RPSBLAST alignment for GI: 254780771 and conserved domain: cd03354

>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine. This reaction represents a key metabolic point of regulation for the cysteine biosynthetic pathway due to its feedback inhibition by cysteine. The enzyme is a 175 kDa homohexamer, composed of a dimer of homotrimers. Each subunit contains an N-terminal alpha helical region and a C-terminal left-handed beta-helix (LbH) subdomain with 5 turns, each containing a hexapeptide repeat motif characteristic of the acyltransferase superfamily of enzymes. The trimer interface mainly involves the C-terminal LbH subdomain while the dimer (of trimers) interface is mediated by the N-terminal alpha helical subdomain.. Length = 101
 Score = 37.8 bits (89), Expect = 0.004
 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 2/74 (2%)

Query: 119 ISPQAFLGEDVKIEDGVVIAPMAVVYPG--VEIGRKTYVGPGSVIGAGVRIGRNCSIGAG 176
           I   A +G++  I  GV +             IG    +G G+ I   + IG N  IGA 
Sbjct: 25  IGETAVIGDNCTIYQGVTLGGKGKGGGKRHPTIGDNVVIGAGAKILGNITIGDNVKIGAN 84

Query: 177 SSIYSSLIGNSVIL 190
           + +   +  NS ++
Sbjct: 85  AVVTKDVPANSTVV 98