RPSBLAST alignment for GI: 254780771 and conserved domain: PRK14358

>gnl|CDD|172834 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional. Length = 481
 Score = 48.4 bits (115), Expect = 3e-06
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 21/180 (11%)

Query: 147 VEIGRKTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVIL--HS---GVRIGNDG- 200
           V +GR   + PG ++    R+    +IGA S +  S++    ++  HS   G  +G    
Sbjct: 271 VTLGRDVTIEPGVLLRGQTRVADGVTIGAYSVVTDSVLHEGAVIKPHSVLEGAEVGAGSD 330

Query: 201 ---FGYARGVSDIHKIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGH 257
              F   R  + + + VHIG   ++ K     N+ +D G     +   +      V IG 
Sbjct: 331 VGPFARLRPGTVLGEGVHIGN-FVETK-----NARLDAG-----VKAGHLAYLGDVTIGA 379

Query: 258 NVHIGCGCIIVSQVGI-AGSTYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIPAG 316
             ++G G I+ +  G+    + +G  V IG    +     +GD   IA+ S V  D+P G
Sbjct: 380 ETNVGAGTIVANFDGVNKHQSKVGAGVFIGSNTTLIAPRVVGDAAFIAAGSAVHDDVPEG 439