RPSBLAST alignment for GI: 254780771 and conserved domain: PRK14355

>gnl|CDD|172831 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 459
 Score = 81.3 bits (201), Expect = 4e-16
 Identities = 58/196 (29%), Positives = 85/196 (43%), Gaps = 23/196 (11%)

Query: 133 DGVVIAPMAVVY--PGVEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVIL 190
            GV +      Y   GV IGR T + PG  I    RIG  C+I  G  I    IG+ V +
Sbjct: 253 AGVTLIDPETTYIDRGVVIGRDTTIYPGVCISGDTRIGEGCTIEQGVVIKGCRIGDDVTV 312

Query: 191 HSG-----VRIGNDG----FGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDT 241
            +G       +G+D       + R  +++   V IG  +   K+ +G  S         T
Sbjct: 313 KAGSVLEDSVVGDDVAIGPMAHLRPGTELSAHVKIGNFVETKKIVMGEGSKASH----LT 368

Query: 242 IIGENTKIDNQVQIGHNVHIGCGCIIVSQVGIAG-STYIGDNVLIGGQCGIAGYLKIGDN 300
            +G+ T       IG NV+IGCG I  +  G+    T I D+V +G        + +G N
Sbjct: 369 YLGDAT-------IGRNVNIGCGTITCNYDGVKKHRTVIEDDVFVGSDVQFVAPVTVGRN 421

Query: 301 VQIASKSGVLKDIPAG 316
             IA+ + V KD+P  
Sbjct: 422 SLIAAGTTVTKDVPPD 437