RPSBLAST alignment for GI: 254780771 and conserved domain: cd03358

>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.. Length = 119
 Score = 57.9 bits (141), Expect = 4e-09
 Identities = 33/123 (26%), Positives = 45/123 (36%), Gaps = 19/123 (15%)

Query: 221 IQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCII------------- 267
           I D   IG N  I+     D  IG+N KI + V I   V I     I             
Sbjct: 1   IGDNCIIGTNVFIEN----DVKIGDNVKIQSNVSIYEGVTIEDDVFIGPNVVFTNDLYPR 56

Query: 268 --VSQVGIAGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPAR 325
             + +      T +     IG    I   + IG+   + + + V KD+P      G PAR
Sbjct: 57  SKIYRKWELKGTTVKRGASIGANATILPGVTIGEYALVGAGAVVTKDVPPYALVVGNPAR 116

Query: 326 PIG 328
            IG
Sbjct: 117 IIG 119