVNKLAKIEEAGEGSLAFLSNPKYESFLYTTNASVVIVNDDLT--LDKPIQSTLIRVPSA 80

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
             + +  +     + +  S    GI   +F+  D KI   V I   A +  G  +   + 
Sbjct: 81  YSSFSVLLEMYNTLKLNKS----GIEQPSFIHPDAKIGKNVYIGAFAYIGAGASVADNSK 136

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYA-RGVSDIHK 212
           + P + +G    +G N ++ +G  IY   ++GN+VI+HS   IG+DGFG+A +      K
Sbjct: 137 IYPHTFVGDNAHVGENSTLFSGVKIYHDCIVGNNVIIHSNTVIGSDGFGFAPQADGSYSK 196

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  IG VII+D VEIGAN+ IDR T+  TII +  K+DN +QI HN  IG   ++ SQ G
Sbjct: 197 ISQIGNVIIEDDVEIGANTCIDRATMGSTIIKKGVKLDNLIQIAHNAEIGSNTVVASQSG 256

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP-AGQQYGGMPARPIGEYL 331
           I+GST IG+N +IGGQ GI G++ +    Q+ ++SG+ + I   G+++GG PA     Y+
Sbjct: 257 ISGSTKIGENCIIGGQVGIVGHISVAKGSQVQAQSGINRPIADEGKKWGGSPAISYQNYM 316

Query: 332 RHMVMLSK 339
           R  V++ +
Sbjct: 317 RSQVVIQR 324


>gi|306815222|ref|ZP_07449371.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli NC101]
 gi|222032009|emb|CAP74748.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli LF82]
 gi|305850884|gb|EFM51339.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli NC101]
 gi|312944787|gb|ADR25614.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O83:H1 str. NRG 857C]
          Length = 341

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQK--------IAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|313158129|gb|EFR57534.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Alistipes sp. HGB5]
          Length = 344

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 159/309 (51%), Gaps = 8/309 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  ++++S I     G ++Y+ + K+   +    AS ++ ++   P    +   +  D  
Sbjct: 22  ETKVHTVSSIEEGKAGSLTYLTNPKYETFLYSTGASIVLVNRSFEPSQQVSATLIKVDDA 81

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                 A  +L    M+  A     GIS  A + E  ++     I    VV  GV+IG+ 
Sbjct: 82  ------AACVLKLLEMYNAAKPRRSGISKLASVAEKAEVGADCYIGDFTVVEAGVKIGKN 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGY-ARGVSDI 210
             + P   +GAGV +G    +  G  +Y    IG + ILH+G  +G DGFG+        
Sbjct: 136 CQIYPQVYLGAGVTVGEGTILYPGVKVYEGCRIGRNCILHAGAVVGADGFGFMPNAAGGF 195

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  +G V+I+D VEIGAN+ IDR   D T+I    K+DN +QIGHNV IG   +  +Q
Sbjct: 196 DKIPQLGNVVIEDDVEIGANTCIDRAKTDSTVIRRGVKLDNLIQIGHNVQIGENTVSSAQ 255

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAG++ +G N  + GQ GIA ++ +GD V+I SKSG+ KD+P G+   G PA P  +Y
Sbjct: 256 TGIAGTSRVGRNCFLAGQVGIADHVNVGDFVKIGSKSGLDKDVPDGEVRFGYPALPGMQY 315

Query: 331 LRHMVMLSK 339
            R   +  +
Sbjct: 316 HRSAAVFKR 324


>gi|94968962|ref|YP_591010.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Koribacter versatilis Ellin345]
 gi|119371423|sp|Q1IQB4|LPXD1_ACIBL RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 1
 gi|94551012|gb|ABF40936.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Candidatus Koribacter versatilis Ellin345]
          Length = 337

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 175/329 (53%), Gaps = 11/329 (3%)

Query: 13  IALMKLAQSIGASLLD-ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           + L ++A+ +G +L +  +     I +++ I  A   DI+++ + ++    +   A AII
Sbjct: 1   MKLSEIARRLGCTLDNCPDPDAVEITAVTGIEAAGPTDITFVSNPRYAAAAKTTHAGAII 60

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKI 131
            S D   F     P + S  P ++FA A  + Y      +A  +  GI P A +    K+
Sbjct: 61  VSDD---FTAGRAPLVRSKNPYLTFAKAIELFY------QAPKYAPGIHPTAVISPTAKV 111

Query: 132 EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVIL 190
                I P  V+   V IG    +    VI  GV IG N    A + +     IGN+VIL
Sbjct: 112 GANASIGPYVVIEDNVAIGANCVLRAHVVIYEGVTIGDNFFAHAHAVVREHCRIGNNVIL 171

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
            +GV IG DG+G+AR     +KI   G  I+ D VE+ ANS +DR +I +T I  + KID
Sbjct: 172 QNGVVIGADGYGFARDTDGWYKIAQSGTTILDDNVEVQANSTVDRASIGETHIYADAKID 231

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N V IGH   +G   ++ SQVG+AGS+++G NV++ GQ G+AG+L IGD V  A ++GV 
Sbjct: 232 NLVMIGHGSSVGEHSLLCSQVGLAGSSHVGKNVILAGQVGVAGHLHIGDGVIAAGQTGVQ 291

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            DI  G++ GG P+    +++R   + ++
Sbjct: 292 NDIEPGKRIGGSPSYDHKQWIRSWQIQTR 320


>gi|170768507|ref|ZP_02902960.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia albertii TW07627]
 gi|170122611|gb|EDS91542.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia albertii TW07627]
          Length = 341

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 174/324 (53%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           +   V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGSNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEVQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  IG DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVIGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|78223558|ref|YP_385305.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter metallireducens GS-15]
 gi|119371935|sp|Q39T44|LPXD_GEOMG RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|78194813|gb|ABB32580.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Geobacter metallireducens GS-15]
          Length = 345

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 98/223 (43%), Positives = 136/223 (60%), Gaps = 1/223 (0%)

Query: 118 GISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGS 177
           G+   A +G +V +   V I P A V  GV +G +  + PG VI  GV +G + ++ +  
Sbjct: 99  GVMEGALVGHNVAMGSDVTIYPGAFVGDGVTLGDRVTIFPGVVIYEGVTLGSDVTLHSNV 158

Query: 178 SIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRG 236
            +Y    IGN V +H+G  IG+DGFGYA      +KI  +G V+I+D VE+GAN+ IDR 
Sbjct: 159 VVYQGCRIGNRVTIHAGTIIGSDGFGYAPDGDGFYKIPQLGIVVIEDDVEVGANTTIDRA 218

Query: 237 TIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLK 296
            +  T IG  TKIDN V I HN  IG  C IVSQVGI+GST +G  V + GQ G+AG+L+
Sbjct: 219 ALAATRIGRGTKIDNLVMIAHNCVIGENCTIVSQVGISGSTKLGRRVTLAGQVGVAGHLE 278

Query: 297 IGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           IGDN  + +KSG+  +IPAG    G+PA    ++LR   ++ K
Sbjct: 279 IGDNSMVGAKSGIPGNIPAGSMVSGIPAFNHRDWLRASAVVPK 321


>gi|86130211|ref|ZP_01048811.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Dokdonia donghaensis MED134]
 gi|85818886|gb|EAQ40045.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Dokdonia donghaensis MED134]
          Length = 341

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 113/332 (34%), Positives = 173/332 (52%), Gaps = 11/332 (3%)

Query: 16  MKLAQSIGASLLD---ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           MK   +  A +L+   E   E  +  L+ I   + G ++++ + K+ + I   +AS  I 
Sbjct: 1   MKFTATQIAGILEGTVEGNPEVEVSKLAKIEEGTPGSLTFLANPKYTSYIYSTEASIAIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D V    + +   L    +   + +  + Y   + +  S    GI    F+ +     
Sbjct: 61  GNDFVA--DQEVKPTLIRVEDAYKSFSKLLEYYNQVKLSKS----GIEQPCFISDTASYG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
           +G+ +   + +   V IG    + P   IG  V IG NC + AGS +YS S+IGN+V +H
Sbjct: 115 EGLYLGAFSYLGDNVRIGDNVKIYPNVYIGDNVTIGDNCVLFAGSKVYSDSVIGNTVYIH 174

Query: 192 SGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  +G DGFG+      +  K+   G VII+D V+IGA + IDR T+  TII +  K+D
Sbjct: 175 SGAIVGADGFGFTPNEKGEYSKVPQTGNVIIEDHVDIGAGTTIDRATLGSTIIRKGVKLD 234

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           NQ+QI HNV IG    I +Q GIAGST IG + LIGGQ GI+G+L IGD V+I ++SG+ 
Sbjct: 235 NQIQIAHNVEIGAHTAIAAQTGIAGSTKIGKHCLIGGQVGISGHLTIGDKVRIQAQSGIG 294

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSKPSK 342
           ++I  G+   G P+    ++ R  V      K
Sbjct: 295 RNIKDGEVLQGSPSFNYADWNRSYVHFKNLPK 326


>gi|326798953|ref|YP_004316772.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sphingobacterium sp. 21]
 gi|326549717|gb|ADZ78102.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sphingobacterium sp. 21]
          Length = 345

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 113/325 (34%), Positives = 171/325 (52%), Gaps = 43/325 (13%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIP--------KN--- 83
           ++  +  I  AS G ++++ + K+ N +   +AS +I + D+    P        KN   
Sbjct: 23  VVSRVEKIEEASQGGLTFLANPKYENYLYTTEASIVIVNNDLTVEEPISATLIRVKNAYT 82

Query: 84  -IPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVK------IEDGVV 136
            I  LL    +  F   G         +E  S+   I P A LGEDV       I D VV
Sbjct: 83  AITLLLEQYNKFRFHKTG---------VETPSY---IHPSAKLGEDVYVGAFSYIGDNVV 130

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRI 196
           +     +YP V IG    +G GS++  GV+I  +C           ++G +V++HSG  I
Sbjct: 131 LEDNVSIYPQVYIGDNVKIGAGSILFPGVKIYHDC-----------VLGKNVVIHSGTVI 179

Query: 197 GNDGFGYA-RGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           G+DGFG+A +      KI  IG V+I+D VEIG+NS IDR T+  TII +  K+DN +Q+
Sbjct: 180 GSDGFGFAPQEDGTYRKISQIGNVVIEDDVEIGSNSTIDRATMGHTIIRKGVKLDNLIQL 239

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HNV +G   +I +Q GI+GST IG NV++GGQ G  G++ I D  Q+ ++SG+ + I  
Sbjct: 240 AHNVEVGENSVIAAQTGISGSTKIGKNVVLGGQVGAVGHITIADGTQVQAQSGINRSIDT 299

Query: 316 -GQQYGGMPARPIGEYLRHMVMLSK 339
            G ++ G PA      +R  V+L +
Sbjct: 300 PGLKWAGTPASQFQNQMRAQVVLQR 324


>gi|110637448|ref|YP_677655.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Cytophaga hutchinsonii ATCC 33406]
 gi|119371929|sp|Q11WA1|LPXD_CYTH3 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|110280129|gb|ABG58315.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Cytophaga hutchinsonii ATCC 33406]
          Length = 349

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 169/311 (54%), Gaps = 8/311 (2%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDK 91
           G+  + S++ I  AS+G IS++ + K+ + I    ASA+I  +D  P        +L D 
Sbjct: 20  GKAKVSSIAKIEEASSGSISFLSNPKYESFIYSTNASAVIVKKDFQPRESLKTSLILVDD 79

Query: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151
           P  SF    +IL      + AS    G    +F+G++  I     I   A +    +IG 
Sbjct: 80  PYTSFT---TILEAYQQALNASKM--GKEEPSFIGKNAVIGSNHYIGAFAYIGSNCKIGN 134

Query: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDI 210
              + P + IG  V IG N +I AG  IY++  +GN V +HSG  IG+DGFG+A      
Sbjct: 135 NVKIYPQAYIGDNVTIGDNTTIYAGVKIYANCELGNQVTIHSGCVIGSDGFGFAPQADGT 194

Query: 211 HKIV-HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVS 269
           +K +  IG V+I + V+IGAN+ ID  T+  TII +  KIDN +QI HNV IG   +I +
Sbjct: 195 YKTIPQIGNVVIGNHVDIGANTVIDCATMGSTIIYDGVKIDNLIQIAHNVKIGKNTVIAA 254

Query: 270 QVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI-PAGQQYGGMPARPIG 328
           Q GI+GST IG+N +I GQ GI G++KI +   IA+++G+ + I   G    G PA    
Sbjct: 255 QAGISGSTTIGENCIIAGQVGIIGHIKIANKTTIAAQAGIGRTISEEGLTLLGSPAIEKL 314

Query: 329 EYLRHMVMLSK 339
           ++L+   +  K
Sbjct: 315 DFLKSFAIYRK 325


>gi|196231508|ref|ZP_03130366.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chthoniobacter flavus Ellin428]
 gi|196224361|gb|EDY18873.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chthoniobacter flavus Ellin428]
          Length = 390

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/255 (40%), Positives = 142/255 (55%), Gaps = 21/255 (8%)

Query: 78  PF-IPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
           PF  P+ +   + D   V+FA    + +P+        +  GI P        ++     
Sbjct: 97  PFRSPEKVLIRVRDA-RVAFARLLPLFFPE------EQYPAGIHPSVVTASSAEVH---- 145

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-------SSLIGNSVI 189
             P A + PG  IG    +G  SV+  G  +G+N  +G    ++        +LIGN V 
Sbjct: 146 --PTAHIGPGCVIGEGACIGARSVLVGGNHLGKNVHLGEDVRLFPNVVVYDQTLIGNRVT 203

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           +H+G  IG DGFGY        KI  +G+V+I+D VEIGANSAIDRG +  T+IG  TKI
Sbjct: 204 IHAGTVIGADGFGYVFDQGVHRKIQQVGKVVIEDDVEIGANSAIDRGALGSTVIGAGTKI 263

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN V I HNV +G  C+I+ QVG AGST +GD V++  Q GIAG+L +GD   I +KSGV
Sbjct: 264 DNLVHIAHNVVLGRHCLIMGQVGFAGSTRLGDYVVVASQSGIAGHLHLGDQATIGAKSGV 323

Query: 310 LKDIPAGQQYGGMPA 324
           ++D+PAG    G+PA
Sbjct: 324 MRDVPAGGTVLGIPA 338


>gi|323170971|gb|EFZ56620.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli LT-68]
          Length = 341

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         ++GAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IVGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|320186601|gb|EFW61326.1| UDP-3-O-3-hydroxymyristoyl-glucosamine N-acyltransferase [Shigella
           flexneri CDC 796-83]
          Length = 323

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 117/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|297622564|ref|YP_003703998.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Truepera radiovictrix DSM 17093]
 gi|297163744|gb|ADI13455.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Truepera radiovictrix DSM 17093]
          Length = 954

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 134/223 (60%), Gaps = 13/223 (5%)

Query: 130 KIEDGVVIAPMAVVYPGVEIGRK------------TYVGPGSVIGAGVRIGRNCSIGAGS 177
           ++ DG V+AP A +   V +G              + VGPG V+G GV +G +C + A  
Sbjct: 709 QLSDGAVVAPDATLGEAVSVGAGAVIGAGAVIGAGSRVGPGCVLGEGVTLGPDCVLHANV 768

Query: 178 SIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRG 236
           ++Y  + +G  VI+HSG  +G DGFGYA G     KI H+G V+I+D VE+GAN+ IDRG
Sbjct: 769 TLYPGTALGARVIVHSGAVLGADGFGYAFGPQGAVKIHHLGGVVIEDDVEVGANTCIDRG 828

Query: 237 TIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLK 296
           T+ DT +G  TKIDN  QIGHNV IG  C+I     I GST +   VL+GG   +  +++
Sbjct: 829 TLLDTRVGARTKIDNLCQIGHNVQIGPDCVIAGGSAIGGSTVLERGVLLGGAVAVTDHVR 888

Query: 297 IGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +G   ++  +S V K +PAG+ + G PA+P  +++R + ++ K
Sbjct: 889 LGAGARVGGRSSVTKSVPAGETWAGYPAKPQRKWVRELYLIGK 931


>gi|282898616|ref|ZP_06306604.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase, LpxD
           [Cylindrospermopsis raciborskii CS-505]
 gi|281196484|gb|EFA71393.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase, LpxD
           [Cylindrospermopsis raciborskii CS-505]
          Length = 346

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 113/317 (35%), Positives = 163/317 (51%), Gaps = 11/317 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI---VPFIPKNIPCLLSDKP 92
           I  ++ I  A  G ISY+   KF + +   KAS +I   D         + +  L + +P
Sbjct: 30  IRGVAAIDEAQAGTISYVEGPKFASLLTSTKASVLILPLDEKLHQQATAQGMAWLATPQP 89

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            + FA   S+ Y      +       I P A +   VKI D V I P  V+    EIG  
Sbjct: 90  RLLFAQTISLFY------QPYKPSPSIHPTAVIDPSVKIGDHVYIGPHVVILANTEIGNG 143

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
            ++ P  VI   V+IG    + A  +I+  S IG   ++HSG  IG +GFG+    +   
Sbjct: 144 VFIYPNVVIYPDVKIGDRTVLHANCAIHERSQIGADCVIHSGTVIGAEGFGFVPTTTGWL 203

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           K+   G  +++D VEIG NSA+DR  + +T IG++TKIDN VQIGH   IG GC I  Q 
Sbjct: 204 KMEQSGYTVLEDGVEIGCNSAVDRPAVGETRIGKHTKIDNLVQIGHGCQIGSGCAIAGQA 263

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GIAG   +G+ V++ GQ GIA  +KIGD   +++++GV  DI  G+   G PA P   YL
Sbjct: 264 GIAGGVKVGNRVILAGQTGIANQVKIGDGAIVSAQAGVHGDIAPGEIVSGSPALPHKLYL 323

Query: 332 RHMVMLSK-PSKYKIKR 347
           +   + S+ P  Y   +
Sbjct: 324 KVSAVYSRLPEIYNFFK 340


>gi|37522282|ref|NP_925659.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gloeobacter violaceus PCC 7421]
 gi|60390197|sp|Q7NH24|LPXD2_GLOVI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|35213282|dbj|BAC90654.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gloeobacter violaceus PCC 7421]
          Length = 345

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 176/329 (53%), Gaps = 13/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA  +G  +  E   +  I  L+ I +A  G++S+I S K+   I+  +A A+I 
Sbjct: 1   MKLGELAAHLGCPV--EGNPDVEIRGLASIQQAGPGELSFIESEKYARFIKLTRAEALIL 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
                P     +PC+ S++P ++FA A  + Y      +      GI P A LG +V++ 
Sbjct: 59  DWR-TPV--SKVPCIRSEQPRLTFAHALELFY------QPRRPAPGIHPTAILGANVQLG 109

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILH 191
           + V +    V+   V IG +  + P   I   VRIG    + A   ++  + IG+  I+ 
Sbjct: 110 ENVHLGAYVVIGDDVTIGPEAVIYPNCTIYNDVRIGVRTVVHANCVLHERTKIGDECIVQ 169

Query: 192 SGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKID 250
           SG  +G +GFG+        HK+   G V ++D+VEIG+N+AIDR ++  T IG  TKID
Sbjct: 170 SGAVVGGEGFGFVPTPEGTWHKMPQSGYVRVEDQVEIGSNAAIDRPSVGFTHIGRGTKID 229

Query: 251 NQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVL 310
           N V +GH   IG  C++V QVG+AG   +G NV++ GQ G+AG+  IGD   ++++SG+ 
Sbjct: 230 NLVMVGHGCEIGEHCLLVGQVGLAGGVKLGRNVVLAGQVGVAGHAAIGDRTVVSAQSGIP 289

Query: 311 KDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            D+  G    G PA P   +LR   ++ +
Sbjct: 290 SDVEPGTVVSGSPALPHALWLRTSALIRR 318


>gi|251790735|ref|YP_003005456.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Dickeya
           zeae Ech1591]
 gi|247539356|gb|ACT07977.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Dickeya
           zeae Ech1591]
          Length = 340

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 177/322 (54%), Gaps = 24/322 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I +++ +  A  G I+++   ++   +   +ASA++ 
Sbjct: 4   IRLDALAQQLDAQLHGD--GDIVITAVASMHSAQAGQITFLSDSRYREQLSSTQASAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           ++  +PF   NI  L+   P +++A        Q M    +  +G I+P A +  D ++ 
Sbjct: 62  TEADLPFC--NIAALVVKNPYLAYA-----RMAQLMDTTPAPAQG-IAPSAVIAPDARLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
           DGV +   AV+  GVE+G       G+VIGAG  IG+N  IGAG+ +++++       +G
Sbjct: 114 DGVSVGANAVIESGVELG------DGAVIGAGCFIGKNARIGAGTRLWANVTIYHNIVLG 167

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
              ++ SG  IG+DGFGYA    +  KI  +G VII D+VEIGA++ IDRG +DDTIIG 
Sbjct: 168 EKCLIQSGAIIGSDGFGYANDRGNWIKIPQLGTVIIGDRVEIGASTTIDRGALDDTIIGN 227

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
              IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +  
Sbjct: 228 GVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTG 287

Query: 306 KSGVLKDIPAGQQY-GGMPARP 326
              V++ I     Y  G+P +P
Sbjct: 288 MGMVMRPITEPGVYSSGIPLQP 309


>gi|315223691|ref|ZP_07865541.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga ochracea F0287]
 gi|314946266|gb|EFS98265.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga ochracea F0287]
          Length = 339

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 169/309 (54%), Gaps = 14/309 (4%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +Y LS I   S G IS++ + K+ + I   +AS +I ++D       +   +  D    +
Sbjct: 24  VYKLSKIEEGSEGSISFLANPKYKHFIYTTQASIVIVNKDFEAEDKISATLVRVDDAYAA 83

Query: 96  FAIAGSILYPQAMH---MEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
           F           M+   +E  SF   I+  A +G++V I   V I    V+   V+I   
Sbjct: 84  FTKLLEFYNQVKMNKVGIEQPSF---IASSAKIGQNVYIGAFVYIGENVVISDNVKIYPN 140

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVS-DI 210
           TY+G  S +G G       +I AG  IYS ++IG   ILHSGV +G DGFG+      + 
Sbjct: 141 TYIGDNSSVGEG------TTIFAGCKIYSETVIGKDCILHSGVVLGADGFGFQPNEKGEF 194

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            ++  IG V+I+D V+IGA +AIDR T+  TII +  K+DNQ+ I HNV IG   +I +Q
Sbjct: 195 SRVPQIGNVVIEDSVDIGAETAIDRATLGSTIIRKGVKLDNQIHIAHNVEIGKNTVIAAQ 254

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAGST +G+N +IGGQ GI G+L IG+ V+I +++GV +++   +   G PA    EY
Sbjct: 255 TGIAGSTKVGENCMIGGQVGIVGHLVIGNRVKIQAQTGVGRNLKDDEAIQGSPALGHAEY 314

Query: 331 LRHMVMLSK 339
            +  V+  K
Sbjct: 315 NKAYVIFRK 323


>gi|312970280|ref|ZP_07784462.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 1827-70]
 gi|310337778|gb|EFQ02889.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 1827-70]
          Length = 341

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 175/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMVQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDTII
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTII 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|301057969|ref|ZP_07199026.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [delta
           proteobacterium NaphS2]
 gi|300447936|gb|EFK11644.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [delta
           proteobacterium NaphS2]
          Length = 346

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 114/335 (34%), Positives = 180/335 (53%), Gaps = 16/335 (4%)

Query: 13  IALMKLAQSIGASLLD-ENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAII 71
           I + K A+ +G   +  ENF   ++  ++ + +A   +IS+    ++ + ++K KA A++
Sbjct: 3   IPITKAAEMVGGECVGGENF---VVKGINALDQAGPSEISFFSDHRYGDRLKKTKAGALL 59

Query: 72  CSQDIVPFIPKNIPCLLSDKPEVSFA-IAGSILYPQAMHMEASSFEGGISPQAFLGEDVK 130
            S     F   N P +++    +++A IA     P   +        G+S  A +G D +
Sbjct: 60  VSGINEEF---NGPQIITANVALAYAKIAAFFAVPPTRYP-------GVSSDAVIGGDCR 109

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVI 189
           + + V + PM  V  G EIG    + PG V+  GV++G+   +    ++    +IGN VI
Sbjct: 110 LGEDVSVFPMVYVGKGCEIGDGATLFPGVVLDQGVKVGKRTVLYPNVTVLRGCIIGNDVI 169

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           +H+G  IG+DGFG+ R  +   K+   G V I D VEIGAN+ IDR     T I E  K 
Sbjct: 170 VHAGTTIGSDGFGFVRDGASSVKVPQTGIVQIDDHVEIGANNCIDRAAFGKTWIKEGVKT 229

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DN VQI HNV IG   I+V+  GI+GS+ +G  V+IGGQ GI  + +IGD   +  +SGV
Sbjct: 230 DNLVQIAHNVVIGEHSIVVALAGISGSSRLGRGVMIGGQVGINDHTEIGDGAMVGPQSGV 289

Query: 310 LKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYK 344
            K IPAG  + G PA      LR+  ++++  ++K
Sbjct: 290 AKSIPAGGIFSGTPAVSHRTRLRNAALVARLPQFK 324


>gi|126663993|ref|ZP_01734987.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Flavobacteria bacterium BAL38]
 gi|126623942|gb|EAZ94636.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Flavobacteria bacterium BAL38]
          Length = 339

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 166/311 (53%), Gaps = 12/311 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           ++ LS I   + G ++++ + K+ N I   +A+  I +    P   ++I   L  K E +
Sbjct: 24  VFKLSKIEEGTKGSLTFLANPKYNNYIYSTQATITIVNHTFEP--EQDIITTLI-KVEDA 80

Query: 96  FAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKT 153
           +     +L  Y Q   M++     GI   + + E+V     + +     V   V IG   
Sbjct: 81  YQSFSKLLEYYNQVKLMKS-----GIEQPSVISENVVYGTDLYLGSFCYVGKNVTIGNNV 135

Query: 154 YVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYA-RGVSDIH 211
            + P S IG  V IG NC   AG  IYS   IG++  +HSG  IG+DGFG+A +      
Sbjct: 136 KIYPNSFIGDNVTIGDNCVFFAGVRIYSETEIGHNCTIHSGTIIGSDGFGFAPQEDGTFT 195

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           K+  IG VII+D VEIGA + +DR T+  TII +  K+DN +Q+ HNV I    +I +Q 
Sbjct: 196 KVPQIGNVIIEDNVEIGACTTVDRATLGSTIIRKGVKLDNHIQVAHNVEISENTVIAAQT 255

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           GIAG+T IG N LIGGQ G AG+L IGD V+I ++SG+ K+I AG+   G PA    ++ 
Sbjct: 256 GIAGTTKIGKNCLIGGQVGFAGHLVIGDGVKIQAQSGIGKNIEAGEVVQGSPAFNYRDFA 315

Query: 332 RHMVMLSKPSK 342
           +  V      K
Sbjct: 316 KSFVHFRNLPK 326


>gi|15835132|ref|NP_296891.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia muridarum Nigg]
 gi|270285304|ref|ZP_06194698.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia muridarum Nigg]
 gi|270289321|ref|ZP_06195623.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia muridarum Weiss]
 gi|301336701|ref|ZP_07224903.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlamydia muridarum MopnTet14]
 gi|20138775|sp|Q9PKF1|LPXD_CHLMU RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|7190554|gb|AAF39356.1| UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Chlamydia muridarum Nigg]
          Length = 354

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 176/328 (53%), Gaps = 32/328 (9%)

Query: 24  ASLLDENF---GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP-- 78
           A  L+  F   G  ++  +  I  A    ++++ + K+  +++  +A AII S+      
Sbjct: 12  ADFLNVEFQGNGATLLSGVEEIGEAKAAHVTFLDNEKYAKHLKSSEAGAIILSRTQFQKY 71

Query: 79  -FIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGG---ISPQAFLGEDVKIEDG 134
             + KN   ++S+ P        S+++ + + +  +  + G   I P A +     IE+ 
Sbjct: 72  RELNKNF-LIVSESP--------SLVFQKCLELFIAPVDSGFPGIHPTAVIHPTAIIEEH 122

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNS 187
           V I P  V+     IG   ++G GSVIGA      + SIG  S IY  +       IG  
Sbjct: 123 VCIEPYVVICQHARIGAACHIGTGSVIGA------HSSIGEHSYIYPRVVVRERVSIGKR 176

Query: 188 VILHSGVRIGNDGFGYARGVSDIHK-IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
           VI+  G  IG+ GFGY       HK + H+G VII+D VEIGAN+ IDRG    +I+ E 
Sbjct: 177 VIIQPGAIIGSCGFGYVTSAFGQHKHLKHLGTVIIEDDVEIGANTTIDRGRFKHSIVREG 236

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
           +KIDN VQI H V +G   ++V+Q GIAGST IG++V+IGGQ G+ G++ I D+V + ++
Sbjct: 237 SKIDNLVQIAHQVEVGQHSMVVAQAGIAGSTKIGNHVIIGGQAGVTGHICIADHVIMMAQ 296

Query: 307 SGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           +GV K I +   YGG PARP  E  R +
Sbjct: 297 TGVTKSITSPGIYGGAPARPYQEVHRQV 324


>gi|213964010|ref|ZP_03392254.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga sputigena Capno]
 gi|213953342|gb|EEB64680.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga sputigena Capno]
          Length = 339

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 111/309 (35%), Positives = 171/309 (55%), Gaps = 14/309 (4%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +Y LS I   + G IS++ + K+ + I   KAS +I ++D       +   +  D    +
Sbjct: 24  VYKLSKIEEGTEGGISFLANPKYKHFIYTTKASIVIVNKDFEAEDTISATLVRVDDAYAA 83

Query: 96  FAIAGSILYPQAMH---MEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
           F+          M+   +E  SF   ISP A +G++V +   V I    V+   V+I   
Sbjct: 84  FSKLLEFYNQVKMNKVGIEQPSF---ISPSAKIGKNVYVGAFVYIGENVVIGDNVKIYPN 140

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVS-DI 210
           TY+G  S       +G + +I AG  IYS ++IG   +LHSGV +G DGFG+      + 
Sbjct: 141 TYIGDNS------SVGDDTTIFAGCKIYSETVIGKDCMLHSGVVLGADGFGFQPNEKGEF 194

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            ++  IG V+I+D V+IGA +AIDR T+  TII +  K+DNQ+ I HNV +G   +I +Q
Sbjct: 195 SRVPQIGNVVIEDSVDIGAGTAIDRATLGSTIIRKGVKLDNQIHIAHNVEVGKNTVIAAQ 254

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAGST +G+N +IGGQ GI G+L IG+ V+I +++GV +++   +   G PA    EY
Sbjct: 255 TGIAGSTKVGENCMIGGQVGIVGHLVIGNRVKIQAQTGVGRNLKDDEAIQGSPALGHAEY 314

Query: 331 LRHMVMLSK 339
            +  V+  K
Sbjct: 315 NKAYVIFRK 323


>gi|256820582|ref|YP_003141861.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Capnocytophaga ochracea DSM 7271]
 gi|256582165|gb|ACU93300.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Capnocytophaga ochracea DSM 7271]
          Length = 339

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 169/309 (54%), Gaps = 14/309 (4%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +Y LS I   S G IS++ + K+ + I   +AS +I ++D       +   +  D    +
Sbjct: 24  VYKLSKIEEGSEGSISFLANPKYKHFIYTTQASIVIVNKDFEAEDKISATLVRVDDAYAA 83

Query: 96  FAIAGSILYPQAMH---MEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
           F           M+   +E  SF   I+  A +G++V I   V I    V+   V+I   
Sbjct: 84  FTKLLEFYNQVKMNKVGIEQPSF---IASSAKIGQNVYIGAFVYIGENVVISDNVKIYPN 140

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVS-DI 210
           TY+G  S +G G       +I AG  IYS ++IG   +LHSGV +G DGFG+      + 
Sbjct: 141 TYIGDNSSVGEG------TTIFAGCKIYSETVIGKDCMLHSGVVLGADGFGFQPNEKGEF 194

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            ++  IG V+I+D V+IGA +AIDR T+  TII +  K+DNQ+ I HNV IG   +I +Q
Sbjct: 195 SRVPQIGNVVIEDSVDIGAETAIDRATLGSTIIHKGVKLDNQIHIAHNVEIGKNTVIAAQ 254

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            GIAGST +G+N +IGGQ GI G+L IG+ V+I +++GV +++   +   G PA    EY
Sbjct: 255 TGIAGSTKVGENCMIGGQVGIVGHLVIGNRVKIQAQTGVGRNLKDDEAIQGSPALGHAEY 314

Query: 331 LRHMVMLSK 339
            +  V+  K
Sbjct: 315 NKAYVIFRK 323


>gi|324008241|gb|EGB77460.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli MS 57-2]
          Length = 341

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 174/322 (54%), Gaps = 24/322 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +QD +PF       L+   P +++A    IL       +       I+P A + E  K+ 
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPKPAQ------NIAPSAVIDETAKLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
           + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       IG
Sbjct: 114 NNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIG 167

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
            + ++ SG  +G DGFGYA    +  K   IGRVII D+VEIGA + IDRG +DDT+IG 
Sbjct: 168 QNCLIQSGTVVGADGFGYANDRGNWVKSPQIGRVIIGDRVEIGACTTIDRGALDDTVIGN 227

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
              IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +  
Sbjct: 228 GVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTG 287

Query: 306 KSGVLKDIPAGQQY-GGMPARP 326
              V++ I     Y  G+P +P
Sbjct: 288 MGMVMRPITEPGVYSSGIPLQP 309


>gi|262276517|ref|ZP_06054326.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Grimontia hollisae CIP 101886]
 gi|262220325|gb|EEY71641.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Grimontia hollisae CIP 101886]
          Length = 341

 Score =  169 bits (427), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 110/325 (33%), Positives = 172/325 (52%), Gaps = 18/325 (5%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L +LA+ +GA L  +  G   I  ++ + +A  G I+++ S K+  ++ +C+ASA++ 
Sbjct: 4   ITLAELAEKLGAELHGD--GSVQISEIAGMDKAGEGQITFLSSSKYRKHLAECQASAVMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY---PQAMHMEASSFEGGISPQAFLGEDV 129
            +  + +   N   L+   P + +A+   +L    P A           I+P A++    
Sbjct: 62  KEADLAYCTGN--ALVMKDPYLGYALTAQLLDSTPPCATD---------IAPSAYVSPSA 110

Query: 130 KIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSV 188
           K+ DGV I   AV+  GVE+G    +G G  IG   ++G N  + A  ++Y  + IG S 
Sbjct: 111 KLGDGVSIGHNAVIEEGVELGDSVQIGAGCFIGKNAKLGANTRLWANVTVYHDVVIGKSC 170

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTK 248
           ++ SG  IG+DGFGYA       KI  +GRV+I D+VEIGA + IDRG I+DT+I +   
Sbjct: 171 LIQSGTVIGSDGFGYANDKGRWVKIPQVGRVVIGDRVEIGACTTIDRGAIEDTVIADGVI 230

Query: 249 IDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSG 308
           IDNQ QI HNV IG    I     +AGS  +G   +IGG     G+++I D V I   + 
Sbjct: 231 IDNQCQIAHNVSIGENTAIAGATVMAGSLKVGKQCIIGGASVFNGHMEITDGVTITGMAM 290

Query: 309 VLKDIPAGQQY-GGMPARPIGEYLR 332
           V++ I     Y  G+P +   E+ +
Sbjct: 291 VMRPITEPGMYSSGIPLQTNKEWRK 315


>gi|325111095|ref|YP_004272163.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Planctomyces brasiliensis DSM 5305]
 gi|324971363|gb|ADY62141.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Planctomyces brasiliensis DSM 5305]
          Length = 361

 Score =  169 bits (427), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 131/231 (56%), Gaps = 20/231 (8%)

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILHSGVR 195
           I P A V P   +G    VGP ++IGAG +IG  C I AG ++  +++ G+ V LH  V 
Sbjct: 104 IDPSAQVDPTAVLGSDVSVGPNAIIGAGCQIGDRCRIHAGVTLGPNVVLGDDVELHPKVV 163

Query: 196 I------------------GNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT 237
           I                  G DGFGY        K+ H GRVI++D VE+GA S IDRG 
Sbjct: 164 IYGGCVLKNRVGVHANSVIGADGFGYRFEAGQFVKLPHYGRVILEDDVEVGACSTIDRGM 223

Query: 238 IDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKI 297
           IDDT+IG+ +KIDNQV I HN  IG   I+VSQVG+AGS   GD    GGQ G+A ++ I
Sbjct: 224 IDDTVIGQGSKIDNQVMIAHNCEIGKHNIVVSQVGLAGSVTTGDYCRFGGQVGVADHVHI 283

Query: 298 GDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLR-HMVMLSKPSKYKIKR 347
           G+   + ++SGV KD+PAG   GG PA P+ E+ +  M  L  P   +  R
Sbjct: 284 GEKSSLMARSGVYKDMPAGDTSGGSPALPVDEWKKILMATLKLPELRQTVR 334


>gi|254508664|ref|ZP_05120779.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Vibrio
           parahaemolyticus 16]
 gi|219548421|gb|EED25431.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Vibrio
           parahaemolyticus 16]
          Length = 343

 Score =  169 bits (427), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 109/322 (33%), Positives = 174/322 (54%), Gaps = 12/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I+L  LA   G  L  +     M+  ++P+ +A  GD++++ + K+  ++  C+A+ ++ 
Sbjct: 4   ISLADLATITGGELHGD--ASAMVTMVAPMDKAQEGDVTFLSNPKYAKHLADCQATVVMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +        N+  L+ D P V+FA        QA+    S     I+P A + +DVK+ 
Sbjct: 62  KEAQREACSGNV--LVVDDPYVAFA-----KVAQALDTTPSPATS-IAPSAVIADDVKLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILH 191
           D V +   AV+  GVE+G    +G G  IG   +IG N  + +  SIY  ++ G+  ++ 
Sbjct: 114 DNVSVGANAVIESGVELGDNAVIGAGCFIGKNAKIGANTKLWSNVSIYHDVVLGDDCLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           +   IG+DGFGYA    +  KI  +G VII ++VEIG+ + IDRG ++DTII +N  +DN
Sbjct: 174 ANTVIGSDGFGYANEKGEWIKIPQLGSVIIGNRVEIGSCTTIDRGALEDTIIEDNVILDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNV IG G  +     +AGST IG   +IGG   I G+++I D V I     V++
Sbjct: 234 QMQIAHNVQIGYGTAMAGGTIVAGSTKIGKYCIIGGGTVINGHIEIVDGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            I     Y  G+P +P  E+ +
Sbjct: 294 GISEKGMYSSGIPLQPNKEWRK 315


>gi|120555449|ref|YP_959800.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Marinobacter aquaeolei VT8]
 gi|120325298|gb|ABM19613.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Marinobacter aquaeolei VT8]
          Length = 341

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 165/307 (53%), Gaps = 11/307 (3%)

Query: 8   VSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKA 67
           ++ K   L ++A+++GASL  +   +  I  L+ +  A  G IS++ +  +   ++  +A
Sbjct: 1   MTQKSYRLQEIAEALGASLRGDP--DIRITGLATLQAAVPGQISFLANPSYAKYLKDTRA 58

Query: 68  SAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGE 127
           SA+I S      +P N+  LL D P + +A       P      A     GI P A + E
Sbjct: 59  SAVIVSSAAADDVPTNV--LLLDNPYLGYAHLSHWFDP------APKASPGIHPTAVVDE 110

Query: 128 DVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGN 186
              I +   I P  V+  GV IG +  +G G  +GA   IG +  +    ++ +  ++G 
Sbjct: 111 SASIPESASIGPHVVIEAGVCIGERVAIGAGGFVGARASIGDDSILRPRVTLAHDVVVGK 170

Query: 187 SVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGEN 246
              + SG  +G+DGFG+A      H+I  +G V++ D VE+GAN+ IDRG +DDT IG  
Sbjct: 171 RCHILSGAVVGSDGFGFANEKGVWHRIAQLGAVVLGDDVEVGANTTIDRGALDDTTIGNG 230

Query: 247 TKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASK 306
            K+DN +QI HNV IG    + ++VGIAGST IG++ + GG  G+AG+L+I D V +   
Sbjct: 231 VKLDNLIQIAHNVQIGDHSAMAAKVGIAGSTRIGNHCVFGGASGVAGHLEIADQVHLTGM 290

Query: 307 SGVLKDI 313
           + V  DI
Sbjct: 291 TLVTGDI 297


>gi|218547634|ref|YP_002381425.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|218355175|emb|CAQ87782.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia fergusonii ATCC 35469]
          Length = 341

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 174/324 (53%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I    V+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANVVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|228469551|ref|ZP_04054544.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas uenonis 60-3]
 gi|228308901|gb|EEK17576.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas uenonis 60-3]
          Length = 342

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 166/326 (50%), Gaps = 14/326 (4%)

Query: 18  LAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV 77
           +A+ IG +L  E  G   +   + I +A  GD+S++ + K+   +    ASA++  +   
Sbjct: 7   IAKLIGGTL--EGDGTAQLQGFAGIEQAKAGDLSFLANMKYEPFLYTTHASAVLVDEKFT 64

Query: 78  PFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE---GGISPQAFLGEDVKIEDG 134
           P  P     +    P  + +        Q M +  S  E    G+ P A +   V I   
Sbjct: 65  PTQPCPTTLIRVANPYETLS--------QLMRLYVSQQEPRWTGVHPTAIVDPSVTIPKE 116

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSG 193
            +I P A +   V++G +  +    VIG    IG + ++    ++YS S+IG+   +H+G
Sbjct: 117 CIIGPYACIEADVKLGEQVVISAHCVIGTNCSIGDHTTLHPRVTLYSDSVIGHHCRIHAG 176

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG DGFG+A       KI  IG V I D VEIGANS IDR T+  T I    KIDN V
Sbjct: 177 TVIGADGFGFAPTEHGYDKIPQIGHVEIGDNVEIGANSCIDRATMGVTRIASGVKIDNLV 236

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HN  +    +I +Q G+AGS +I +   +GGQ GIAG+L +GD+ Q+  ++GVL ++
Sbjct: 237 QIAHNCTVDEHTVIAAQAGLAGSAHIKEWCQLGGQVGIAGHLTVGDHSQLGGQTGVLGNL 296

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSK 339
                  G PA P+G+ LR   ML K
Sbjct: 297 QPHSVVMGAPAMPVGKALRAFAMLPK 322


>gi|288800095|ref|ZP_06405554.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella sp. oral taxon 299 str. F0039]
 gi|288333343|gb|EFC71822.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella sp. oral taxon 299 str. F0039]
          Length = 344

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 161/305 (52%), Gaps = 7/305 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           I S + I     G IS+I + K+++ I   ++S ++  + +V  + K I   L       
Sbjct: 24  INSFAKIEEGKQGAISFISNPKYIHYIYTTQSSIVLLDESVV--LDKPISTTLIRVKNAY 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
            A+A  +     ++  +   + GI P A +     I   V I P   +  GV IG  T V
Sbjct: 82  EAVAKLL----QIYSASKPQKKGIDPTASIASSATIGKDVYIGPFVFIGEGVTIGDNTQV 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P +VI     IG NC I    +IY    +GN++I+HSG  IG DGFG+A   +   KI 
Sbjct: 138 YPHTVILDNTSIGNNCIIYPNVTIYHECKLGNNIIIHSGSVIGADGFGFAPSENGYDKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            IG V I+D VEIGANS +DR T+  T I +  K+DN VQI HN  IG   ++ +QVGIA
Sbjct: 198 QIGIVTIEDDVEIGANSCVDRSTMGSTYIRKGVKLDNLVQIAHNTDIGKNTVMSAQVGIA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GST +G+  + GGQ G+AG++KIG+ V + ++SGV   +   Q+  G P  P   Y +  
Sbjct: 258 GSTSVGEWCMFGGQVGVAGHIKIGNKVFLGAQSGVPGSLEDNQKLIGTPPMPQRAYFKSQ 317

Query: 335 VMLSK 339
            +  +
Sbjct: 318 AIFQR 322


>gi|119898190|ref|YP_933403.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Azoarcus sp. BH72]
 gi|166199071|sp|A1K6R1|LPXD_AZOSB RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|119670603|emb|CAL94516.1| probable UDP-3-O-[3-hydroxymyristol] glucosamine N-acyltransferase
           [Azoarcus sp. BH72]
          Length = 341

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 119/326 (36%), Positives = 177/326 (54%), Gaps = 14/326 (4%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L +LA  +G  ++ +      +  ++ + +A  GD+S++ + K++  ++   ASAII + 
Sbjct: 4   LDELAARLGGDVVGDP--ATTVRRVATLEQAGEGDLSFLANPKYVGRLKSSHASAIIVAD 61

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
                + +    +  D P + FA    +  P        +   G+ P       V +   
Sbjct: 62  SARSLLGEKAGIVTRD-PYLYFARVAQLFNPP------EAVAPGVHP--LADVAVAVPAS 112

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSG 193
           V +A  A +  GVE+G    +G GS IGAGVRIG    +     IY   +IG + ++H+G
Sbjct: 113 VAVAAGASIGAGVELGEDVVIGAGSSIGAGVRIGAGTRLAPRVVIYPGCVIGTNCLIHAG 172

Query: 194 VRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
             IG+DGFG+AR  S    KI  +GRV+I D VEIGAN+ IDRG +DDT+IG   KIDNQ
Sbjct: 173 AVIGSDGFGFAREKSGAWVKIPQVGRVVIGDDVEIGANTTIDRGALDDTVIGNGVKIDNQ 232

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           +QIGHNV IG    I   VGIAGST IG   +IGGQ GI G+L I D+V I++ + V K 
Sbjct: 233 IQIGHNVRIGDYTAIAGCVGIAGSTQIGARCMIGGQAGIIGHLTIADDVVISAGTLVTKS 292

Query: 313 I-PAGQQYGGMPARPIGEYLRHMVML 337
           I   G     +P +P  +++++   L
Sbjct: 293 IHKPGVYTANLPVQPHADWVKNFAHL 318


>gi|261211368|ref|ZP_05925656.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           sp. RC341]
 gi|260839323|gb|EEX65949.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           sp. RC341]
          Length = 320

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 156/293 (53%), Gaps = 14/293 (4%)

Query: 44  RASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL 103
           +A  G+++++ + K+  ++ +CKA+ I+         P N   L+   P V+FA     L
Sbjct: 3   KAQLGNVTFLSNPKYSKHLSECKATVIMVKASERELCPGN--ALVVADPYVAFAKVTQAL 60

Query: 104 --YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVI 161
              P   H        GI+P A + ED K+   V I   AV+  GV++G    VG G  I
Sbjct: 61  DSTPAPAH--------GIAPSAVIAEDAKLGSNVSIGANAVIESGVQLGDNVVVGAGCFI 112

Query: 162 GAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVI 220
           G   R+G N  + A  +IY  + IG+  ++ SG  IG DGFGYA    +  KI  +G V 
Sbjct: 113 GKQARLGDNTKLWANVTIYHKVEIGSDCLIQSGTVIGADGFGYANERGEWIKIPQLGSVR 172

Query: 221 IQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIG 280
           I D+VEIGA + IDRG +DDT+I +N  IDNQ+QI HNVHIG G  +     IAGST IG
Sbjct: 173 IGDRVEIGACTTIDRGALDDTVIEDNVIIDNQLQIAHNVHIGYGSALAGGTIIAGSTRIG 232

Query: 281 DNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GGMPARPIGEYLR 332
              +IGG   I G+++I D V I     V++ I     Y  G+P +   E+ +
Sbjct: 233 KYCIIGGASVINGHIEIADGVTITGMGMVMRSIEEKGMYSSGIPLQTNKEWRK 285


>gi|33240313|ref|NP_875255.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|81664576|sp|Q7VC79|LPXD_PROMA RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|33237840|gb|AAP99907.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
          Length = 345

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 116/336 (34%), Positives = 175/336 (52%), Gaps = 22/336 (6%)

Query: 15  LMKLAQSIGASLLDENFGER-MIYSLSPIARASTGDISYIISRKFL-NNIEKCKASAIIC 72
           L+++  +  + L+D N      I S + + +A    IS+I +  +L N I + KASA+I 
Sbjct: 6   LIEILNNGDSGLIDHNLSSNPEINSAASLEKAEVNQISFIENASYLFNEINQTKASALIL 65

Query: 73  SQ--DIVPFIP-KNIPCLLSDKPEVSFA-----IAGSILYPQAMHMEASSFEGGISPQAF 124
            +  DI   +  KNI  +    P ++FA     I  + ++P+++H           P A 
Sbjct: 66  GEKVDITEKLDLKNIAWVTVKNPRIAFAEILEEINPTKVFPESIH-----------PSAV 114

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SL 183
           +G +VKI   + I     +     IG  + +  G VI   V IG+N  + A   I+  S 
Sbjct: 115 IGNNVKIGKNIYIGANVCIDSNTRIGDNSIIHSGVVIYENVVIGKNNELHANCVIHQYSN 174

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           +G++ I++S   IG++GFG+        K+   G+VI+ D VEIG+ S +DR  + DT+I
Sbjct: 175 LGDNCIINSNAVIGSEGFGFIPTKRGWRKMPQTGKVILGDNVEIGSCSTVDRPAVGDTVI 234

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G  TKIDN VQ+GH V IG  C + SQVGIAG   IGD V++ GQ G+   +K+G NV  
Sbjct: 235 GSGTKIDNLVQVGHGVQIGNHCAMASQVGIAGGAKIGDGVILAGQVGVGNRVKVGSNVIA 294

Query: 304 ASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           +SK G+  DI   Q   G PA P   +LR      K
Sbjct: 295 SSKCGIHTDIEPEQVVSGFPAIPNKLWLRCAANFKK 330


>gi|145219521|ref|YP_001130230.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prosthecochloris vibrioformis DSM 265]
 gi|145205685|gb|ABP36728.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chlorobium phaeovibrioides DSM 265]
          Length = 351

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 168/310 (54%), Gaps = 9/310 (2%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI-VPFIPKNIPCLLSD 90
           G+  I + + I  A  G++S+I + K+L  +++ KAS +I  + + V    +    L   
Sbjct: 23  GKGEISAPAKIESAGAGEVSFIANEKYLRFLDETKASLVIVHRSVNVADFAEGRSFLKVA 82

Query: 91  KPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            P  +F     +   +   +  +    GI+P A +GE V + +GV +   AVV     IG
Sbjct: 83  DPYTAF-----VFVLKKFSLPRTIAAPGIAPTAVIGEGVVMGEGVTVGGYAVVGDRCRIG 137

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSD 209
             + +GP +VI   V IG  C+I      Y  + IG  V++H+G  IG DGFG+A     
Sbjct: 138 AGSIIGPHAVIMHDVEIGEGCTIFPHVVCYDGTRIGRRVVIHAGSVIGADGFGFAPQADG 197

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            + KI  +G V I D  EIGAN+ IDR T+  T+IG+  K+DN VQ+ HN  IG   +I 
Sbjct: 198 SYVKIPQMGIVEIGDDAEIGANATIDRATMGSTVIGKGVKVDNLVQVAHNCRIGEHTVIA 257

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD-IPAGQQYGGMPARPI 327
           +Q GI+GS  +G   +IGGQ G AG+L++ D   +A+++GV K  +  G    G PA+P+
Sbjct: 258 AQAGISGSVIMGRQCMIGGQAGFAGHLELADRTSVAAQAGVSKSFLEPGTALRGYPAQPM 317

Query: 328 GEYLRHMVML 337
            + LRH  ML
Sbjct: 318 RDQLRHEAML 327


>gi|289548350|ref|YP_003473338.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Thermocrinis albus DSM 14484]
 gi|289181967|gb|ADC89211.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase
           [Thermocrinis albus DSM 14484]
          Length = 326

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 113/333 (33%), Positives = 178/333 (53%), Gaps = 16/333 (4%)

Query: 18  LAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV 77
           +A+  G  L+     E  +  +S + +     + +  S K    ++  K   ++ S++  
Sbjct: 6   VARVTGGKLVGNPLKE--LLGVSSVDKPRERTVIFCHSSKEAEKVKGLKEVLLVLSEE-- 61

Query: 78  PFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVI 137
           P  P     +L +  +++ A      YP+   +       G+SPQA + E V + + V +
Sbjct: 62  P--PYATDYVLVEDTKLALARFLQHFYPEKHPV-------GVSPQAVVEEGVSLGEDVYV 112

Query: 138 APMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRI 196
            P   +  G  + R   V P S IG G  IG    I +G  IY  ++IG  V +HSG  I
Sbjct: 113 GPFVYIGRGSVLERGVKVYPFSYIGEGCYIGEESVIFSGVHIYPKTVIGKRVRIHSGAVI 172

Query: 197 GNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIG 256
           G DGFGY  G   I K+ HIG V+I+D VEIGAN+ +DR  +D+T IG +TKIDN V IG
Sbjct: 173 GADGFGYHIGKEGITKLHHIGSVVIEDDVEIGANTTVDRALLDETRIGRSTKIDNLVMIG 232

Query: 257 HNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAG 316
           HN  IG   +IV+QVGI+GS   G  V++ GQ G+A +++IG+NV + ++SGV   +  G
Sbjct: 233 HNCSIGEENVIVAQVGISGSVVTGKRVILAGQVGVADHVRIGNNVTVTAQSGVSSSLEDG 292

Query: 317 QQYG-GMPARPIGEYLRHMVMLSK-PSKYKIKR 347
           + YG  +PA    ++ R    ++K P  ++ ++
Sbjct: 293 KVYGAALPAIEWSKWKRLYAYITKLPELFRERK 325


>gi|312142801|ref|YP_003994247.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Halanaerobium sp. 'sapolanicus']
 gi|311903452|gb|ADQ13893.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Halanaerobium sp. 'sapolanicus']
          Length = 354

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 115/321 (35%), Positives = 163/321 (50%), Gaps = 12/321 (3%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ---DIVPFIPKNIPCLLS 89
           E +I S   I  +     ++  SR+FL+      AS II  +   D +         LLS
Sbjct: 29  ELLIDSARGINESKKFSATFADSREFLSKALNSAASLIITKKGLLDELELESFEKTFLLS 88

Query: 90  DKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           D P   FA    +L  +       S E  I+  A LG+++ I  GV+I+  A      EI
Sbjct: 89  DNPRRVFAQTAQLLTDRPYFTANISAEAVIADSAELGKNLSIHPGVIISENA------EI 142

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHSGVRIGNDGFGYARGVS 208
           G  T + PG +IG  V+IG +C    G  I   S I + VI+ SG  IG+DGFGYA    
Sbjct: 143 GDNTILAPGVIIGPDVKIGNDCLFHPGVIIERESEIADQVIIQSGAVIGSDGFGYASDKR 202

Query: 209 DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
             HKI   G V+I+ +VEIGAN+ IDRG    T+I +  K+DN V I HNV +G   ++V
Sbjct: 203 GHHKIPQQGNVVIESEVEIGANTTIDRGASGSTVIKKGAKLDNLVMIAHNVEVGEQSMLV 262

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIG 328
            QVGIAGST +   V +GGQ G+ G++ + +N   A+++ +      G    G PA    
Sbjct: 263 GQVGIAGSTTLEKRVTLGGQAGVVGHINLAENTTGAARAMITSKTNQGDFISGAPAHDHK 322

Query: 329 EYLRHMVMLSKPSKY--KIKR 347
           + L+    L +  KY  KIK+
Sbjct: 323 DALKEQAYLRRLPKYIKKIKQ 343


>gi|332299594|ref|YP_004441515.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Porphyromonas asaccharolytica DSM 20707]
 gi|332176657|gb|AEE12347.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Porphyromonas asaccharolytica DSM 20707]
          Length = 342

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 167/326 (51%), Gaps = 14/326 (4%)

Query: 18  LAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV 77
           +A+ IG +L  E  G   +   + I +A  GD+S++ + K+   +    ASA++  +   
Sbjct: 7   IAKLIGGTL--EGDGTAQLQGFAGIEQAKMGDLSFLANMKYEPYLYTTHASAVLVDERFA 64

Query: 78  PFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE---GGISPQAFLGEDVKIEDG 134
           P  P +   +    P  + +        Q M +  S  E    G+ P A +   V+I   
Sbjct: 65  PTQPCSTTLIRVANPYETLS--------QLMRLYVSQQEPHWTGVHPTAIIDPSVEIPKE 116

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSG 193
            +I P   +   V++G +  +    VIGA   IG + ++    ++YS S+IG+   +HSG
Sbjct: 117 CIIGPYVCIEADVKLGEQVVISAHCVIGANCSIGDHTTLHPRVTLYSDSIIGHHCRIHSG 176

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG DGFG+A       KI  IG V I D VEIGANS IDR T+  T I    KIDN V
Sbjct: 177 TVIGADGFGFAPTDHGYDKIPQIGHVEIGDHVEIGANSCIDRATMGVTRIASGVKIDNLV 236

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HN  +    +I +Q G+AGS +I +   +GGQ GIAG+L +GD+ ++  ++GVL D+
Sbjct: 237 QIAHNCTVDEHTVIAAQAGLAGSAHIKEWCQLGGQVGIAGHLTVGDHSRLGGQTGVLGDL 296

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSK 339
                  G PA P+G+ LR    L K
Sbjct: 297 QPHSIVMGTPAMPVGKALRAFATLPK 322


>gi|313887481|ref|ZP_07821170.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas asaccharolytica PR426713P-I]
 gi|312923123|gb|EFR33943.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas asaccharolytica PR426713P-I]
          Length = 342

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 167/326 (51%), Gaps = 14/326 (4%)

Query: 18  LAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIV 77
           +A+ IG +L  E  G   +   + I +A  GD+S++ + K+   +    ASA++  +   
Sbjct: 7   IAKLIGGTL--EGDGTAQLQGFAGIEQAKAGDLSFLANMKYEPYLYTTHASAVLVDERFA 64

Query: 78  PFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFE---GGISPQAFLGEDVKIEDG 134
           P  P +   +    P  + +        Q M +  S  E    G+ P A +   V+I   
Sbjct: 65  PTQPCSTTLIRVANPYETLS--------QLMRLYVSQQEPHWTGVHPTAIIDPSVEIPKE 116

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSG 193
            +I P   +   V++G +  +    VIGA   IG + ++    ++YS S+IG+   +HSG
Sbjct: 117 CIIGPYVCIEADVKLGEQVVISSHCVIGANCSIGDHTTLHPRVTLYSDSIIGHHCRIHSG 176

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG DGFG+A       KI  IG V I D VEIGANS IDR T+  T I    KIDN V
Sbjct: 177 TVIGADGFGFAPTDHGYDKIPQIGHVEIGDHVEIGANSCIDRATMGVTRIASGVKIDNLV 236

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HN  +    +I +Q G+AGS +I +   +GGQ GIAG+L +GD+ ++  ++GVL D+
Sbjct: 237 QIAHNCTVDEHTVIAAQAGLAGSAHIKEWCQLGGQVGIAGHLTVGDHSRLGGQTGVLGDL 296

Query: 314 PAGQQYGGMPARPIGEYLRHMVMLSK 339
                  G PA P+G+ LR    L K
Sbjct: 297 QPHSIVMGAPAMPVGKALRAFATLPK 322


>gi|78485620|ref|YP_391545.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thiomicrospira crunogena XCL-2]
 gi|119371985|sp|Q31G52|LPXD_THICR RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|78363906|gb|ABB41871.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Thiomicrospira crunogena XCL-2]
          Length = 347

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/298 (35%), Positives = 150/298 (50%), Gaps = 10/298 (3%)

Query: 39  LSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAI 98
           +S +  A    IS++   K ++ +E   A  ++              CLL + P  +FA 
Sbjct: 30  VSGLVEAQQNHISFLSDSKRIHELETTSAGVVLIHPKFESLTTTT--CLLVENPYFAFAK 87

Query: 99  AGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPG 158
              +L P+       +F  GI   A + +  KI +   I    V+   V IG   Y+GPG
Sbjct: 88  VSQLLNPE-------NFPAGIHASAVVDDSAKIAESAWIGENVVIGKRVTIGDNCYIGPG 140

Query: 159 SVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIG 217
           SV+     IG+   + A  ++ ++ +IG    L  G  IG  GFG+A    + HKI  IG
Sbjct: 141 SVVLDDSVIGQKTRLVANVTVMHNCIIGEEGYLDPGCVIGGQGFGFANEQGEWHKIPQIG 200

Query: 218 RVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGST 277
           RV+I D+V +G N+ I RG I+DT+I  N  ID+ V I HNV IG G  I SQVG AGST
Sbjct: 201 RVVIGDRVFVGVNANIHRGAINDTVIESNCIIDSLVHIAHNVSIGYGSAIASQVGFAGST 260

Query: 278 YIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMV 335
            +G   +  GQ GI G++ I D    A+KSGV   I     Y G PA P  E+ ++MV
Sbjct: 261 AVGKYCVFAGQAGINGHISIADKSYFAAKSGVTHTIKESGSYSGFPAIPTPEWQKNMV 318


>gi|34764258|ref|ZP_00145106.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|27885971|gb|EAA23299.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
          Length = 301

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 154/285 (54%), Gaps = 16/285 (5%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LSP   +    +++    KFL N+ + KA  II     +P I      ++ D P V 
Sbjct: 24  VSKLSPFFHSDEKSLTFAADEKFLKNLSQTKAKVIIVPDIDLPLIEGKGYIVVKDSPRV- 82

Query: 96  FAIAGSILYPQAMHMEASSF---EGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
                  + P+ +H  + +    E      A +GE+V I   V I    V+   V+I   
Sbjct: 83  -------IMPKLLHFFSRTLKKIEKMREDTAKIGENVDIAPNVYIGHDVVIGNNVKIFPN 135

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHK 212
             +G G++IG G  I  N SI     I     G + ++  G  IG+DGFG+ +   +  K
Sbjct: 136 VTIGEGAIIGDGTVIYSNVSIREFVEI-----GKNCVIQPGAVIGSDGFGFVKVNGNNTK 190

Query: 213 IVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVG 272
           I  IG VI++D+VEIGAN+ IDRG I DTII + TKIDN VQI HN  IG  C+I+SQVG
Sbjct: 191 IDQIGTVIVEDEVEIGANTTIDRGAIGDTIIKKYTKIDNLVQIAHNDIIGENCLIISQVG 250

Query: 273 IAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQ 317
           IAGST IG+NV + GQ G+AG+L+IGDN  I +   +  ++ A +
Sbjct: 251 IAGSTTIGNNVTLAGQVGVAGHLEIGDNTMIGAHLEIAGNVEANK 295


>gi|145300051|ref|YP_001142892.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142852823|gb|ABO91144.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 340

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 172/324 (53%), Gaps = 16/324 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
             L +LAQ +GA +  +  G   I  ++ + +A  GDI+++ ++K+ + +E+ KASA++ 
Sbjct: 4   FTLAQLAQQLGAEIHGD--GTLEIRKVATLEKAGEGDITFLSNKKYRHYLEQSKASAVLI 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           ++  +PF P N   L+   P V FA    +L   PQ            I P A +  DV+
Sbjct: 62  TEADLPFCPTN--ALVLKDPYVGFARVAQLLDTTPQPAT--------DIHPSAVIAADVQ 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVI 189
           + + V I   AV+  GV +G    +GPG  +G   R+G    + A  ++Y ++ +G+  +
Sbjct: 112 LGERVAIGANAVIESGVVLGDDVRIGPGCFVGKNTRLGARSRLWANVTLYHNITMGSDCL 171

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           + SG  IG DGFGYA    +  KI  +G V I ++VEIGA + IDRG ++DT I +N  I
Sbjct: 172 VQSGTVIGADGFGYANERGEWIKIPQLGGVTIGNRVEIGACTTIDRGALEDTRIADNVII 231

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DNQ QI HNV IG G  +     +AGS  +G   +IGG     G+++I D   +   + V
Sbjct: 232 DNQCQIAHNVEIGYGTAVAGSTVMAGSLKVGKYCIIGGASVFNGHMEICDQATVTGMAMV 291

Query: 310 LKDIPAGQQY-GGMPARPIGEYLR 332
           ++ I     Y  G+P +   E+ +
Sbjct: 292 MRPITEPGVYSSGIPLQTNKEWRK 315


>gi|242279988|ref|YP_002992117.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio salexigens DSM 2638]
 gi|242122882|gb|ACS80578.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Desulfovibrio salexigens DSM 2638]
          Length = 342

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 163/309 (52%), Gaps = 26/309 (8%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           ++ I  L+ +  A   ++S++ + K+ + +   KA AI+  +     +      L+S+ P
Sbjct: 18  DKEISGLNTLELAGPTELSFLANAKYESALAVTKAGAIVLEEKYADQVES---ALISENP 74

Query: 93  EVSFAIAGSILYPQAMHMEAS---SFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
            +  A        +AMH+ A      EG I   AF+  +  ++D   + P A +  G +I
Sbjct: 75  YMDLA--------KAMHVFARPQGCLEG-IHELAFIHHEADVDDSATVYPFAFIGKGAKI 125

Query: 150 GRK------TYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGY 203
           G         Y+G   V+G G  I  NCSI AG+     +IG   I+  G  IG DGFGY
Sbjct: 126 GPNCKVFAGAYIGEDVVLGPGCIIYPNCSIMAGT-----VIGTGCIVQPGAVIGGDGFGY 180

Query: 204 ARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGC 263
           A+      KI  IG V +QD+VEIGAN+ +DR  +D T IG  +KIDN VQI HNV  G 
Sbjct: 181 AQVSGKHMKIPQIGTVELQDQVEIGANACVDRAALDVTRIGAGSKIDNLVQIAHNVTTGE 240

Query: 264 GCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMP 323
            C+++SQ G+AGST +G  V++  Q G+   +KIGD   I +++GV  D+PAG    G P
Sbjct: 241 DCLVISQSGVAGSTKLGKGVVLAAQAGLVDNIKIGDGAVIGAQAGVTNDVPAGFMGAGSP 300

Query: 324 ARPIGEYLR 332
               G +LR
Sbjct: 301 LLEKGNFLR 309


>gi|237729485|ref|ZP_04559966.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Citrobacter sp. 30_2]
 gi|283835241|ref|ZP_06354982.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Citrobacter youngae ATCC 29220]
 gi|226909214|gb|EEH95132.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Citrobacter sp. 30_2]
 gi|291068952|gb|EFE07061.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Citrobacter youngae ATCC 29220]
          Length = 341

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 176/324 (54%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LA+ + A L  +  G+ +I  ++ +  A TG+I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAEQLDAELHGD--GDIVITGVASMQSAQTGNITFMVNPKYREHLGVCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAAIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V +   AV+  GVE+G         VIGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSVGANAVIESGVELGDNV------VIGAGCFVGKNTKIGAGSRLWANVTIYHDIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ S   +G+DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGENCLIQSSTVVGSDGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|113478181|ref|YP_724242.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Trichodesmium erythraeum IMS101]
 gi|119371987|sp|Q10VF5|LPXD_TRIEI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|110169229|gb|ABG53769.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Trichodesmium erythraeum IMS101]
          Length = 345

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 169/332 (50%), Gaps = 11/332 (3%)

Query: 19  AQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVP 78
           +++I  SL   N  +  I  ++ I  A  G +SYI   KF N ++   ASA+I   D   
Sbjct: 12  SETITCSLEKINHLDPDIQGVAAIDEAKPGTLSYIEGAKFANYLKTTNASALILPMDETL 71

Query: 79  FI---PKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGV 135
                 + I  L S +P + FA A ++ Y              + P A +G++V      
Sbjct: 72  QKLAGERGIGWLSSKEPRLLFAQAIALFYRPFQPTPEIHATSIVHPTAKVGKNV------ 125

Query: 136 VIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGV 194
            +    VV  GV+IG    + P  VI   V IG N  + A  SI+  S IG   ++HSG 
Sbjct: 126 YLGAHVVVEAGVKIGDNVCIYPNVVIYPNVEIGENTILNANCSIHERSQIGKGCVIHSGA 185

Query: 195 RIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQ 254
            IG +GFG+        K+   G+VI++D VE+G N+ IDR  + +T IG+NTK+DN VQ
Sbjct: 186 VIGGEGFGFVPTPEGWFKMEQSGKVILEDGVEVGGNTTIDRPAVGETRIGKNTKLDNLVQ 245

Query: 255 IGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314
           IGH   IG  C + +QVG+AG   +GDNV++ GQ G+A   KIGD     +++GV  D+ 
Sbjct: 246 IGHGCKIGKNCALAAQVGLAGGVKLGDNVILAGQVGVANQAKIGDRAIATAQAGVHNDVA 305

Query: 315 AGQQYGGMPARPIGEYLRHMVMLSK-PSKYKI 345
           AG+     PA P   YL+   +  + P  Y+ 
Sbjct: 306 AGEIVSSSPAVPNKIYLKASAIYKRLPEIYQF 337


>gi|215485340|ref|YP_002327771.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|215263412|emb|CAS07732.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
          Length = 341

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 174/324 (53%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           + D +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TLDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|86143286|ref|ZP_01061688.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leeuwenhoekiella blandensis MED217]
 gi|85830191|gb|EAQ48651.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Leeuwenhoekiella blandensis MED217]
          Length = 342

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 163/304 (53%), Gaps = 8/304 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LS I   + G ++++ + K+   I K KAS  I  +D  P    +I   L    +  
Sbjct: 24  VSKLSKIEEGTQGSLTFLANPKYTPYIYKTKASIAIVDKDFQP--EHDIEVTLIRVEDAY 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
            + +  + Y   + +  S    GI   +F+ +  +  + + +   A +   V+IG    +
Sbjct: 82  KSFSKLLEYYNQVKLNKS----GIEQPSFISDTAEYGEDLYLGAFAYIGNNVKIGNNVKI 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVS-DIHKI 213
            P   IG   +IG NC +  G+ +YS  ++G +V +HSG  IG DGFG+A   + +  +I
Sbjct: 138 YPNVYIGDNCKIGDNCVLFQGAKVYSDCVLGETVYVHSGAIIGADGFGFAPDENGEYSRI 197

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
              G VII+D V+IGA + IDR T+  TII +  K+DNQ+QI HNV IG    I +Q GI
Sbjct: 198 PQTGNVIIEDNVDIGAGTTIDRATLGSTIIRKGVKLDNQIQIAHNVEIGEHTAIAAQTGI 257

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           AGST IG N +IGGQ GI G++ IGD V+I ++SG+ +++   +   G PA    ++ + 
Sbjct: 258 AGSTKIGKNCMIGGQVGIVGHITIGDRVRIQAQSGITRNLKNDEAVQGSPALSYNDFNKS 317

Query: 334 MVML 337
            V  
Sbjct: 318 YVHF 321


>gi|332830292|gb|EGK02920.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Dysgonomonas gadei ATCC BAA-286]
          Length = 348

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 165/312 (52%), Gaps = 8/312 (2%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           ++ + S I     G ++++ + K+ + I    AS ++ + D +   P     +       
Sbjct: 25  VVNNFSRIEDGKPGTLTFLANPKYTHYIYSTDASIVLVNNDFIADQPVKATLIRCFNAYA 84

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           + AI         M  +    + GI   +++  +VK  + + +   A +   V IG  T 
Sbjct: 85  ALAILLD------MVEKTKPQKSGIEAMSYIATNVKYGENIYVGAFAYIAENVLIGNNTK 138

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           + P   IG  V IG N  I  G+ +Y    IGN+ I+H+G  IG+DGFG+A       KI
Sbjct: 139 IYPQVYIGENVTIGDNTIIYPGAKVYQGCTIGNNCIIHAGAVIGSDGFGFAPEDGIYKKI 198

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             +G VII+D VEIGAN+ IDR  +D T++    K+DN +QI HNV IG   ++ +QVG+
Sbjct: 199 PQMGIVIIEDDVEIGANTTIDRAVMDATVVHRGVKLDNLIQIAHNVEIGENTVMAAQVGV 258

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRH 333
           +GST IG + + GGQ G+ G++ IGDN  + ++SG++ +I +  +  G PA P+  + + 
Sbjct: 259 SGSTKIGKHCVFGGQVGLGGHITIGDNSSVGAQSGIISNIESDSKILGSPAIPVKNFFKS 318

Query: 334 MVMLSK-PSKYK 344
            V+  K P  Y+
Sbjct: 319 SVVFPKLPDMYR 330


>gi|160872059|ref|ZP_02062191.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsiella grylli]
 gi|159120858|gb|EDP46196.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Rickettsiella grylli]
          Length = 342

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 165/307 (53%), Gaps = 10/307 (3%)

Query: 35  MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEV 94
           +I  +  + +A  G+IS++ ++++L  +   +ASA+I  ++ +   P N   L+   P +
Sbjct: 25  LITGIMALQKAQAGEISFLDNKRYLKYLSTTQASAVILREECLKHAPNN--ALVVTDPYL 82

Query: 95  SFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTY 154
           +FA     L+ + + +        I   A LGE   I   V I P +V+ P   +     
Sbjct: 83  AFAKVAQ-LFERTLPVIPE-----IHTTALLGEGCHIHSSVSIGPYSVIGPNTRLEEGVV 136

Query: 155 VGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIHKI 213
           +GP  VIG  V IG    + +  SI + + IG  VI+H+G  IG+DGFG A+  +   KI
Sbjct: 137 IGPACVIGENVVIGAKTCLKSHVSICADTHIGPRVIIHNGSVIGSDGFGLAKENNKWIKI 196

Query: 214 VHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGI 273
             +G+V+I   VEIGAN +IDRG +DDTII    K+DNQ+QIGHNV IG    I    GI
Sbjct: 197 PQLGKVLIGHDVEIGANVSIDRGALDDTIISNGVKLDNQIQIGHNVRIGENTAIAGCTGI 256

Query: 274 AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPA-RPIGEYLR 332
           AGST+IG N  IGG   I G+++I DNV I   S V+  I     Y    + +P  E+ R
Sbjct: 257 AGSTHIGKNCRIGGGVCINGHIEIADNVCITGMSSVVHSIRYPGIYSSTHSIQPRREWQR 316

Query: 333 HMVMLSK 339
           + V   +
Sbjct: 317 NSVRFRQ 323


>gi|206576669|ref|YP_002240333.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella pneumoniae 342]
 gi|288937039|ref|YP_003441098.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Klebsiella variicola At-22]
 gi|290512460|ref|ZP_06551826.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella sp. 1_1_55]
 gi|206565727|gb|ACI07503.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella pneumoniae 342]
 gi|288891748|gb|ADC60066.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Klebsiella variicola At-22]
 gi|289774801|gb|EFD82803.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella sp. 1_1_55]
          Length = 341

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/335 (34%), Positives = 178/335 (53%), Gaps = 28/335 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAKTGQITFMVNPKYREHLAACQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF   +   L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPF--AHSAALVVRNPYLTYARMAQILDTTPQPAQ--------DIAPSAVIDPSAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GV +G         VIGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVAIGANAVIESGVVLGDNV------VIGAGCFVGKNTKIGAGSRLWANVTIYHEIE 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ S   IG DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTLI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARPIGEYLRHMVML 337
                V++ I     Y  G+P +P   + +   ++
Sbjct: 286 TGMGMVMRPISEPGVYSSGIPLQPNKAWRKTAALV 320


>gi|149907543|ref|ZP_01896290.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Moritella sp. PE36]
 gi|149809213|gb|EDM69142.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Moritella sp. PE36]
          Length = 336

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 115/329 (34%), Positives = 167/329 (50%), Gaps = 12/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++A +I A L  +  G   I  ++ +  A  G I+++   K+   +    ASA+I 
Sbjct: 3   MTLQQIATAIQAELHGD--GSIEISGINSMQNAQPGSITFLSDSKYSAQLATVAASAVIV 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D       N   L+   P V FA+   +L          +    I+P A + +DV + 
Sbjct: 61  KPD--DLAACNTNALVMKNPYVGFALVAQLLDT------TPAPATDIAPSAVIADDVVLG 112

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           D V I   AV+  GV +     +G G  IG   RIG++  + A  +IY  + IG+  +  
Sbjct: 113 DNVAIGANAVIETGVTLADNVIIGAGCFIGKNSRIGQSTKLWANVTIYHDIEIGSDCLFQ 172

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG DGFGYA       KI  +GRVII D+VEIGA + IDRG +D+TII +   +DN
Sbjct: 173 SGTVIGADGFGYANDGGRWIKIPQLGRVIIGDRVEIGACTTIDRGALDNTIIADGVILDN 232

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q Q+GHNV IG    I     +AGS  +G   +IGG C I G+++I DNV I   S V++
Sbjct: 233 QCQVGHNVEIGENTAISGGTLLAGSLKLGKQCMIGGGCVINGHMEITDNVNITGMSMVMR 292

Query: 312 DI-PAGQQYGGMPARPIGEYLRHMVMLSK 339
            I  AG    G+PA+   E+ R    + K
Sbjct: 293 PIDKAGLYSSGIPAQANREWRRQTARVMK 321


>gi|332294917|ref|YP_004436840.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thermodesulfobium narugense DSM 14796]
 gi|332178020|gb|AEE13709.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Thermodesulfobium narugense DSM 14796]
          Length = 346

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 171/332 (51%), Gaps = 25/332 (7%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L ++A+ +G  L  E+     +  + P+  A   D+S+++ +         KA A +C +
Sbjct: 6   LSEIAREVGGVLRGEDL---EVTDVKPLNIACEKDLSFVLDKANFEASRFSKAGAFLCYR 62

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMH------MEASSFEGGISPQAFLGED 128
                   N P +  D P+++ +   +I YP++            S    IS +A++G  
Sbjct: 63  GF----ESNRPTIEVDSPKLALSKVLNIFYPRSFRDPLIHRTSVISERAKISDKAYVGPY 118

Query: 129 VKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSV 188
             +EDG VI     +   V +G+ TY+G G+ I     I   C +G            + 
Sbjct: 119 CVVEDGAVIEDRVELVAFVYVGKNTYIGKGTRIFPFACIREMCRVG-----------ENC 167

Query: 189 ILHSGVRIGNDGFGYARGVSDIHKIV-HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENT 247
           ++ +G  IGNDGFGYA      H  +  IG V I ++V+IG+N+ IDRG+  DT+I +N 
Sbjct: 168 VIQAGATIGNDGFGYATDSCGHHTWIPQIGGVSIGNEVDIGSNTTIDRGSFVDTVIKDNV 227

Query: 248 KIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKS 307
           K+DN VQI HN  +    I+VS VG++GS ++ +N ++ G+ G+  +L IG    + +KS
Sbjct: 228 KVDNLVQIAHNCILEKSVILVSMVGLSGSVHVKENAVLAGKVGVKDHLTIGKGATVLAKS 287

Query: 308 GVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           G++KD+P G    G PARP  ++ +  +++ +
Sbjct: 288 GLMKDVPDGSTVMGYPARPYIDFFKERILIER 319


>gi|290968726|ref|ZP_06560264.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Megasphaera genomosp. type_1 str. 28L]
 gi|290781379|gb|EFD93969.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Megasphaera genomosp. type_1 str. 28L]
          Length = 339

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 112/341 (32%), Positives = 178/341 (52%), Gaps = 19/341 (5%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            + +LA  +G  ++ +  G R I  +  +A A   DI++ ++  +   + +  A A++ +
Sbjct: 5   TIQELATFLGGHVIGD--GNRYITDVKSLAEAKKTDITFAVA-PYTEYVPQVDAGAVMVT 61

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
            +I     KN   L+ + P ++F+   ++ +P+       + E GI P A + +   I  
Sbjct: 62  AEIPA--GKNT-LLVVENPRLAFSRLLTLFHPR------QTVEPGIHPTAVIDKSADIGA 112

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHS 192
              I P AV+   V+IG    + P   IG   +IG   ++  G+ I+ + +IGN  ++ +
Sbjct: 113 YTAIMPYAVIGKNVKIGAHCTIYPYVFIGDQAQIGEGTTVYPGAVIHENCVIGNHNVIRA 172

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
              IG +GFG+A       +I  IG V I D VE+GA + ID GT+  T +G  TKIDN 
Sbjct: 173 HAVIGGEGFGFATEQGKHIRIPQIGNVTIGDDVEVGACTCIDNGTMGATAVGRGTKIDNL 232

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
           V +GHNV IG  C +++Q GIAGST  G++V   GQ G  G++ IGDN   A K+G+  +
Sbjct: 233 VHLGHNVEIGDDCFLIAQTGIAGSTKAGNHVTFAGQTGCTGHITIGDNTVFAGKTGITGN 292

Query: 313 IPAGQQYGGMPARPIGEY------LRHMVMLSKPSKYKIKR 347
           I  G  Y G PARP  E+      L+H+  L K  K   +R
Sbjct: 293 IKGGGVYAGFPARPHMEWSRTQAHLKHLPELVKRVKELEER 333


>gi|328676276|gb|AEB27146.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella cf. novicida Fx1]
          Length = 347

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 177/340 (52%), Gaps = 29/340 (8%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++++ + A +++E  GE +I  L+   +A   D++ I  ++ +   +  KA+A I S
Sbjct: 4   TLKQISEHLNAKVINEPSGEVIISGLNYAEQAKENDLTLIDKQEHIKLWQNSKAAATIVS 63

Query: 74  QDIVPFIPKNIPCLLSDKP-----EVSFAIAG-----SILYPQAMHMEASSFEGGISPQA 123
           + I   + +     ++DKP         A+A      S+ YP+         + GI  +A
Sbjct: 64  KKISKELAQ-----VNDKPLIVVNNADLAMAKILELFSVPYPE---------QNGIHEKA 109

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-S 182
            +    KI   V I P A +   VEIG  T +     I    ++G NC I    +I   +
Sbjct: 110 VIDPTAKIGKNVSIGPGAYIGKNVEIGDNTIIYANVCIYDDAKVGTNCIIWPSVTIRDRT 169

Query: 183 LIGNSVILHSGVRIGNDGFGYARGVSD---IHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
           +IG+   L+S   IG+DGFGY R   D   I +I HIG V+I   V+IG+N+ ID     
Sbjct: 170 IIGHFCRLYSNCSIGSDGFGY-RPSEDGRTIVRIPHIGNVVIGSFVDIGSNTCIDNAKYG 228

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            TIIG+ TKIDN VQIGHNV IG GC+I  Q GI+GS  IGD V+I G  GI  +  IG 
Sbjct: 229 STIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNIGS 288

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             +I  K+GV+ D+PAG+ + G PA    E  +  + + K
Sbjct: 289 GARIGGKAGVMWDVPAGESHMGYPAYKDSELAKQWIAIRK 328


>gi|118496814|ref|YP_897864.1| UDP-3-O-[3-fatty acid] glucosamine N-acyltransferase [Francisella
           tularensis subsp. novicida U112]
 gi|194324505|ref|ZP_03058277.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella tularensis subsp. novicida FTE]
 gi|208780571|ref|ZP_03247910.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella novicida FTG]
 gi|254372178|ref|ZP_04987670.1| UDP-3-[O-3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. novicida GA99-3549]
 gi|118422720|gb|ABK89110.1| UDP-3-O-[3-fatty acid] glucosamine N-acyltransferase [Francisella
           novicida U112]
 gi|151569908|gb|EDN35562.1| UDP-3-[O-3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella novicida GA99-3549]
 gi|194321340|gb|EDX18826.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella tularensis subsp. novicida FTE]
 gi|208743546|gb|EDZ89851.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella novicida FTG]
          Length = 347

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/340 (35%), Positives = 177/340 (52%), Gaps = 29/340 (8%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++++ + A +++E  GE +I  L+   +A   D++ I  ++ +   +  KA+A I S
Sbjct: 4   TLKQISEHLNAKVINEPSGEVIISGLNYAEQAKENDLTLIDKQEHIKLWQNSKAAAAIVS 63

Query: 74  QDIVPFIPKNIPCLLSDKP-----EVSFAIAG-----SILYPQAMHMEASSFEGGISPQA 123
           + I   + +     ++DKP         A+A      S+ YP+         + GI  +A
Sbjct: 64  KKISKELAQ-----VNDKPLIVVNNADLAMAKILELFSVPYPE---------QNGIHEKA 109

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-S 182
            +    KI   V I P A +   VEIG  T +     I    ++G NC I    +I   +
Sbjct: 110 VIDPTAKIGKNVSIGPGAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVTIRDRT 169

Query: 183 LIGNSVILHSGVRIGNDGFGYARGVSD---IHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
           +IG+   L+S   IG+DGFGY R   D   I +I HIG V+I   V+IG+N+ ID     
Sbjct: 170 IIGHFCRLYSNCSIGSDGFGY-RPSEDGRTIVRIPHIGNVVIGSFVDIGSNTCIDNAKYG 228

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            TIIG+ TKIDN VQIGHNV IG GC+I  Q GI+GS  IGD V+I G  GI  +  IG 
Sbjct: 229 STIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNIGS 288

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             +I  K+GV+ D+PAG+ + G PA    E  +  + + K
Sbjct: 289 GARIGGKAGVMWDVPAGESHMGYPAYKDSELAKQWIAIRK 328


>gi|271499505|ref|YP_003332530.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Dickeya
           dadantii Ech586]
 gi|270343060|gb|ACZ75825.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [Dickeya
           dadantii Ech586]
          Length = 341

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 11/316 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I +++ +  A  G I+++   ++   +   +ASA++ 
Sbjct: 4   IRLDALAQQLDAQLHGD--GDIVITAVASMHSAQAGQITFLSDSRYREQLSSTQASAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +Q  +PF   N   L+   P +++A        Q M    +  +G I+P A +  D ++ 
Sbjct: 62  TQADLPFC-NNAAALVVKNPYLAYA-----RMAQLMDTTPAPAQG-IAPSAVIAPDARLG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILH 191
           DGV I   AV+  GVE+G    +G G  +G   RIG    + A  +IY +++ G   ++ 
Sbjct: 115 DGVSIGANAVIESGVELGDGVVIGAGCFVGKHARIGAGTRLWANVAIYHNVVLGEQCLIQ 174

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA    +  KI  +G VII D+VEIGA++ IDRG +DDTIIG    IDN
Sbjct: 175 SGAVIGSDGFGYANDRGNWIKIPQLGTVIIGDRVEIGASTTIDRGALDDTIIGNGVIIDN 234

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +     V++
Sbjct: 235 QCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMR 294

Query: 312 DIPAGQQY-GGMPARP 326
            I     Y  G+P +P
Sbjct: 295 PITEPGVYSSGIPLQP 310


>gi|254373659|ref|ZP_04989143.1| UDP-3-[O-3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella novicida GA99-3548]
 gi|151571381|gb|EDN37035.1| UDP-3-[O-3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella novicida GA99-3548]
          Length = 347

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 176/340 (51%), Gaps = 29/340 (8%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++++ + A +++E  GE +I  L+   +A   D++ I  ++ +   +  KA+A I S
Sbjct: 4   TLKQISEHLNAKVINEPSGEVIISGLNYAEQAKENDLTLIDKQEHIKLWQNSKAAAAIVS 63

Query: 74  QDIVPFIPKNIPCLLSDKP-----EVSFAIAG-----SILYPQAMHMEASSFEGGISPQA 123
           + I      N    ++DKP         A+A      S+ YP+         + GI  +A
Sbjct: 64  KKI-----SNELAQVNDKPLIVVNNADLAMAKILELFSVPYPE---------QNGIHEKA 109

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-S 182
            +    KI   V I P A +   VEIG  T +     I    ++G NC I    +I   +
Sbjct: 110 VIDPTAKIGKNVSIGPGAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVTIRDRT 169

Query: 183 LIGNSVILHSGVRIGNDGFGYARGVSD---IHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
           +IG+   L+S   IG+DGFGY R   D   I +I HIG V+I   V+IG+N+ ID     
Sbjct: 170 IIGHFCRLYSNCSIGSDGFGY-RPSEDGRTIVRIPHIGNVVIGSFVDIGSNTCIDNAKYG 228

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            TIIG+ TKIDN VQIGHNV IG GC+I  Q GI+GS  IGD V+I G  GI  +  IG 
Sbjct: 229 STIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNIGS 288

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
             +I  K+GV+ D+PAG+ + G PA    E  +  + + K
Sbjct: 289 GARIGGKAGVMWDVPAGESHMGYPAYKDSELAKQWIAIRK 328


>gi|71278708|ref|YP_268305.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Colwellia psychrerythraea 34H]
 gi|119371928|sp|Q485G0|LPXD_COLP3 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|71144448|gb|AAZ24921.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Colwellia psychrerythraea 34H]
          Length = 349

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 163/311 (52%), Gaps = 12/311 (3%)

Query: 24  ASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKN 83
           A+L ++N     I  L+ +A+A TG ++++ + K+   +    ASA+I S D V      
Sbjct: 20  AALDEQNEALTQISGLATLAKAGTGQVAFLANSKYQQQLSSTNASAVIVSPDAVEAC--Q 77

Query: 84  IPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVV 143
           +  L+ D P + +A+  S+L              GI P A + +DV I + V +    V+
Sbjct: 78  VSALVMDNPYMGYAMLASLLD------STPKVSCGIHPNAVIADDVLIGENVSVGANTVI 131

Query: 144 YPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFG 202
             GV++     +G G  IG G +IG +  + A  +IY  + IG+  ++ +   IG+DGFG
Sbjct: 132 ESGVQLADNVSIGAGCFIGHGAKIGESTILWANITIYHRVEIGHHCLIQASTVIGSDGFG 191

Query: 203 YA--RGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVH 260
           YA  +G    HKI  +G VII D VEIGA++ IDRG +D+T I +   +DNQ+QI HNV 
Sbjct: 192 YAPVKGQYKWHKIPQLGSVIIGDHVEIGASTTIDRGALDNTEIRDGVILDNQIQIAHNVI 251

Query: 261 IGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP-AGQQY 319
           +G    I     IAGST IG N  I G  G+ G++ I DN      S V K+I  AG   
Sbjct: 252 VGENTAIAGCTVIAGSTVIGKNCTIAGLVGVNGHITIADNCVFTGMSMVTKNISQAGVYS 311

Query: 320 GGMPARPIGEY 330
            GMP     E+
Sbjct: 312 SGMPVVQNKEW 322


>gi|307129830|ref|YP_003881846.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [Dickeya
           dadantii 3937]
 gi|306527359|gb|ADM97289.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase [Dickeya
           dadantii 3937]
          Length = 340

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 112/322 (34%), Positives = 176/322 (54%), Gaps = 24/322 (7%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I +++ +  A  G I+++   ++   +   +ASA++ 
Sbjct: 4   IRLDALAQQLDAQLHGD--GDIVITAVASMHSAQAGQITFLSDSRYREQLNSTQASAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           ++  +PF   +   L+   P +++A        Q M    +  +G ISP A +  D ++ 
Sbjct: 62  TEADLPFC--DTAALVVKNPYLAYA-----RMAQLMDTTPAPAQG-ISPSAVIAPDARLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
           DGV +   AV+  GVE+G       G+++GAG  IG+N  IGAG+ +++++       +G
Sbjct: 114 DGVSVGANAVIESGVELGN------GAIVGAGCFIGKNARIGAGTRLWANVTIYHNVVLG 167

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGE 245
              ++ SG  IG+DGFGYA    +  KI  +G VII D+VEIGA++ IDRG +DDTIIG 
Sbjct: 168 EQCLIQSGAVIGSDGFGYANDRGNWIKIPQLGTVIIGDRVEIGASTTIDRGALDDTIIGN 227

Query: 246 NTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIAS 305
              IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +  
Sbjct: 228 GVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTG 287

Query: 306 KSGVLKDIPAGQQY-GGMPARP 326
              V++ I     Y  G+P +P
Sbjct: 288 MGMVMRPITEPGVYSSGIPLQP 309


>gi|330445155|ref|ZP_08308807.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489346|dbj|GAA03304.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 342

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 167/322 (51%), Gaps = 12/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L KLA+ +GA L  +  G   I+S++ + +A+ G I+++   K+   +  CKA A++ 
Sbjct: 4   ITLAKLAEKLGAELRGD--GSVEIHSIAGMGKAAEGQITFLSDSKYRKQLADCKADAVML 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
            +  V F   N   L+   P +S+A+   +L          +    + P A LG      
Sbjct: 62  READVEFFQGN--ALVVKDPYLSYALVAQLLDTTPAAATDIAASAFVDPTAQLG------ 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           D V I   AV+  GV +G    VG G  IG    IG N  + A  +IY ++ +G+  ++ 
Sbjct: 114 DNVAIGHNAVIEAGVTLGNNVQVGAGCFIGKNAVIGDNTKLWANVTIYHNVELGSDCLVQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG DGFGYA    +  KI  +G V I ++VEIG+ + IDRG +DDTII +N  IDN
Sbjct: 174 SSTVIGADGFGYANDKGEWVKIPQLGTVRIGNRVEIGSCTTIDRGALDDTIIEDNVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNV IG G  +     +AGST IG   +IGG   + G+++I D V I     V++
Sbjct: 234 QMQIAHNVQIGYGTAMAGGTIVAGSTKIGKYCIIGGASVLNGHIEIADGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            I     Y  G+P +   E+ +
Sbjct: 294 SIEEKGMYSSGIPLQTNREWRK 315


>gi|149192150|ref|ZP_01870371.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           shilonii AK1]
 gi|148834020|gb|EDL51036.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           shilonii AK1]
          Length = 343

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 171/322 (53%), Gaps = 11/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA+  G  +        +I +++P+  A  G I+++ + K+  ++ +C+ASAI+ 
Sbjct: 4   LTLAQLAEITGGEIHGNE--STLISAVAPMNSAGEGQITFLTNVKYAKHLGECQASAIMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
               +     N   L+   P V++A        QA+    +    GI+P A +  +  + 
Sbjct: 62  KASELEHCKTN--ALVVADPYVAYA-----KVAQALDTTPAPAASGIAPSAVVSSEACLG 114

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILH 191
           + V +   AV+  G E+G    VG G  IG G ++GRN  + A  SIY  ++ G+  ++ 
Sbjct: 115 ENVSVGANAVIEAGAELGDNVIVGAGCFIGKGAKLGRNTKLWANVSIYHDVVLGDDCLVQ 174

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   IG+DGFGYA    +  KI  +G V I ++VEIGA + IDRG +DDTII +N  IDN
Sbjct: 175 SSTVIGSDGFGYANEKGEWVKIPQVGTVRIGNRVEIGACTTIDRGALDDTIIEDNVIIDN 234

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNVHIG G  +     +AGST IG    IGG   + G+++I D V +     V++
Sbjct: 235 QMQIAHNVHIGYGTAMAGGTIVAGSTKIGKYCQIGGASVLNGHIEIADGVIVTGMGMVMR 294

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            +P    Y  G+P +   E+ +
Sbjct: 295 SLPEKGIYSSGIPLQTNKEWRK 316


>gi|188995883|ref|YP_001930135.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas gingivalis ATCC 33277]
 gi|226740736|sp|B2RME3|LPXD_PORG3 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|188595563|dbj|BAG34538.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas gingivalis ATCC 33277]
          Length = 349

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 163/305 (53%), Gaps = 7/305 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           ++  + I    +G +S++ + K+ + + + ++ A++ +QD  P   +++   L   P   
Sbjct: 24  LHDFAKIEEGRSGCLSFLANAKYEHYLYQTQSDAVLVNQDFEP--RESVKTTLIRVPNAY 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
            A+A  +    +M  +      G+   AF+   V + D   +   A V  G  +G    +
Sbjct: 82  AALAQLMQLVDSMKPQRK----GVDSTAFVHPSVILPDDCYVGAFAYVSEGASLGTGCSL 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   +G+GV +G    +    ++Y    IG+  ++HSG  IG DGFG+A       KI 
Sbjct: 138 YPHVYVGSGVSVGEGTILYPHVTVYDGCSIGSRCVIHSGAVIGADGFGFAPNAEGYSKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            +G VII+D VEIGAN+ IDR  +D TII    K+DN VQI HN  +G   +  +QVG+A
Sbjct: 198 QLGNVIIEDDVEIGANTCIDRAVMDSTIIHRGVKLDNLVQIAHNCSVGSHTVFAAQVGMA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS+++G+    GGQ G++G++K+GD V +  ++G+L ++ +G    G P  P+ + LR  
Sbjct: 258 GSSHVGEWCQFGGQVGLSGHIKVGDRVSLGGQTGLLSNVKSGSTLLGSPGMPLRDMLRAS 317

Query: 335 VMLSK 339
           V+  K
Sbjct: 318 VIFPK 322


>gi|34539943|ref|NP_904422.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas gingivalis W83]
 gi|60390063|sp|Q7MXT7|LPXD_PORGI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|34396254|gb|AAQ65321.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Porphyromonas gingivalis W83]
          Length = 349

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 163/305 (53%), Gaps = 7/305 (2%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           ++  + I    +G +S++ + K+ + + + ++ A++ +QD  P   +++   L   P   
Sbjct: 24  LHDFAKIEEGRSGCLSFLANAKYEHYLYQTQSDAVLVNQDFEP--RESVKTTLIRVPNAY 81

Query: 96  FAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYV 155
            A+A  +    +M  +      G+   AF+   V + D   +   A V  G  +G    +
Sbjct: 82  TALAQLMQLVDSMKPQRK----GVDSTAFVHPSVILPDDCYVGAFAYVSEGASLGTGCSL 137

Query: 156 GPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGFGYARGVSDIHKIV 214
            P   +G+GV +G    +    ++Y    IG+  ++HSG  IG DGFG+A       KI 
Sbjct: 138 YPHVYVGSGVSVGEGTILYPHVTVYDGCSIGSRCVIHSGAVIGADGFGFAPNAEGYSKIP 197

Query: 215 HIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIA 274
            +G VII+D VEIGAN+ IDR  +D TII    K+DN VQI HN  +G   +  +QVG+A
Sbjct: 198 QLGNVIIEDDVEIGANTCIDRAVMDSTIIHRGVKLDNLVQIAHNCSVGSHTVFAAQVGMA 257

Query: 275 GSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHM 334
           GS+++G+    GGQ G++G++K+GD V +  ++G+L ++ +G    G P  P+ + LR  
Sbjct: 258 GSSHVGEWCQFGGQVGLSGHIKVGDRVSLGGQTGLLSNVKSGSTLLGSPGMPLRDMLRAS 317

Query: 335 VMLSK 339
           V+  K
Sbjct: 318 VIFPK 322


>gi|303258065|ref|ZP_07344073.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Burkholderiales bacterium 1_1_47]
 gi|302859084|gb|EFL82167.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Burkholderiales bacterium 1_1_47]
          Length = 362

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 170/322 (52%), Gaps = 14/322 (4%)

Query: 25  SLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFI---- 80
           S +  N G+  I S++P+  A  GD++++ + K+ +    CKA+A++ +++    I    
Sbjct: 27  STISANGGKAEIKSIAPLETAGHGDVAFLANSKYRDAAGACKATALVLTEEDKQAIWGEK 86

Query: 81  -PKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAP 139
            P+ I  +++  P   FA A  I++PQ         E G+  +A + +   I+    +  
Sbjct: 87  EPERI-VVITRNPYAWFAYALQIIFPQEQP------EPGVDTRAVVEDGAVIDSTATVEA 139

Query: 140 MAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGN 198
             V+  G ++G   +VG  SVIG GV +G +  I    +IY    IG   I+HSG  IG 
Sbjct: 140 GVVIRKGAQVGPYCFVGANSVIGEGVVLGEHTRIYPNVTIYYGCRIGRRNIIHSGAVIGA 199

Query: 199 DGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHN 258
           DGFG+A       KI  IG V   D VEIGAN+ IDRG + +T IG+ TKID+ V IGHN
Sbjct: 200 DGFGFAPLDRQYVKIPQIGAVETGDDVEIGANTCIDRGALQNTTIGQGTKIDDLVMIGHN 259

Query: 259 VHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQ 318
             +G   ++  + G+AGST IGDNV  GG  G AG+LK+     I   +GV   I     
Sbjct: 260 CQVGKNVVLSGRTGLAGSTIIGDNVQAGGGSGFAGHLKVAAGSIIGGGAGVPSSIEKPDY 319

Query: 319 YGG-MPARPIGEYLRHMVMLSK 339
           Y G MPA P  E+   + ++ +
Sbjct: 320 YAGYMPAMPHREFYNILSVIKR 341


>gi|152968773|ref|YP_001333882.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238893175|ref|YP_002917909.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella pneumoniae NTUH-K2044]
 gi|262044750|ref|ZP_06017797.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|330001658|ref|ZP_08304084.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella sp. MS 92-3]
 gi|150953622|gb|ABR75652.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine n-acyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|238545491|dbj|BAH61842.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine n-acyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037900|gb|EEW39124.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|328537600|gb|EGF63820.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Klebsiella sp. MS 92-3]
          Length = 341

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 116/335 (34%), Positives = 177/335 (52%), Gaps = 28/335 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAKTGQITFMVNPKYREHLAACQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF   +   L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TQDDLPF--AHSAALVVRNPYLTYARMAQILDTTPQPAQ--------DIAPSAVIDPSAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           +   V I   AV+  GV +G         VIGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGSNVAIGANAVIESGVVLGDNV------VIGAGCFVGKNTKIGAGSRLWANVTVYHEIE 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ S   IG DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGENCLIQSSTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARPIGEYLRHMVML 337
                V++ I     Y  G+P +P   + +   ++
Sbjct: 286 TGMGMVMRPISEPGVYSSGIPLQPNKAWRKTAALV 320


>gi|117621249|ref|YP_855724.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|166232075|sp|A0KHH3|LPXD_AERHH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|117562656|gb|ABK39604.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 339

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 106/324 (32%), Positives = 171/324 (52%), Gaps = 16/324 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
             L +LAQ +GA +  +  G   I  ++ + +A  GDI+++ ++K+ + +E+ KA+A++ 
Sbjct: 3   FTLAQLAQQLGAQVHGD--GTLEIRKVATLEKAGEGDITFLSNKKYRHYLEQSKATAVLI 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           ++  +PF P N   L+   P V FA    +L   PQ            I P A +  DV+
Sbjct: 61  TEADLPFCPTN--ALVLKDPYVGFARVAQLLDTTPQPAT--------DIHPSAVIAADVQ 110

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVI 189
           + + V I   AV+  GV +G    +GPG  +G   R+G    + A  ++Y ++ +G   +
Sbjct: 111 LGERVAIGANAVIESGVVLGDDVRIGPGCFVGKNTRLGARSRLWANVTLYHNITMGTDCL 170

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           + SG  IG DGFGYA    +  KI  +G V I ++VEIGA + IDRG ++DT I +N  I
Sbjct: 171 VQSGTVIGADGFGYANERGEWIKIPQLGGVTIGNRVEIGACTTIDRGALEDTRIADNVII 230

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DNQ QI HNV IG G  +     +AGS  +G   +IGG     G+++I D   +   + V
Sbjct: 231 DNQCQIAHNVEIGYGTAVAGSTVMAGSLKVGKYCIIGGASVFNGHMEICDQATVTGMAMV 290

Query: 310 LKDIPAGQQY-GGMPARPIGEYLR 332
           ++ I     Y  G+P +   E+ +
Sbjct: 291 MRPITEPGVYSSGIPLQTNKEWRK 314


>gi|187932179|ref|YP_001892164.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. mediasiatica FSC147]
 gi|187713088|gb|ACD31385.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 347

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 118/340 (34%), Positives = 178/340 (52%), Gaps = 29/340 (8%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++++ + A +++E  GE +I  L+   +A   D++ I  ++ +   +  KA+A I S
Sbjct: 4   TLKQISEHLNAKVINEPSGEVIITGLNYAEQAKENDLTLIDKQEHIKLWQNSKATAAIVS 63

Query: 74  QDIVPFIPKNIPCLLSDKP-----EVSFAIAG-----SILYPQAMHMEASSFEGGISPQA 123
           + I   + +     ++DKP         A+A      S+ YP+         + GI  +A
Sbjct: 64  KKISKELAQ-----VNDKPLIVVNNADLAMAKILELFSVPYPE---------QNGIHEKA 109

Query: 124 FLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYS-S 182
            +    KI   V I P A +   VEIG  T +     I    ++G NC I    +I   +
Sbjct: 110 VIDPTAKIGKNVSIGPGAYIGKNVEIGDNTIIYANVCIYNDAKVGTNCIIWPSVTIRDRT 169

Query: 183 LIGNSVILHSGVRIGNDGFGYARGVSD---IHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
           +IG+   L+S   IG+DGFGY R   D   I +I HIG V+I   V+IG+N+ I+     
Sbjct: 170 IIGHFCRLYSNCSIGSDGFGY-RPSEDGRTIVRIPHIGNVVIGSFVDIGSNTCINNAKYG 228

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
            TIIG+ TKIDN VQIGHNV IG GC+I  Q GI+GS  IGD V+I G  GI  +  IG 
Sbjct: 229 STIIGDYTKIDNLVQIGHNVIIGKGCMICGQAGISGSVTIGDGVIIAGNAGIKDHTNIGS 288

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           + +I  K+GV+ D+PAG+ + G PA    E  +  + + K
Sbjct: 289 DARIGGKAGVMWDVPAGESHMGYPAYKDSELAKQWIAIRK 328


>gi|330998722|ref|ZP_08322451.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parasutterella excrementihominis YIT 11859]
 gi|329576461|gb|EGG57973.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Parasutterella excrementihominis YIT 11859]
          Length = 362

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 170/322 (52%), Gaps = 14/322 (4%)

Query: 25  SLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFI---- 80
           S +  N G+  I S++P+  A  GD++++ + K+ +    CKA+A++ +++    I    
Sbjct: 27  STISANGGKAEIKSIAPLETAGHGDVAFLANSKYRDAAGACKATALVLTEEDKQAIWGEK 86

Query: 81  -PKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAP 139
            P+ I  +++  P   FA A  I++PQ         E G+  +A + +   I+    +  
Sbjct: 87  EPERI-LVITRNPYAWFAYALQIIFPQEQP------EPGVDTRAVVEDGAVIDSTATVEA 139

Query: 140 MAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY-SSLIGNSVILHSGVRIGN 198
             V+  G ++G   +VG  SVIG GV +G +  I    +IY    IG   I+HSG  IG 
Sbjct: 140 GVVIRKGAQVGPYCFVGANSVIGEGVVLGEHTRIYPNVTIYYGCRIGRRNIIHSGAVIGA 199

Query: 199 DGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHN 258
           DGFG+A       KI  IG V   D VEIGAN+ IDRG + +T IG+ TKID+ V IGHN
Sbjct: 200 DGFGFAPLDRQYVKIPQIGAVETGDDVEIGANTCIDRGALQNTTIGQGTKIDDLVMIGHN 259

Query: 259 VHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQ 318
             +G   ++  + G+AGST IGDNV  GG  G AG+LK+     I   +GV   I     
Sbjct: 260 CQVGKNVVLSGRTGLAGSTIIGDNVQAGGGSGFAGHLKVAAGSIIGGGAGVPSSIEKPDY 319

Query: 319 YGG-MPARPIGEYLRHMVMLSK 339
           Y G MPA P  E+   + ++ +
Sbjct: 320 YAGYMPAMPHREFYNILSVIKR 341


>gi|283783963|ref|YP_003363828.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Citrobacter rodentium ICC168]
 gi|282947417|emb|CBG86962.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Citrobacter rodentium ICC168]
          Length = 341

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 116/324 (35%), Positives = 174/324 (53%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LA+ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ 
Sbjct: 4   IRLSDLAEQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLALCQASAVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           +QD +PF       L+   P +++A    IL   PQ            I+P A +     
Sbjct: 62  TQDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAK--------DIAPSAVVDATAT 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         VIGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNHVSIGANAVIESGVELGDNV------VIGAGCFVGKNTKIGAGSRLWANVTVYHDIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  IG DGFGYA    +  KI  +GRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGENCLIQSGTVIGADGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|83858378|ref|ZP_00951900.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83853201|gb|EAP91053.1| UDP-3-O-3-hydroxymyristoyl glucosamine N-acyltransferase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 341

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 107/347 (30%), Positives = 173/347 (49%), Gaps = 20/347 (5%)

Query: 5   NFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEK 64
            FF     +    +A  IG+ L+ +  G+  +  +S    A  GD+ ++   K       
Sbjct: 6   RFFERLGPLKASDIAALIGSDLIGD--GDVAVSDVSTPDSAGEGDLIFLAG-KAPPETPP 62

Query: 65  CKASAIICSQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAF 124
               AI+        +P     L+       FA A + L     H +   F   I P A 
Sbjct: 63  MAGVAIVPDASWAEALPHCQAVLVHRVTRAGFAKAAARLLAPRFH-DGPDF---IHPTAT 118

Query: 125 LGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI 184
           + +  ++  GV++ P AV      IG    +  G++IG GV IG +  IG  +++  +L+
Sbjct: 119 IADSARLAPGVIVGPDAV------IGENARIEAGAIIGPGVVIGDHARIGVRANVQCALV 172

Query: 185 GNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           G    + +G  +G  GFG A    ++  + H+GRVII+D+  +GAN+ +DRG + DT IG
Sbjct: 173 GARCEISAGAVVGEAGFGLAYENGEVFTLPHLGRVIIEDEATLGANATVDRGMLKDTRIG 232

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
           +  +IDN   I HNV +G   ++ +  GI+GST IG     GG+ G+A +LKIG   ++A
Sbjct: 233 KGARIDNLCHIAHNVDVGEYAVMAAFAGISGSTVIGAGAQFGGRVGVADHLKIGQGARLA 292

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLRHMVML-------SKPSKYK 344
           + + V+KD+PAG+ + G PA+PI  ++R    L       SKP + K
Sbjct: 293 ADAAVMKDVPAGETWAGSPAQPIQSFMRETAWLRRAVSRKSKPERKK 339


>gi|228474105|ref|ZP_04058846.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Capnocytophaga gingivalis ATCC 33624]
 gi|228274619|gb|EEK13460.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Capnocytophaga gingivalis ATCC 33624]
          Length = 343

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 166/315 (52%), Gaps = 8/315 (2%)

Query: 33  ERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKP 92
           E  +Y LS I     G I+++ + K+ + I   +AS +I   D  P  P     +    P
Sbjct: 23  EVEVYKLSKIEEGCPGTITFLSNPKYKHFIYTTEASVVIVKDDFHPEQPIKSTLIRVADP 82

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            ++F     + Y   M +       GI    F+     + + V I     +    +IG  
Sbjct: 83  YLAFT--QLLEYYNQMRIATKV---GIEEPVFINSSSTLGENVYIGAFTSIGAHCKIGNN 137

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYA-RGVSDI 210
             +   + IG  V IG N  I +  ++ + S+IG + ILHSGV IG DGFG+A +     
Sbjct: 138 VKIYSNTNIGDNVTIGDNTIIFSAVTLCADSVIGANCILHSGVVIGADGFGFAPQEDGSY 197

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
            KI  IG V+I+D+VEIGAN+ IDR T+  TII +  KIDN VQI HNV IG   +I SQ
Sbjct: 198 KKIPQIGNVVIEDEVEIGANTTIDRATMGSTIIRKGVKIDNLVQIAHNVEIGAHTVIASQ 257

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            G+AGS+ IG +  IGGQ GIAG+  IG+NV+I ++SG+ +D+   +   G PA    +Y
Sbjct: 258 AGVAGSSKIGAHCSIGGQVGIAGHFTIGNNVKIQAQSGIGRDVKDNEVIQGSPAFTYMDY 317

Query: 331 LRHMVMLSK-PSKYK 344
            +  V+  K P  +K
Sbjct: 318 NKSYVVFRKLPELFK 332


>gi|189499940|ref|YP_001959410.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chlorobium phaeobacteroides BS1]
 gi|189495381|gb|ACE03929.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Chlorobium phaeobacteroides BS1]
          Length = 362

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 112/319 (35%), Positives = 171/319 (53%), Gaps = 9/319 (2%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI-VPFIPKNIPCLLSD 90
           G+  I   + I  A+ G +S++ + K+   +   KAS +I  ++        ++  L   
Sbjct: 23  GDVTIDGPAKIENATKGTVSFVANEKYSRFVGTTKASLLIVGEETNTSQYNDHLNFLKVK 82

Query: 91  KPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIG 150
            P  +F       Y +   + A     G++  A +GE V++ + V I    V+     IG
Sbjct: 83  DPYTAFVFVLQ-KYTRPRLIAAP----GVASSAVIGEHVELGENVSIGEHTVIGDECVIG 137

Query: 151 RKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLI-GNSVILHSGVRIGNDGFGYARGVSD 209
             T +G  SV+ A VR GR+C++      Y+ +I G+ V +HSG  +G DGFG+A     
Sbjct: 138 DNTVIGSNSVLMAHVRTGRDCTLFPHVVCYNGIILGDRVTIHSGTVVGADGFGFAPQPDG 197

Query: 210 IH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIV 268
            + KI  +G V I D VEIGAN+ IDR T+  T+I +  KIDN VQIGHN  IG   +IV
Sbjct: 198 SYIKIPQMGIVEIDDDVEIGANNTIDRATMGSTVIEKGVKIDNLVQIGHNCTIGENTVIV 257

Query: 269 SQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA-GQQYGGMPARPI 327
           SQ GI+GS  +G + +IGGQ G +G+L + D  ++++++GV K     GQ  GG PA+P+
Sbjct: 258 SQAGISGSVSVGKHCMIGGQAGFSGHLSLPDRTRVSARAGVTKSAAKPGQTLGGFPAQPL 317

Query: 328 GEYLRHMVMLSKPSKYKIK 346
            + LR   +L    K K K
Sbjct: 318 RDQLRQEALLRGLDKMKRK 336


>gi|330830745|ref|YP_004393697.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aeromonas veronii B565]
 gi|328805881|gb|AEB51080.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Aeromonas veronii B565]
          Length = 339

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 106/324 (32%), Positives = 171/324 (52%), Gaps = 16/324 (4%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
             L +LAQ +GA +  +  G   I  ++ + +A  GDI+++ ++K+ + +E+ KA+A++ 
Sbjct: 3   FTLAQLAQQLGAQVHGD--GTLEIRKVATLEKAGEGDITFLSNKKYRHYLEQSKATAVLI 60

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           ++  +PF P N   L+   P V FA    +L   PQ            I P A +  DV+
Sbjct: 61  TEADLPFCPTN--ALVLKDPYVGFARVAQLLDTTPQPAT--------DIHPSAVIAADVQ 110

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVI 189
           + + V I   AV+  GV +G    +GPG  +G   R+G    + A  ++Y ++ +G   +
Sbjct: 111 LGERVAIGANAVIESGVVLGDDVRIGPGCFVGKNTRLGARSRLWANVTLYHNVTMGTDCL 170

Query: 190 LHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           + SG  IG DGFGYA    +  KI  +G V I ++VEIGA + IDRG ++DT I +N  I
Sbjct: 171 VQSGTVIGADGFGYANERGEWIKIPQLGGVTIGNRVEIGACTTIDRGALEDTRIADNVII 230

Query: 250 DNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGV 309
           DNQ QI HNV IG G  +     +AGS  +G   +IGG     G+++I D   +   + V
Sbjct: 231 DNQCQIAHNVEIGYGTAVAGSTVMAGSLKVGKYCIIGGASVFNGHMEICDQATVTGMAMV 290

Query: 310 LKDIPAGQQY-GGMPARPIGEYLR 332
           ++ I     Y  G+P +   E+ +
Sbjct: 291 MRPITEPGVYSSGIPLQTNKEWRK 314


>gi|225164732|ref|ZP_03726966.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Opitutaceae bacterium TAV2]
 gi|224800653|gb|EEG19015.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Opitutaceae bacterium TAV2]
          Length = 362

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 163/329 (49%), Gaps = 25/329 (7%)

Query: 7   FVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCK 66
           F S +   L++    +GA+          I S++ +  A  GD+S++   K+ N++   +
Sbjct: 5   FSSDEITKLLQPTAQLGAT-------NETISSIAALKDAQPGDLSFLAHTKYKNDLAHTR 57

Query: 67  ASAIICSQDI-VPFIPK--NIPCLLSDKPEVSFA----IAGSILYPQAMHMEASSFEGGI 119
           AS ++   D   P  P   N   L    P  + A    +  S  +P+           GI
Sbjct: 58  ASLVLIPADYDTPPPPPAANQLYLKVQNPSAALATLCAVIESRFWPRP--------HPGI 109

Query: 120 SPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI 179
            P A + + V+I     I P  VV  G  IG  T++     +G   RIG  C I    SI
Sbjct: 110 HPSAVIADGVQIAPTATIGPQCVVSEGAVIGEHTHLQAQIFVGRDARIGDQCWISPHVSI 169

Query: 180 --YSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT 237
             Y  L  + V +HSG  IG+DGFGY        KI  IG V++++ VEIGAN+ IDR  
Sbjct: 170 GDYCEL-RDRVRIHSGAVIGSDGFGYESSTGRHLKIPQIGNVVLENDVEIGANTTIDRAR 228

Query: 238 IDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKI 297
              T+IGE TKIDN VQIGHNV  G  CI+ +QVGI+GST +GD V++GGQ G  G++ I
Sbjct: 229 FSRTVIGEGTKIDNLVQIGHNVVTGKHCILCAQVGISGSTTLGDYVVLGGQTGTIGHIHI 288

Query: 298 GDNVQIASKSGVLKDIPAGQQYGGMPARP 326
               +   ++G+  +   G    G PA P
Sbjct: 289 ATGTRAGGQTGINFNTEPGSNISGSPALP 317


>gi|34497661|ref|NP_901876.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Chromobacterium violaceum ATCC 12472]
 gi|60390070|sp|Q7NVY4|LPXD_CHRVO RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|34103517|gb|AAQ59879.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (firA
           protein) [Chromobacterium violaceum ATCC 12472]
          Length = 348

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 172/336 (51%), Gaps = 18/336 (5%)

Query: 15  LMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQ 74
           L  + + +G +L   N   R +  L+P+  A  G+I+++ S KF   + +  A A+I ++
Sbjct: 5   LEHIVKQLGGALRGPN---REVSRLAPLELAGAGEIAFVASAKFRRQMLESAADALIVTE 61

Query: 75  DIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDG 134
            +   +P     + +D P + FA   ++ +P        +   GI P+A +G   +I + 
Sbjct: 62  ALAAELPDRSLIVAAD-PYLYFARLATLFHPP------KAPRAGIHPRAVVGVGCRIGES 114

Query: 135 VVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSG 193
             IA  A +   V IG +  + PG V+G G  IG + ++    +IY   +IGN V +HSG
Sbjct: 115 SEIAANATIGDNVVIGERCRLMPGVVVGDGCEIGDDVTLYPNVTIYHDCVIGNRVGVHSG 174

Query: 194 VRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQV 253
             IG DGFG A       KI   GRV+++D VEIGAN+ +DRG + DT+I +  KIDN V
Sbjct: 175 SVIGGDGFGLAWDKDHWFKIPQTGRVVLEDDVEIGANTTVDRGALVDTVIRKGAKIDNLV 234

Query: 254 QIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDI 313
           QI HNV IG    I   VGIAGST IG    +GG     G++++ D   I   + V K I
Sbjct: 235 QIAHNVEIGEHTAIAGCVGIAGSTKIGARCTVGGAAMFVGHIEVADRTHIGGGTLVSKSI 294

Query: 314 -PAGQQYGGMPARPIGEYL------RHMVMLSKPSK 342
             AG      P + + ++L      RH+   +K  K
Sbjct: 295 KEAGNYASSYPLQSMKDWLSNAVHVRHLDDFAKRVK 330


>gi|56708597|ref|YP_170493.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis SCHU S4]
 gi|89255944|ref|YP_513306.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica LVS]
 gi|110671068|ref|YP_667625.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis FSC198]
 gi|115314426|ref|YP_763149.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica OSU18]
 gi|156501937|ref|YP_001428002.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|167009151|ref|ZP_02274082.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica FSC200]
 gi|224457781|ref|ZP_03666254.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis MA00-2987]
 gi|254367299|ref|ZP_04983326.1| UDP-3-o-3-hydroxymyristoyl glucosamine N-acetyltransferase
           [Francisella tularensis subsp. holarctica 257]
 gi|254368775|ref|ZP_04984788.1| UDP-3-O-(3-hydroxy-fatty acid)-glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica FSC022]
 gi|254371229|ref|ZP_04987231.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase 2
           [Francisella tularensis subsp. tularensis FSC033]
 gi|254875461|ref|ZP_05248171.1| lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis MA00-2987]
 gi|290954612|ref|ZP_06559233.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica URFT1]
 gi|295311955|ref|ZP_06802779.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica URFT1]
 gi|81597121|sp|Q5NEP9|LPXD2_FRATT RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|119371888|sp|Q14G52|LPXD2_FRAT1 RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|119371907|sp|Q2A4P6|LPXD2_FRATH RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|119371908|sp|Q0BN22|LPXD2_FRATO RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 2
 gi|166199086|sp|A7NAP3|LPXD_FRATF RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|56605089|emb|CAG46204.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis SCHU S4]
 gi|89143775|emb|CAJ78977.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica LVS]
 gi|110321401|emb|CAL09587.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis FSC198]
 gi|115129325|gb|ABI82512.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134253116|gb|EBA52210.1| UDP-3-o-3-hydroxymyristoyl glucosamine N-acetyltransferase
           [Francisella tularensis subsp. holarctica 257]
 gi|151569469|gb|EDN35123.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase 2
           [Francisella tularensis subsp. tularensis FSC033]
 gi|156252540|gb|ABU61046.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|157121696|gb|EDO65866.1| UDP-3-O-(3-hydroxy-fatty acid)-glucosamine N-acyltransferase
           [Francisella tularensis subsp. holarctica FSC022]
 gi|254841460|gb|EET19896.1| lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis MA00-2987]
 gi|282159826|gb|ADA79217.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Francisella tularensis subsp. tularensis NE061598]
          Length = 337

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 116/317 (36%), Positives = 167/317 (52%), Gaps = 18/317 (5%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           D+N   + I +LS   +A  GDIS+  + K+L  + + KASA++ +++++ F   N   L
Sbjct: 18  DKNVEIKKIATLS---QAGEGDISFCTNPKYLKALSETKASAVLITEEVLEFCNTNAVVL 74

Query: 88  LSDKPEVSFAIAGSILYPQAMHM--EASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYP 145
               P ++ A        + M +  ++   +G I  +A +     I + V I   AVV  
Sbjct: 75  --SNPYMALA--------KVMELFDKSPRPDGKIHSKAVIAASAIIGENVTIGANAVVGE 124

Query: 146 GVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHSGVRIGNDGFGYA 204
            V IG   Y+G  + I  G +IG +  I +  SI +  +IG   I+H    IG DGFG A
Sbjct: 125 NVVIGDNVYIGACATIDNGTKIGNDTLIKSNVSIAHDVVIGTGCIIHQNAVIGCDGFGNA 184

Query: 205 RGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGC 263
           R       KI  +GRVII+D VEIG+ + +DRG IDDTII +  +IDN VQI HNV IG 
Sbjct: 185 RDEDGSWTKIPQLGRVIIEDDVEIGSGTTVDRGAIDDTIIKKGARIDNLVQIAHNVVIGR 244

Query: 264 GCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA-GQQYGGM 322
              +     +AGST IGDN LIGGQ  I G++ I DN  I   S + K I   G  Y   
Sbjct: 245 NTALAGVTAVAGSTTIGDNCLIGGQSAITGHISICDNTIIGGASNIGKSITKPGMYYAAF 304

Query: 323 PARPIGEYLRHMVMLSK 339
            A+P  ++ R +  L+K
Sbjct: 305 EAKPRIQWGRFVAKLAK 321


>gi|260592059|ref|ZP_05857517.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella veroralis F0319]
 gi|260535937|gb|EEX18554.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Prevotella veroralis F0319]
          Length = 346

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 113/326 (34%), Positives = 174/326 (53%), Gaps = 23/326 (7%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           DEN   + I++ + I     G IS++ + K+ + +    +S ++  +DI   + K +   
Sbjct: 19  DEN---KTIHTFAKIEDGKEGAISFLANPKYTHYLYNTASSIVLVDEDIQ--LEKPVKAT 73

Query: 88  LSDKPEVSFAIAGSI-LY----PQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAV 142
           L         +A  + LY    P+   +++ +F   +SP+A +G+DV       I   A 
Sbjct: 74  LIRVKNARDCVAKLLQLYESMKPKRQGIDSLAF---VSPKATIGKDV------YIGAFAY 124

Query: 143 VYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVRIGNDGF 201
           V  GV +G    + P + I  GV +G+NC I   +SIY    +G+ VILHSG  +G DGF
Sbjct: 125 VGDGVTVGDGCQIYPHATIMEGVEMGKNCIIYPNASIYQGCKLGDRVILHSGAVVGADGF 184

Query: 202 GYARG--VSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNV 259
           G+A     +   KI  IG V ++D VEIGAN+ +DR T+  T + +  K+DN VQI HN 
Sbjct: 185 GFAPNAETNSYDKIPQIGIVTLEDDVEIGANTCVDRSTMGSTYVRKGVKLDNLVQIAHNT 244

Query: 260 HIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY 319
            IG   ++ +QVGIAGST +G   + GGQ GIAG+++IGD V + ++SGV   + A QQ 
Sbjct: 245 DIGENTVMSAQVGIAGSTKVGQWCMFGGQVGIAGHIEIGDKVFLGAQSGVPGSLKANQQL 304

Query: 320 GGMPARPIGEYLRHMVMLSK-PSKYK 344
            G P      Y +   +  + P  YK
Sbjct: 305 IGTPPMEQRSYFKSQAIFRRLPEMYK 330


>gi|26246125|ref|NP_752164.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli CFT073]
 gi|26106522|gb|AAN78708.1|AE016755_208 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli CFT073]
          Length = 341

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 173/324 (53%), Gaps = 28/324 (8%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I  ++ +  A TG I+++++ K+  ++  C+AS ++ 
Sbjct: 4   IRLADLAQQLDAELHGD--GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASXVVM 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVK 130
           + D +PF       L+   P +++A    IL   PQ            I+P A +    K
Sbjct: 62  TXDDLPFAKS--AALVVKNPYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAK 111

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL------- 183
           + + V I   AV+  GVE+G         +IGAG  +G+N  IGAGS +++++       
Sbjct: 112 LGNNVSIGANAVIESGVELGDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQ 165

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTII 243
           IG + ++ SG  +G DGFGYA    +  KI  IGRVII D+VEIGA + IDRG +DDT+I
Sbjct: 166 IGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVI 225

Query: 244 GENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQI 303
           G    IDNQ QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +
Sbjct: 226 GNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTV 285

Query: 304 ASKSGVLKDIPAGQQY-GGMPARP 326
                V++ I     Y  G+P +P
Sbjct: 286 TGMGMVMRPITEPGVYSSGIPLQP 309


>gi|315616336|gb|EFU96954.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Escherichia coli 3431]
          Length = 329

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 166/305 (54%), Gaps = 26/305 (8%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDK 91
           G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ +QD +PF       L+   
Sbjct: 9   GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKS--AALVVKN 66

Query: 92  PEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           P +++A    IL   PQ            I+P A +    K+ + V I   AV+  GVE+
Sbjct: 67  PYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAKLGNNVSIGANAVIESGVEL 118

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFG 202
           G         +IGAG  +G+N  IGAGS +++++       IG + ++ SG  +G DGFG
Sbjct: 119 GDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFG 172

Query: 203 YARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIG 262
           YA    +  KI  IGRVII D+VEIGA + IDRG +DDTIIG    IDNQ QI HNV IG
Sbjct: 173 YANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIG 232

Query: 263 CGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GG 321
               +   V +AGS  IG   +IGG   I G+++I D V +     V++ I     Y  G
Sbjct: 233 DNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSG 292

Query: 322 MPARP 326
           +P +P
Sbjct: 293 IPLQP 297


>gi|225872194|ref|YP_002753649.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidobacterium capsulatum ATCC 51196]
 gi|225792693|gb|ACO32783.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Acidobacterium capsulatum ATCC 51196]
          Length = 347

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 178/340 (52%), Gaps = 35/340 (10%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L  LA  +G     E+  E  I  ++ I  A  G ++++ + K+   ++K +ASA++ 
Sbjct: 1   MKLSVLAHQLGGVCTGEDDPE--ISGVAGIEEAQPGHLTFVANPKYTAEVKKTRASAVVV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY----------PQA-MHMEASSFEGG-IS 120
           S D   F    +P L    P+++FA A  + Y          P+A +H  A    G  I 
Sbjct: 59  SPD---FPEIALPALRVKNPDLAFARAIEVFYRGPVYAPGIHPKAEVHPTAKIGAGAHIG 115

Query: 121 PQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIY 180
             A +GE+V I +  VI P  V+YPGV IG + +    +V+        NC +G G    
Sbjct: 116 AYAVIGENVVIGEQAVILPHVVIYPGVTIGDRFFAHAHAVVR------ENCRLGDG---- 165

Query: 181 SSLIGNSVILHSGVRIGNDGFGYAR-GVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTID 239
                  VIL +G  +G+DGFG+AR      +KIV  G  I+ D+VEI AN+ +DR  + 
Sbjct: 166 -------VILQNGAVVGSDGFGFARLEGGGWYKIVQSGPAILDDEVEIQANACVDRARVG 218

Query: 240 DTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGD 299
           +T +    K+DN VQ+GH   IG   ++ SQ G+AGST IG NV++ GQ G+AG+ KIGD
Sbjct: 219 ETHLHRGVKVDNLVQVGHGSIIGENSLLCSQTGLAGSTEIGRNVILAGQVGVAGHCKIGD 278

Query: 300 NVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
            V   +++G+  DIPAG    G P     ++LR   ++ +
Sbjct: 279 GVIATAQAGLHGDIPAGSILSGSPGFDNKQWLRVTAIMPR 318


>gi|77360950|ref|YP_340525.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|119371957|sp|Q3IIY4|LPXD_PSEHT RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|76875861|emb|CAI87082.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 340

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 115/333 (34%), Positives = 167/333 (50%), Gaps = 11/333 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
            L ++A+ + A L  +  G   I  ++ +A A +G I+++ ++K+ + +E  +ASA+I S
Sbjct: 5   TLSQIAELLSAELQGD--GALEITKIATLAHARSGHIAFLANKKYRSQLEVTQASAVIVS 62

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIED 133
           +   P+   N   L+   P VS+A        Q M     S   GI P A +  +  +  
Sbjct: 63  EADAPYFNGN--KLIVANPYVSYA-----KLAQLMDTTPRSAATGIHPSAVVHPNATVSK 115

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHS 192
              I    V+     I     +GP S IG GV+IG    + +  +IY ++ IG+  +L +
Sbjct: 116 SAAIGANTVIESNAIINDNVQIGPNSFIGEGVKIGSGTKLWSNVTIYHNVEIGSDCLLQA 175

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQ 252
              IG+DGFGYA       KI  +G VII DKVEIGA++ IDRG +DDTII  N  IDNQ
Sbjct: 176 NSVIGSDGFGYANERGQWIKIPQLGSVIIGDKVEIGASTTIDRGALDDTIIHSNVIIDNQ 235

Query: 253 VQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKD 312
            QI HNV +  G  I     +AGS  IG N  IGG   I G++ + D V I   S V K 
Sbjct: 236 CQIAHNVEVNSGTAIAGCTVLAGSVTIGKNCQIGGMTAINGHMSVCDGVIITGMSMVTKS 295

Query: 313 IPAGQQY-GGMPARPIGEYLRHMVMLSKPSKYK 344
           I     Y  G+P     E+ + +  L   S+ K
Sbjct: 296 ITEPGIYSSGIPHTTNKEWRKSIAHLRNLSEMK 328


>gi|282898187|ref|ZP_06306178.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase, LpxD
           [Raphidiopsis brookii D9]
 gi|281196718|gb|EFA71623.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N- acyltransferase, LpxD
           [Raphidiopsis brookii D9]
          Length = 351

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 110/317 (34%), Positives = 163/317 (51%), Gaps = 11/317 (3%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI---VPFIPKNIPCLLSDKP 92
           I  ++ I  A  G I+Y+   KF + +   KAS +I   D         + +  L + +P
Sbjct: 30  IRGVAAIDEAQAGTITYVEGPKFASLLTSTKASVLILPLDEKLHQQATAQGMAWLATPQP 89

Query: 93  EVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
            + FA   S+ Y      +       I P A +   VKI D V I    V+    EIG  
Sbjct: 90  RLLFAQTISLFY------QPYKPSPSIHPTAVIDPSVKIGDHVYIGAHVVILANTEIGNG 143

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYS-SLIGNSVILHSGVRIGNDGFGYARGVSDIH 211
            ++ P  VI    +IG    + A  +I+  S IG   ++HSG  IG +GFG+    +   
Sbjct: 144 VFIYPNVVIYPDAKIGDRTVLHANCAIHERSQIGTDCVIHSGTVIGAEGFGFVPTTTGWL 203

Query: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271
           K+   G  +++D VEIG NSA+DR  + +T IG++TKIDN VQIGH   IG GC I  Q 
Sbjct: 204 KMEQSGYTVLEDGVEIGCNSAVDRPAVGETRIGKHTKIDNLVQIGHGCQIGSGCAIAGQA 263

Query: 272 GIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYL 331
           G+AG   +G+ V++ GQ GIA  +KIGD V +++++GV  DI +G+   G PA P   YL
Sbjct: 264 GMAGGVKVGNRVVLAGQTGIANQVKIGDGVIVSAQAGVHGDIASGEIVSGSPALPHKLYL 323

Query: 332 RHMVMLSK-PSKYKIKR 347
           +   + S+ P  Y   +
Sbjct: 324 KVSAVYSRLPEIYNFFK 340


>gi|225012876|ref|ZP_03703309.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Flavobacteria bacterium MS024-2A]
 gi|225002998|gb|EEG40975.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Flavobacteria bacterium MS024-2A]
          Length = 234

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 135/224 (60%), Gaps = 19/224 (8%)

Query: 142 VVYPGVEIGRKTYVGPGSVIG-----AGVRIGRNCSIGAGSSIYSS-------------L 183
           ++ P  ++G+  YVGP + IG     +GV+I  NC IGAG  I  +             +
Sbjct: 1   MINPSAKLGKDVYVGPNATIGECVIESGVQIHSNCVIGAGVIIGKNTILMPNVIILDECV 60

Query: 184 IGNSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTI 242
           +G + I+HSGV IG+DGFG+A   S  + KI  +GRV+++D VEIGANS IDR T+ DT+
Sbjct: 61  VGANCIIHSGVVIGSDGFGFAPQESGAYVKIPQLGRVVVKDDVEIGANSTIDRATLGDTL 120

Query: 243 IGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQ 302
           I +  K+DN +QI HNV IG   +I +Q GIAGST IG + +IGGQ G AG+L IGD VQ
Sbjct: 121 IEKGVKLDNMIQIAHNVEIGAHTVIAAQTGIAGSTKIGSHCVIGGQVGFAGHLTIGDGVQ 180

Query: 303 IASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           +  ++GV K IP+   + G PA     Y +   +  +  K + +
Sbjct: 181 LQGQTGVTKSIPSAGAFQGTPAMDYKAYYKSYALFKQFPKIEAR 224


>gi|298383876|ref|ZP_06993437.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 1_1_14]
 gi|298263480|gb|EFI06343.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 1_1_14]
          Length = 346

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 168/321 (52%), Gaps = 9/321 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
           VP        +  D    S A    +L    ++  +   + GI   A++    KI + V 
Sbjct: 65  VPEHEIRATLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAYIAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG  C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENTVIGDNTQIYPHTFVGDGVKIGNGCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  TII    KIDN VQI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATIIHSGAKIDNLVQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +QVGIAGS  IG+  + GGQ GIAG++ IGD V + ++SG+   I A
Sbjct: 239 AHNDEIGSHTVMAAQVGIAGSAKIGEWCMFGGQVGIAGHITIGDRVNLGAQSGIPSSIKA 298

Query: 316 GQQYGGMPARPIGEYLRHMVM 336
                G P      Y +  V+
Sbjct: 299 DSVLIGTPPMEPKAYFKAAVV 319


>gi|37524683|ref|NP_928027.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|60390069|sp|Q7N8N7|LPXD_PHOLL RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|36784108|emb|CAE12977.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 342

 Score =  166 bits (419), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 170/316 (53%), Gaps = 12/316 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           I L  LAQ + A L  +  G+ +I S++P+  A+   I+++   ++   + +C+A+A++ 
Sbjct: 4   IRLADLAQQLNAQLHGD--GDIVITSIAPMHSANGEQITFLSDSRYRERLGECQAAAVVL 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
               +P+   NIP L+   P +++A    I+    +  +       ISPQA LG++V   
Sbjct: 62  QASDLPYC--NIPALVVANPYLAYAYMAQIMDTTPIPAQDIHSSAVISPQATLGKNV--- 116

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
               +   AV+  GV +G    +G G  IG   RIG    + A  S+Y ++ +G   ++ 
Sbjct: 117 ---AVGANAVIESGVVLGDNVVIGAGCFIGKNTRIGAGSRLWANVSVYHNVEMGEQCLIQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA       KI  +G VII D+VEIGA + IDRG +D+TIIG    IDN
Sbjct: 174 SGAVIGSDGFGYANDRGKWVKIPQLGSVIIGDRVEIGACTTIDRGALDNTIIGNGVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q QI HNV IG    +   V +AGS  IG   +IGG   I G+++I D V +   S V++
Sbjct: 234 QCQIAHNVIIGDNTAVAGGVIMAGSLKIGCYCMIGGASVINGHMEICDKVTVTGMSMVMR 293

Query: 312 DIPAGQQY-GGMPARP 326
            I     Y  G+PA+P
Sbjct: 294 PITEPGVYSSGIPAQP 309


>gi|114569940|ref|YP_756620.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Maricaulis maris MCS10]
 gi|119371943|sp|Q0APV5|LPXD_MARMM RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|114340402|gb|ABI65682.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Maricaulis maris MCS10]
          Length = 344

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 169/349 (48%), Gaps = 13/349 (3%)

Query: 1   MQRLNFFVSHKGIALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLN 60
           M    F+     + L  +A   GA++ D    ++ +  ++P+     G +SY  S K L 
Sbjct: 1   MADPRFYDRLGPLTLKDIAALSGAAISDSGTADQSVDRVTPLGEPVAGALSYAESGKLLR 60

Query: 61  NIEKCKAS--AIICSQDIVPFIPK-NIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEG 117
           +      S  A+IC  D      +     L    P  +FA     L+ Q       SF  
Sbjct: 61  SAPDGALSGVAVICPPDAASEATRLGAAVLTHTAPRAAFASVLPALF-QTRSFATDSF-- 117

Query: 118 GISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGS 177
            I P A +G   ++  GVVI        G EIG    +GP  VIG G RIG    +    
Sbjct: 118 -IDPSAKIGAGTRLGAGVVIGE------GAEIGTDCVIGPHCVIGPGCRIGDRSRLSPHV 170

Query: 178 SIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGT 237
           S+  S IG    + +G  IG DGFG A    +   I+H+G V+I D V IGAN  IDRG 
Sbjct: 171 SLQCSDIGADCNILAGAVIGEDGFGIAVSNGNTVGILHLGSVLIGDHVTIGANCTIDRGL 230

Query: 238 IDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKI 297
              T IG ++KIDN   I HN  IG   I+    G+AGS  I DN ++GG+ G+  ++ I
Sbjct: 231 FGATRIGASSKIDNLCHIAHNADIGENVIMAGYSGLAGSAVIADNAMLGGRVGVYDHVTI 290

Query: 298 GDNVQIASKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSKPSKYKIK 346
           G+  ++ + S   +D+PAG+ + G PA+P+ +++R +  L + ++ K K
Sbjct: 291 GEGARVGANSAASRDVPAGEFWVGNPAQPMRQHMRELAELRRLARPKNK 339


>gi|187931174|ref|YP_001891158.1| UDP-3-O-(3-hydroxy-fatty acid)-glucosamine N-acyltransferase
           [Francisella tularensis subsp. mediasiatica FSC147]
 gi|187712083|gb|ACD30380.1| UDP-3-O-(3-hydroxy-fatty acid)-glucosamine N-acyltransferase
           [Francisella tularensis subsp. mediasiatica FSC147]
          Length = 337

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 116/317 (36%), Positives = 167/317 (52%), Gaps = 18/317 (5%)

Query: 28  DENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCL 87
           D+N   + I +LS   +A  GDIS+  + K+L  + + KASA++ +++++ F   N   L
Sbjct: 18  DKNVEIKKIATLS---QAGEGDISFCTNPKYLKALSETKASAVLITEEVLEFCNTNAVVL 74

Query: 88  LSDKPEVSFAIAGSILYPQAMHM--EASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYP 145
               P ++ A        + M +  ++   +G I  +A +     I + V I   AVV  
Sbjct: 75  --SNPYMALA--------KVMELFDKSPRPDGKIHSKAVIAASAIIGENVTIGANAVVGE 124

Query: 146 GVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHSGVRIGNDGFGYA 204
            V IG   Y+G  + I  G +IG +  I +  SI +  +IG   I+H    IG DGFG A
Sbjct: 125 NVVIGDDVYIGACATIDNGTKIGNDTLIKSNVSIAHDVVIGTGCIIHQNAVIGCDGFGNA 184

Query: 205 RGVS-DIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGC 263
           R       KI  +GRVII+D VEIG+ + +DRG IDDTII +  +IDN VQI HNV IG 
Sbjct: 185 RDEDGSWTKIPQLGRVIIEDDVEIGSGTTVDRGAIDDTIIKKGARIDNLVQIAHNVVIGR 244

Query: 264 GCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA-GQQYGGM 322
              +     +AGST IGDN LIGGQ  I G++ I DN  I   S + K I   G  Y   
Sbjct: 245 NTALAGVTAVAGSTTIGDNCLIGGQSAITGHISICDNTIIGGASNIGKSITKPGMYYAAF 304

Query: 323 PARPIGEYLRHMVMLSK 339
            A+P  ++ R +  L+K
Sbjct: 305 EAKPRIQWGRFVAKLAK 321


>gi|260913170|ref|ZP_05919652.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pasteurella dagmatis ATCC 43325]
 gi|260632757|gb|EEX50926.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Pasteurella dagmatis ATCC 43325]
          Length = 342

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 173/322 (53%), Gaps = 12/322 (3%)

Query: 14  ALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICS 73
           +L +LAQ IGA++      + ++ S++P+ +A+   +++I + KF   + + KA  ++ S
Sbjct: 5   SLQELAQQIGATI--RGNADVVVESIAPLDKANEKQLTFISNPKFRELLSQSKAGILVVS 62

Query: 74  QDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEAS-SFEGGISPQAFLGEDVKIE 132
           +  V F  +    L+   P V++AI        A +M+ +     GI+P A + E V + 
Sbjct: 63  EADVVFCSEQSNLLIVKDPYVAYAIL-------AQYMDKTPKAASGIAPTAVVSEQVVLG 115

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           + V I   AV+  GVE+G    +G    +G   +IG N  + A  S+Y  + IG   ++ 
Sbjct: 116 ENVSIGANAVIEDGVELGDNVVIGANCFVGKNTKIGANTQLWANVSVYHDVEIGQHCLIQ 175

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA       KI  +G+VII + VEIGA + IDRG +D T+I +N  IDN
Sbjct: 176 SGAVIGSDGFGYANDRGRWIKIPQVGQVIIGNHVEIGACTCIDRGALDPTVIEDNVIIDN 235

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
             QI HNVHIG G  +   V +AGS  +G   LIGG   I G+++I D V I     V++
Sbjct: 236 LCQIAHNVHIGTGTAVAGGVIMAGSLKVGRYCLIGGASVINGHMEICDKVTITGMGMVMR 295

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            I     Y  G+P +   E+ +
Sbjct: 296 PITEPGVYSSGIPLQTNKEWRK 317


>gi|332520447|ref|ZP_08396909.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Lacinutrix algicola 5H-3-7-4]
 gi|332043800|gb|EGI79995.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Lacinutrix algicola 5H-3-7-4]
          Length = 342

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 109/312 (34%), Positives = 165/312 (52%), Gaps = 14/312 (4%)

Query: 36  IYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDKPEVS 95
           +  LS I     G ++++ + K+   I   KAS  I ++D  P      P L+  K E +
Sbjct: 24  VSKLSKIEEGVEGALTFLANPKYTQYIYTTKASIAIVNKDFEPEQEVQ-PTLI--KVEDA 80

Query: 96  FAIAGSIL-YPQAMHMEASSFE--GGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGRK 152
           +     +L Y   + +     E    IS  A LG DV       +     +   V IG  
Sbjct: 81  YKSFSKLLEYYNQVKLNKFGIEQPSSISETATLGNDV------YVGAFTYIGDNVTIGDN 134

Query: 153 TYVGPGSVIGAGVRIGRNCSIGAGSSIYSS-LIGNSVILHSGVRIGNDGFGYARGVS-DI 210
             + P S IG  V IG N  + +G+ +YS  ++GN+ +++SG  IG DGFG+A     + 
Sbjct: 135 VKIFPSSYIGDNVTIGENTVVFSGAKVYSECIVGNNCVINSGAIIGADGFGFAPNEKGEY 194

Query: 211 HKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQ 270
           HK+  IG VI++D V+IGA + IDR T+  T+I    K+DNQ+QI HNV IG   +I +Q
Sbjct: 195 HKVPQIGNVILEDFVDIGAATTIDRATLGSTVIKRGVKLDNQIQIAHNVEIGENTVIAAQ 254

Query: 271 VGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPIGEY 330
            G+AGST IG N +IGGQ GI G++ IG+ V+I ++SG+ +++   +   G PA   G+Y
Sbjct: 255 TGVAGSTKIGQNCIIGGQVGIVGHITIGNGVKIQAQSGIGRNVKDNEVLQGSPALSYGDY 314

Query: 331 LRHMVMLSKPSK 342
            +  V      K
Sbjct: 315 NKSYVYFKNLPK 326


>gi|313682610|ref|YP_004060348.1| UDP-3-o-(3-hydroxymyristoyl) glucosamine n-acyltransferase
           [Sulfuricurvum kujiense DSM 16994]
 gi|313155470|gb|ADR34148.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Sulfuricurvum kujiense DSM 16994]
          Length = 315

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 114/335 (34%), Positives = 170/335 (50%), Gaps = 32/335 (9%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++A  +G S ++++     I  ++ +  AS G+IS++   K+   +E  +ASA+I 
Sbjct: 1   MKLFEIAALLGCSGVEDSI---EITGMNTLREASAGEISFLSDSKYEKELENTQASAVIL 57

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
                  +PK +  L SD+P +S A+        + H         + P           
Sbjct: 58  PSSKAHLLPKGVIALPSDEPYMSVALL-------SKHFSKPIRSSEVPP----------- 99

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IG 185
              VI   +VVYP   I     +G    I +GV +G +  IG    +Y ++       IG
Sbjct: 100 ---VIGEGSVVYPSAHIENGASIGSNCTIMSGVYVGADAVIGDDVILYPNVCIYRDCRIG 156

Query: 186 NSVILHSGVRIGNDGFGYARGVSDIH-KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIG 244
           N V++H+G  IG+DGFGYA      H K+   G V+I+D VEIGAN+ +D      TII 
Sbjct: 157 NRVMIHAGSVIGSDGFGYAHTKMGEHVKLYQNGNVVIEDDVEIGANTTVDCAVFGSTIIK 216

Query: 245 ENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIA 304
           + +KIDN VQIGHN  IG   I+VSQ G+AGST +G NV++GGQ   AG+L I     +A
Sbjct: 217 QGSKIDNLVQIGHNCIIGEHSILVSQTGLAGSTTLGRNVVMGGQSATAGHLSIAPFTTMA 276

Query: 305 SKSGVLKDIPAGQQYGGMPARPIGEYLRHMVMLSK 339
           ++SGV K I     Y G P      +L+    L+K
Sbjct: 277 ARSGVTKSITNKGVYSGFPLMEHKMWLKMQAKLAK 311


>gi|37521580|ref|NP_924957.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gloeobacter violaceus PCC 7421]
 gi|60390198|sp|Q7NJ21|LPXD1_GLOVI RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase 1
 gi|35212578|dbj|BAC89952.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Gloeobacter violaceus PCC 7421]
          Length = 373

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 111/339 (32%), Positives = 170/339 (50%), Gaps = 43/339 (12%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L  ++  +G +L  E  G+  I  ++ I  A  G ++++ + K+   +   KASA I 
Sbjct: 1   MKLSDISAKLGCAL--EGDGQVDIVGIAGIEEAEAGHLTFLSNPKYKAKLRHTKASAAIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILY-----PQAMHMEASSFEGGISPQAFLGE 127
             D        +P L    P ++FA A  + Y     P  +H  A      ++P A  G 
Sbjct: 59  PADFEASAAWPLPLLRHANPYLTFAHAIELFYSPPPAPHGVHPTAV-----VAPTAVCGH 113

Query: 128 DVKI------------EDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGA 175
           +V+I             DGV + P   +YPGV IGR + +    V+   V IG +C    
Sbjct: 114 NVRIGASSVIGEGVVLADGVTVYPNCTIYPGVRIGRNSTIHSNCVVREHVVIGEDC---- 169

Query: 176 GSSIYSSLIGNSVILHSGVRIGNDGFGYARGVS-DIHKIVHIGRVIIQDKVEIGANSAID 234
                        I+ +G  IG DGFGYA+      +KIV  G V+++++VEIGA + +D
Sbjct: 170 -------------IVQNGAVIGADGFGYAKQADGTWYKIVQSGSVVLENRVEIGACTTVD 216

Query: 235 RGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGY 294
           R TI +T I   +K+DN V IGH   +G   ++  QVG+AGS+ +G NV++ GQ G+AG+
Sbjct: 217 RATIGETRIKSGSKLDNLVMIGHGSSVGENTLLCGQVGLAGSSTVGRNVMLAGQVGVAGH 276

Query: 295 LKIGDNVQIASKSGVLKDIPAGQ-QYGGMPARPIGEYLR 332
           L IGDNV    KS + K + A Q  YG +PA     +L+
Sbjct: 277 LHIGDNVVATVKSCIWKSVEANQVLYGNIPASDSHTWLK 315


>gi|262404584|ref|ZP_06081139.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           sp. RC586]
 gi|262349616|gb|EEY98754.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Vibrio
           sp. RC586]
          Length = 350

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 172/322 (53%), Gaps = 12/322 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LA   G  L  +     ++ +++P+ +A  G+++++ + K+  ++  CKA+ I+ 
Sbjct: 4   LTLAELATITGGELHGDPTA--LVSAVAPMDKAQLGNVTFLSNPKYSKHLSACKATVIMV 61

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
                   P N+  L+   P V+FA     L        A ++  GI+  A + ED K+ 
Sbjct: 62  KASERELCPGNV--LVVADPYVAFAKVTQALDS----TPAPAY--GIALSAVIAEDAKLG 113

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           + V I   AV+  GV++G    VG G  IG    +G N  + A  +IY  + IG+  ++ 
Sbjct: 114 NNVSIGANAVIESGVQLGDNVVVGAGCFIGKQACLGDNTKLWANVTIYHKVEIGSDCLIQ 173

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           SG  IG+DGFGYA    +  KI  +G V I D+VEIGA + IDRG +DDT+I +N  IDN
Sbjct: 174 SGTVIGSDGFGYANERGEWIKIPQLGSVRIGDRVEIGACTTIDRGALDDTVIEDNVIIDN 233

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QI HNVHIG G  +     IAGST IG   +IGG   + G+++I D V I     V++
Sbjct: 234 QMQIAHNVHIGYGSALAGGTIIAGSTRIGKYCIIGGASVLNGHIEIADGVTITGMGMVMR 293

Query: 312 DIPAGQQY-GGMPARPIGEYLR 332
            I     Y  G+P +   E+ +
Sbjct: 294 SIEEKGMYSSGIPLQTNKEWRK 315


>gi|254479958|ref|ZP_05093206.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [marine
           gamma proteobacterium HTCC2148]
 gi|214039520|gb|EEB80179.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase [marine
           gamma proteobacterium HTCC2148]
          Length = 336

 Score =  166 bits (419), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 110/329 (33%), Positives = 169/329 (51%), Gaps = 12/329 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L +LAQ    +L  +   +R +  L+ +  A    +S+I SRK+L  +    A+A++ 
Sbjct: 1   MTLGELAQRFNLTLSGD--AQRSVSGLATLGGAGPDHVSFIASRKYLEQLADTAAAAVLI 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
             D     P  +  L+++ P ++FA   S+    +   E      G+ P A +  + ++ 
Sbjct: 59  HPDFADQCP--VDTLVTEDPYLAFARMTSLFDRSSRPAE------GVHPAAVVSAEAEVA 110

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
           D V IA  AVV  G  IG    +G  + +GAG RIG N  +  G  +Y  + +G   I+H
Sbjct: 111 DSVRIAANAVVEAGAVIGEGVVIGANAYVGAGSRIGANTCLNPGVIVYHDVWLGARCIVH 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
           S   +G+DGFG+A G     KI  +G + I D VEIGA + IDRG ++ T+I +   IDN
Sbjct: 171 STSVLGSDGFGFAPGPEGWEKIHQLGGLRIGDDVEIGAGTTIDRGALEHTVIEDGVIIDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           QV I HN  IG    I    G+AGST IG N  + G   ++G+++I D V I   S V +
Sbjct: 231 QVHIAHNCRIGKNTAIAGCTGMAGSTIIGANCTVAGAVALSGHIEICDGVHITGMSMVTR 290

Query: 312 DIPAGQQY-GGMPARPIGEYLRHMVMLSK 339
            I     Y  G+PA P  E+ ++ V  S+
Sbjct: 291 SITEPGVYSSGVPASPNREWRKNAVRFSQ 319


>gi|29349615|ref|NP_813118.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|253570016|ref|ZP_04847425.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 1_1_6]
 gi|60390097|sp|Q8A014|LPXD_BACTN RecName: Full=UDP-3-O-[3-hydroxymyristoyl] glucosamine
           N-acyltransferase
 gi|29341525|gb|AAO79312.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840397|gb|EES68479.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Bacteroides sp. 1_1_6]
          Length = 346

 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 168/321 (52%), Gaps = 9/321 (2%)

Query: 19  AQSIGASLLDENFGER--MIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDI 76
           A+ I A +  E  G+    +++ + I     G IS++ + K+   I + ++S ++ ++D 
Sbjct: 5   AKQIAAFIQGEIIGDENATVHTFAKIEEGMPGAISFLSNPKYTPYIYETQSSIVLVNKDF 64

Query: 77  VPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVV 136
           VP        +  D    S A    +L    ++  +   + GI   A++    KI + V 
Sbjct: 65  VPEHEIRATLIKVDNAYESLA---KLL---NLYEMSKPKKQGIDSLAYIAPSAKIGENVY 118

Query: 137 IAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILHSGVR 195
           I   A +     IG  T + P + +G GV+IG  C + +  ++Y    IGN  ILHSG  
Sbjct: 119 IGAFAYIGENAVIGDNTQIYPHTFVGDGVKIGNGCLLYSNVNVYHDCRIGNECILHSGAV 178

Query: 196 IGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQI 255
           IG DGFG+A   +   KI  IG VI++DKV+IGAN+ +DR T+  TII    KIDN VQI
Sbjct: 179 IGADGFGFAPTPNGYDKIPQIGIVILEDKVDIGANTCVDRATMGATIIHSGAKIDNLVQI 238

Query: 256 GHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPA 315
            HN  IG   ++ +QVGIAGS  IG+  + GGQ GIAG++ IGD V + ++SG+   I A
Sbjct: 239 AHNDEIGSHTVMAAQVGIAGSAKIGEWCMFGGQVGIAGHITIGDRVNLGAQSGIPSSIKA 298

Query: 316 GQQYGGMPARPIGEYLRHMVM 336
                G P      Y +  V+
Sbjct: 299 DSVLIGTPPMEPKAYFKAAVV 319


>gi|110804231|ref|YP_687751.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
           [Shigella flexneri 5 str. 8401]
 gi|110613779|gb|ABF02446.1| UDP-3-O-(3-hydroxymyristoyl)-glucosamine N-acyltransferase
           [Shigella flexneri 5 str. 8401]
          Length = 329

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 166/305 (54%), Gaps = 26/305 (8%)

Query: 32  GERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIICSQDIVPFIPKNIPCLLSDK 91
           G+ +I  ++ +  A TG I+++++ K+  ++  C+ASA++ +QD +PF       L+   
Sbjct: 9   GDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKS--AALVVKN 66

Query: 92  PEVSFAIAGSIL--YPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEI 149
           P +++A    IL   PQ            I+P A +    K+ + V I   AV+  GVE+
Sbjct: 67  PYLTYARMAQILDTTPQPAQ--------NIAPSAVIDATAKLGNNVSIGANAVIESGVEL 118

Query: 150 GRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-------IGNSVILHSGVRIGNDGFG 202
           G         +IGAG  +G+N  IGAGS +++++       IG + ++ SG  +G DGFG
Sbjct: 119 GDNV------IIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFG 172

Query: 203 YARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIG 262
           YA    +  KI  IGRVII D+VEIGA + IDRG +DDT+IG    IDNQ QI HNV IG
Sbjct: 173 YANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVIGNGVIIDNQCQIAHNVVIG 232

Query: 263 CGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQY-GG 321
               +   V +AGS  IG   +IGG   I G+++I D V +     V++ I     Y  G
Sbjct: 233 DNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSG 292

Query: 322 MPARP 326
           +P +P
Sbjct: 293 IPLQP 297


>gi|254492659|ref|ZP_05105830.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylophaga thiooxidans DMS010]
 gi|224462180|gb|EEF78458.1| UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase
           [Methylophaga thiooxydans DMS010]
          Length = 336

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 184/332 (55%), Gaps = 12/332 (3%)

Query: 13  IALMKLAQSIGASLLDENFGERMIYSLSPIARASTGDISYIISRKFLNNIEKCKASAIIC 72
           + L ++A++I   L+ ++  + +I  +  +A A+   IS++ + K+   ++   A A+I 
Sbjct: 1   MTLAQIAEAIDGHLIGDS--DYLIEGVGTLATATQQQISFLANSKYKKFLKDTHAGAVIV 58

Query: 73  SQDIVPFIPKNIPCLLSDKPEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIE 132
           +  +   +  N+  + +  P V++A A ++LYP+++          I P A + ++V I 
Sbjct: 59  ASGMGEELNTNV--IEAKDPYVAYAKAATLLYPESLAQSTIHASAWIDPAATVADNVSIG 116

Query: 133 DGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSL-IGNSVILH 191
             V I   AV+  GV      ++G GSVI   V IG +  I +  ++   + IG  VI+H
Sbjct: 117 PHVSIGKGAVIKSGV------HIGAGSVIEQDVYIGEDSRIKSNVTLCRQIQIGQRVIIH 170

Query: 192 SGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDN 251
            GV IG DGFG A       K+  +GRV+I D VEIGAN+ IDRG IDDT+I    K+DN
Sbjct: 171 PGVVIGADGFGIANDNGVWIKVPQVGRVVIGDDVEIGANTTIDRGAIDDTVIHHGVKLDN 230

Query: 252 QVQIGHNVHIGCGCIIVSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLK 311
           Q+QIGHNV IG   +I   VGIAGST IG +