RPSBLAST alignment for GI: 254780771 and conserved domain: TIGR03570

>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff. Length = 201
 Score = 56.0 bits (136), Expect = 1e-08
 Identities = 34/117 (29%), Positives = 49/117 (41%), Gaps = 24/117 (20%)

Query: 134 GVVIAPMAVVYPGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSI-YSSLIGNSVILHS 192
             +I P A+V P   IG  T +  G+VI   VRIG N  I  G+ + +  +IG+ V +  
Sbjct: 87  ATLIHPSAIVSPSASIGEGTVIMAGAVINPDVRIGDNVIINTGAIVEHDCVIGDYVHIAP 146

Query: 193 GVRIGNDGFGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKI 249
           GV +                    G V+I + V IGA + I    I    IG    +
Sbjct: 147 GVTLS-------------------GGVVIGEGVFIGAGATI----IQGVTIGAGAIV 180