RPSBLAST alignment for GI: 254780771 and conserved domain: cd03353

>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase. It is a bifunctional bacterial enzyme that catalyzes two consecutive steps in the formation of UDP-N-acetylglucosamine (UDP-GlcNAc), an important precursor in bacterial cell wall formation. The two enzymatic activities, uridyltransferase and acetyltransferase, are carried out by two independent domains. The C-terminal LbH domain possesses the acetyltransferase activity. It catalyzes the CoA-dependent acetylation of GlcN-1-phosphate to GlcNAc-1-phosphate. The LbH domain contains 10 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X. The acetyltransferase active site is located at the interface between two subunits of the active LbH trimer.. Length = 193
 Score = 86.7 bits (216), Expect = 9e-18
 Identities = 61/194 (31%), Positives = 90/194 (46%), Gaps = 29/194 (14%)

Query: 131 IEDGVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVIL 190
           I+  V I    V+ PGV +  KT +G   VIG    I ++ +IG G  I +S +    ++
Sbjct: 12  IDGDVEIGVDVVIDPGVILEGKTVIGEDCVIGPNCVI-KDSTIGDGVVIKASSVIEGAVI 70

Query: 191 HSGVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI- 249
            +G  +G   F + R  + + + VHIG     + VE           I  + IGE +K  
Sbjct: 71  GNGATVGP--FAHLRPGTVLGEGVHIG-----NFVE-----------IKKSTIGEGSKAN 112

Query: 250 ------DNQVQIGHNVHIGCGCIIVSQVGIAGS-TYIGDNVLIGGQCGIAGYLKIGDNVQ 302
                 D   +IG  V+IG G I  +  G+    T IGDNV IG    +   + IGD   
Sbjct: 113 HLSYLGD--AEIGEGVNIGAGTITCNYDGVNKHRTVIGDNVFIGSNSQLVAPVTIGDGAT 170

Query: 303 IASKSGVLKDIPAG 316
           IA+ S + KD+P G
Sbjct: 171 IAAGSTITKDVPPG 184