RPSBLAST alignment for GI: 254780771 and conserved domain: cd03358

>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.. Length = 119
 Score = 46.0 bits (110), Expect = 1e-05
 Identities = 20/70 (28%), Positives = 26/70 (37%), Gaps = 15/70 (21%)

Query: 123 AFLGEDVKIEDGVVIAPMAV---------------VYPGVEIGRKTYVGPGSVIGAGVRI 167
             + E V IED V I P  V                  G  + R   +G  + I  GV I
Sbjct: 29  VSIYEGVTIEDDVFIGPNVVFTNDLYPRSKIYRKWELKGTTVKRGASIGANATILPGVTI 88

Query: 168 GRNCSIGAGS 177
           G    +GAG+
Sbjct: 89  GEYALVGAGA 98