RPSBLAST alignment for GI: 254780771 and conserved domain: cd04647

>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.. Length = 109
 Score = 59.0 bits (144), Expect = 2e-09
 Identities = 31/104 (29%), Positives = 40/104 (38%), Gaps = 15/104 (14%)

Query: 239 DDTIIGENTKID--NQVQIGHNVHIGCGCIIVS-------------QVGIAGSTYIGDNV 283
           D+  IG    I     + IG NV IG    I               Q   +    IGD+V
Sbjct: 6   DNVYIGPGCVISAGGGITIGDNVLIGPNVTIYDHNHDIDDPERPIEQGVTSAPIVIGDDV 65

Query: 284 LIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAGQQYGGMPARPI 327
            IG    I   + IGD   + + S V KD+P      G PA+ I
Sbjct: 66  WIGANVVILPGVTIGDGAVVGAGSVVTKDVPPNSIVAGNPAKVI 109